3CCEL

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
150
structure length
145
Chain Sequence
b'TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 145
sequence length 150
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 3cceL02
4.10.990.10 Few Secondary Structures Irregular Molecule: Ribosomal Protein L15; Chain: K; domain 1 Molecule: Ribosomal Protein L15; Chain: K; domain 1 3cceL01
3CCSO 3CCVL 3CMAO 1KC8M 1VQ7O 1VQ4O 1VQ9L 3I55O 1YI2O 3I56L 3CCJL 1Q82M 1YJ9L 1YITO 3CCMO 3G4SO 1KC8P 3CXCK 3G6EO 3CC2L 1YJWO 2OTJO 1Q82P 3CD6O 3CCLL 3CMEO 1VQ5O 1VQ6L 1VQ8O 3CCQO 3CCUL 3CXCN 1VQKO 2QEXO 3CCSL 3OW2K 3CMAL 1S72O 1VQOO 2OTLL 1VQ7L 1VQ4L 3I55L 1YI2L 1VQMO 1YITL 1QVFK 3CCML 3G4SL 1JJ2K 3G6EL 1VQPO 2OTJL 1K9MP 3OW2N 1W2BK 3CMEL 3CPWK 3CCVO 1VQ8L 3CCQL 1QVFN 3G71O 1QVGK 1JJ2N 1YIJO 1M90M 3CC7O 1Q81P 1NJIP 1VQKL 2QEXL 1N8RM 1M1KM 1S72L 1VQOL 2QA4O 1M90P 3CC4O 1W2BN 1K9MM 3CPWN 1VQLO 1Q7YM 1VQML 1N8RP 1M1KP 1YJNO 3CCLO 1VQPL 1YJWL 1KQSK 1QVGN 1Q7YP 1YHQO 1KD1P 3CD6L 1VQNO 3CCEO 3CCRO 1VQ5L 1Q81M 1Q86P 1NJIM 1K73M 1K8AM 1VQ9O 2OTLO 3G71L 1YIJL 3I56O 3CC7L 3CCJO 1KQSN 1K73P 1YJ9O 1K8AP 3CC2O 2QA4L 3CC4L 1VQLL 1KD1M 1YJNL 1VQ6O 1Q86M 1YHQL 1VQNL 3CCEL 3CCUO 3CCRL
chains in the Genus database with same CATH superfamily
3CCSO 5DS4A 3CCVL 3CMAO 1KC8M 1VQ7O 1VQ4O 1VQ9L 3I55O 1YI2O 3I56L 3CCJL 1Q82M 4N06A 1YJ9L 1YITO 3CCMO 3G4SO 1KC8P 3CXCK 3G6EO 3CC2L 1YJWO 2OTJO 1Q82P 3CD6O 3CCLL 3CMEO 1VQ5O 1VQ6L 1VQ8O 3CCQO 3CCUL 3CXCN 1VQKO 2QEXO 3CCSL 3OW2K 3CMAL 1S72O 1VQOO 2OTLL 1VQ7L 1VQ4L 3I55L 1YI2L 1VQMO 1YITL 1QVFK 3CCML 3G4SL 4QDLA 1JJ2K 3G6EL 1VQPO 4WJ0A 2OTJL 1K9MP 3OW2N 5DQTA 1W2BK 3CMEL 3CPWK 3CCVO 1VQ8L 3CCQL 1QVFN 3G71O 1QVGK 1JJ2N 1YIJO 1M90M 2YZSA 3CC7O 1Q81P 1NJIP 1VQKL 2QEXL 4W8KA 1N8RM 1M1KM 1S72L 1VQOL 2QA4O 5DQZA 1M90P 3CC4O 3GODA 1W2BN 1K9MM 3CPWN 1VQLO 1Q7YM 1VQML 1N8RP 1M1KP 1YJNO 3CCLO 1VQPL 1YJWL 1KQSK 1QVGN 1Q7YP 1YHQO 4P6IC 1KD1P 1VQNO 3CD6L 3CCEO 3CCRO 5DLJA 5DS5A 1VQ5L 1Q81M 1Q86P 1NJIM 3NKDA 4XTKA 1K73M 1K8AM 1VQ9O 2OTLO 3G71L 1YIJL 3I56O 3CC7L 3CCJO 1KQSN 1K73P 1YJ9O 1K8AP 3CC2O 2QA4L 3CC4L 1VQLL 5FCLA 1KD1M 1YJNL 1VQ6O 1Q86M 1YHQL 1VQNL 3CCEL 3CCUO 3CCRL 5DS6A
chains in the Genus database with same CATH topology
3CCSO 5DS4A 3CCVL 3CMAO 1KC8M 1VQ7O 1VQ4O 1VQ9L 3I55O 1YI2O 3I56L 3CCJL 1Q82M 4N06A 1YJ9L 1YITO 3CCMO 3G4SO 1KC8P 3CXCK 3G6EO 3CC2L 1YJWO 2OTJO 1Q82P 3CD6O 3CCLL 3CMEO 1VQ5O 1VQ6L 1VQ8O 3CCQO 3CCUL 3CXCN 1VQKO 2QEXO 3CCSL 3OW2K 3CMAL 1S72O 1VQOO 2OTLL 1VQ7L 1VQ4L 3I55L 1YI2L 1VQMO 1YITL 1QVFK 3CCML 3G4SL 4QDLA 1JJ2K 3G6EL 1VQPO 4WJ0A 2OTJL 1K9MP 3OW2N 5DQTA 1W2BK 3CMEL 3CPWK 3CCVO 1VQ8L 3CCQL 1QVFN 3G71O 1QVGK 1JJ2N 1YIJO 1M90M 2YZSA 3CC7O 1Q81P 1NJIP 1VQKL 2QEXL 4W8KA 1N8RM 1M1KM 1S72L 1VQOL 2QA4O 5DQZA 1M90P 3CC4O 3GODA 1W2BN 1K9MM 3CPWN 1VQLO 1Q7YM 1VQML 1N8RP 1M1KP 1YJNO 3CCLO 1VQPL 1YJWL 1KQSK 1QVGN 1Q7YP 1YHQO 4P6IC 1KD1P 1VQNO 3CD6L 3CCEO 3CCRO 5DLJA 5DS5A 1VQ5L 1Q81M 1Q86P 1NJIM 3NKDA 4XTKA 1K73M 1K8AM 1VQ9O 2OTLO 3G71L 1YIJL 3I56O 3CC7L 3CCJO 1KQSN 1K73P 1YJ9O 1K8AP 3CC2O 2QA4L 3CC4L 1VQLL 5FCLA 1KD1M 1YJNL 1VQ6O 1Q86M 1YHQL 1VQNL 3CCEL 3CCUO 3CCRL 5DS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS O;  3CCV L;  3CMA O;  1KC8 M;  1VQ7 O;  1VQ4 O;  1VQ9 L;  3I55 O;  1YI2 O;  3I56 L;  3CCJ L;  1Q82 M;  1YJ9 L;  1YIT O;  3CCM O;  3G4S O;  1KC8 P;  3CXC K;  3G6E O;  3CC2 L;  1YJW O;  2OTJ O;  1Q82 P;  3CD6 O;  3CCL L;  3CME O;  1VQ5 O;  1VQ6 L;  1VQ8 O;  3CCQ O;  3CCU L;  3CXC N;  1VQK O;  2QEX O;  3CCS L;  3OW2 K;  3CMA L;  1S72 O;  1VQO O;  2OTL L;  1VQ7 L;  1VQ4 L;  3I55 L;  1YI2 L;  1VQM O;  1YIT L;  1QVF K;  3CCM L;  3G4S L;  1JJ2 K;  3G6E L;  1VQP O;  2OTJ L;  1K9M P;  3OW2 N;  1W2B K;  3CME L;  3CPW K;  3CCV O;  1VQ8 L;  3CCQ L;  1QVF N;  3G71 O;  1QVG K;  1JJ2 N;  1YIJ O;  1M90 M;  3CC7 O;  1Q81 P;  1NJI P;  1VQK L;  2QEX L;  1N8R M;  1M1K M;  1S72 L;  1VQO L;  2QA4 O;  1M90 P;  3CC4 O;  1W2B N;  1K9M M;  3CPW N;  1VQL O;  1Q7Y M;  1VQM L;  1N8R P;  1M1K P;  1YJN O;  3CCL O;  1VQP L;  1YJW L;  1KQS K;  1QVG N;  1Q7Y P;  1YHQ O;  1KD1 P;  3CD6 L;  1VQN O;  3CCE O;  3CCR O;  1VQ5 L;  1Q81 M;  1Q86 P;  1NJI M;  1K73 M;  1K8A M;  1VQ9 O;  2OTL O;  3G71 L;  1YIJ L;  3I56 O;  3CC7 L;  3CCJ O;  1KQS N;  1K73 P;  1YJ9 O;  1K8A P;  3CC2 O;  2QA4 L;  3CC4 L;  1VQL L;  1KD1 M;  1YJN L;  1VQ6 O;  1Q86 M;  1YHQ L;  1VQN L;  3CCE L;  3CCU O;  3CCR L; 
#chains in the Genus database with same CATH topology
 3CCS O;  5DS4 A;  3CCV L;  3CMA O;  1KC8 M;  1VQ7 O;  1VQ4 O;  1VQ9 L;  3I55 O;  1YI2 O;  3I56 L;  3CCJ L;  1Q82 M;  4N06 A;  1YJ9 L;  1YIT O;  3CCM O;  3G4S O;  1KC8 P;  3CXC K;  3G6E O;  3CC2 L;  1YJW O;  2OTJ O;  1Q82 P;  3CD6 O;  3CCL L;  3CME O;  1VQ5 O;  1VQ6 L;  1VQ8 O;  3CCQ O;  3CCU L;  3CXC N;  1VQK O;  2QEX O;  3CCS L;  3OW2 K;  3CMA L;  1S72 O;  1VQO O;  2OTL L;  1VQ7 L;  1VQ4 L;  3I55 L;  1YI2 L;  1VQM O;  1YIT L;  1QVF K;  3CCM L;  3G4S L;  4QDL A;  1JJ2 K;  3G6E L;  1VQP O;  4WJ0 A;  2OTJ L;  1K9M P;  3OW2 N;  5DQT A;  1W2B K;  3CME L;  3CPW K;  3CCV O;  1VQ8 L;  3CCQ L;  1QVF N;  3G71 O;  1QVG K;  1JJ2 N;  1YIJ O;  1M90 M;  2YZS A;  3CC7 O;  1Q81 P;  1NJI P;  1VQK L;  2QEX L;  4W8K A;  1N8R M;  1M1K M;  1S72 L;  1VQO L;  2QA4 O;  5DQZ A;  1M90 P;  3CC4 O;  3GOD A;  1W2B N;  1K9M M;  3CPW N;  1VQL O;  1Q7Y M;  1VQM L;  1N8R P;  1M1K P;  1YJN O;  3CCL O;  1VQP L;  1YJW L;  1KQS K;  1QVG N;  1Q7Y P;  1YHQ O;  4P6I C;  1KD1 P;  1VQN O;  3CD6 L;  3CCE O;  3CCR O;  5DLJ A;  5DS5 A;  1VQ5 L;  1Q81 M;  1Q86 P;  1NJI M;  3NKD A;  4XTK A;  1K73 M;  1K8A M;  1VQ9 O;  2OTL O;  3G71 L;  1YIJ L;  3I56 O;  3CC7 L;  3CCJ O;  1KQS N;  1K73 P;  1YJ9 O;  1K8A P;  3CC2 O;  2QA4 L;  3CC4 L;  1VQL L;  5FCL A;  1KD1 M;  1YJN L;  1VQ6 O;  1Q86 M;  1YHQ L;  1VQN L;  3CCE L;  3CCU O;  3CCR L;  5DS6 A; 
#chains in the Genus database with same CATH homology
 3CCS O;  5DS4 A;  3CCV L;  3CMA O;  1KC8 M;  1VQ7 O;  1VQ4 O;  1VQ9 L;  3I55 O;  1YI2 O;  3I56 L;  3CCJ L;  1Q82 M;  4N06 A;  1YJ9 L;  1YIT O;  3CCM O;  3G4S O;  1KC8 P;  3CXC K;  3G6E O;  3CC2 L;  1YJW O;  2OTJ O;  1Q82 P;  3CD6 O;  3CCL L;  3CME O;  1VQ5 O;  1VQ6 L;  1VQ8 O;  3CCQ O;  3CCU L;  3CXC N;  1VQK O;  2QEX O;  3CCS L;  3OW2 K;  3CMA L;  1S72 O;  1VQO O;  2OTL L;  1VQ7 L;  1VQ4 L;  3I55 L;  1YI2 L;  1VQM O;  1YIT L;  1QVF K;  3CCM L;  3G4S L;  4QDL A;  1JJ2 K;  3G6E L;  1VQP O;  4WJ0 A;  2OTJ L;  1K9M P;  3OW2 N;  5DQT A;  1W2B K;  3CME L;  3CPW K;  3CCV O;  1VQ8 L;  3CCQ L;  1QVF N;  3G71 O;  1QVG K;  1JJ2 N;  1YIJ O;  1M90 M;  2YZS A;  3CC7 O;  1Q81 P;  1NJI P;  1VQK L;  2QEX L;  4W8K A;  1N8R M;  1M1K M;  1S72 L;  1VQO L;  2QA4 O;  5DQZ A;  1M90 P;  3CC4 O;  3GOD A;  1W2B N;  1K9M M;  3CPW N;  1VQL O;  1Q7Y M;  1VQM L;  1N8R P;  1M1K P;  1YJN O;  3CCL O;  1VQP L;  1YJW L;  1KQS K;  1QVG N;  1Q7Y P;  1YHQ O;  4P6I C;  1KD1 P;  1VQN O;  3CD6 L;  3CCE O;  3CCR O;  5DLJ A;  5DS5 A;  1VQ5 L;  1Q81 M;  1Q86 P;  1NJI M;  3NKD A;  4XTK A;  1K73 M;  1K8A M;  1VQ9 O;  2OTL O;  3G71 L;  1YIJ L;  3I56 O;  3CC7 L;  3CCJ O;  1KQS N;  1K73 P;  1YJ9 O;  1K8A P;  3CC2 O;  2QA4 L;  3CC4 L;  1VQL L;  5FCL A;  1KD1 M;  1YJN L;  1VQ6 O;  1Q86 M;  1YHQ L;  1VQN L;  3CCE L;  3CCU O;  3CCR L;  5DS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...