3CCJI

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 11
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3ccjI00
2K3FA 2E35A 1YHQI 2E34A 1YI2I 2ZJQF 1ACIA 4UY8I 3G71I 3CCJI 3CJTB 3CCMI 1YITI 2ZJPF 2NXNB 3CC2I 2H8WA 4V19K 4IOCF 5DM7F 1VQ5I 3CD6I 1YIJI 3I55I 3CC7I 1FOYA 2JQ7A 1HC8A 3DLLF 1S72I 3CCUI 1VQ4I 3G4SI 5JVGF 3J7ZI 1VQNI 3G6EI 3CF5F 1VQKI 1VQ7I 1YJWI 1FOWA 4IOAF 3CCVI 5DM6F 2OTLI 1VQ6I 4IO9F 3CMEI 3PIPF 1MMSA 1YJNI 1VQ9I 1VQPI 1Y39A 5GAGJ 1QA6A 5GAHJ 3CC4I 1VQ8I 2OTJI 3J7YJ 1YJ9I 2FOWA 3CCQI 2QA4I 3CCRI 5GADJ 3CCLI 5GAEJ 2E36A 1VQOI 3PIOF 2QEXI 1FOXA 1VQMI 3I56I 2ZJRF 3CCSI 3CMAI 3CCEI 1VQLI
chains in the Genus database with same CATH superfamily
2X85A 2VBYA 4FE7A 3MKYB 3CESA 3VPRA 4A69C 2VQLA 3CUQC 4XRSA 1S7OA 2HOTA 1T6SA 4IVNA 4ZZLA 2EZKA 1K6OA 4UVBA 2CUFA 3I64A 2DMUA 1K78A 3I59A 2R0QC 3ECOA 3M9AA 1OCTC 3LSRA 3HPGA 5F1RA 3S93A 3HRMA 5E3NA 1YITI 2ZJPF 2FBIA 2NXNB 5K7HA 4G6DA 1XCBA 4FHTA 4KJZA 2H8WA 2D45A 2XF5A 3RI4A 4R1HA 4I98B 3KZYA 2LYCA 3UR3C 3ABLH 4CUGA 5BMZA 4CCMA 3A0BC 4BJTA 3NRVA 3LSTA 3RTRA 3QPSA 1NK2P 3LA2A 4EJTA 1XG1A 2RGVA 4IF4A 4IPAA 2ACJA 2AQFA 3E0JB 2VC1A 5J4YA 2ZFUA 3GTGJ 2W85A 5BQTA 3TO6A 3S2WA 5DDGA 1S72I 3S1QJ 2F48A 3VB2A 4DJAA 1IV6A 4RDUA 2LF8A 2W4SA 2JRMA 4ASNA 1VQNI 3FXQA 4HDVA 1SD6A 4PCQA 4A2UA 3NWTA 4KA4A 1QZEA 2O7OA 1OLTA 2ZCWA 3MVPA 3ZMTA 4YFKF 4LLGF 5IYDJ 2RVCA 3BOQA 4HLXA 4WWCA 4HF1A 3CZ6A 4CO8A 3TW6A 4LMYA 3PFYA 3PQKA 2P7CB 2E1MB 2OF7A 3WE2A 1A35A 4U7BA 2GQQA 3U1KA 1VQ6I 1I50J 3PIPF 1D0XA 3BQZA 4A12A 2A3SA 4RGXA 1ON2A 4KIFA 1REPC 2A69F 4GYIA 2IXSA 1FBSA 3IAM2 1R5ID 3Q0VA 4GO1A 4YFNF 1QBJA 3W6VA 4BNCA 2R7TA 1P4WA 3CC4I 3IH3A 1J2XA 2LK2A 4BE2A 2ZC2A 2V1XA 1TBXA 3GTPJ 3MN2A 2F4OB 2F5VA 2VT3A 4JK1X 1W36D 5HS8A 2ID3A 2EFWA 1BOAA 1XPXA 5HDNA 3OS1A 4PSXA 4KMFA 3OL4A 3DEEA 3QP6A 4CCKA 3ERED 3OYAA 4RB2C 1SD5A 1MH4A 4UUTA 1W5CC 3CDIA 2DPUA 3FISA 2HVSA 2W24A 3WU0A 3OYBA 2UXXA 3ZOBA 2EZHA 1U8RA 1FP1D 1PYVA 4E7KA 4BS9A 2LF7A 3TOAA 3F6OA 2E7WA 3H0GJ 2KRHA 3S16J 1G6NA 2DMQA 3GUDA 2AHQA 1KQ0A 1WKMA 3FK6A 4XRSG 1QNTA 4DYCA 5KNLA 1Y0NA 3MZ8A 1ACIA 3QU3A 2ECCA 4BKXA 4HNUA 1LEBA 1OFCX 1VF9A 2PEXA 3KEYA 5BPDA 1IV8A 3IH4A 1IAWA 4DW6A 5J1RA 1V5EA 2ELHA 4OWRB 3W2WA 4BYYA 3DPUA 3ZMZA 3T1BA 4OINF 2JWTA 3WHBA 3I55I 1G4DA 2A05A 2NAZA 3ZQCA 3AFHA 1LB2A 3OYHA 3O6BB 3K9TA 4HV6A 2EV0A 3R0AA 5FFZA 1ETYA 1OR7C 4ESBA 5GTIC 2B7EA 3L2QA 2Y0MA 1UZCA 2RDPA 3GO5A 1OCRH 3A0HC 5AIQA 1YO5C 2LMDA 3MKWB 4L5EA 3KEQA 2ELJA 1YIOA 5LGTA 5KVRA 4W1UA 3QPHA 3DCFA 2L2OA 1V55H 3K4KA 3G3ZA 2DA3A 3LWFA 2JZYA 2P5VA 2XVCA 3P5JA 2UV1A 2NRAC 2ZSHB 1LFUP 3KLNA 1TW2A 3S1RJ 3GLLA 1JKOC 1R58A 2WBMA 4G12A 5LEJA 2Z5UA 1CF7A 3HEFA 1RR7A 2GM4A 2HKXA 2LBFA 2CV2A 3L1PA 3EQLF 2K85A 4F92B 1EF4A 2K9MA 2OAZA 1VNDA 1Z3YA 5H2FC 4HA8A 1BI1A 3AG2H 4I01A 1Z3XA 4BXFA 4EM0B 1BN5A 1RUOA 2FXAA 4XRFA 1IXCA 3RPUD 5FKNA 4RB1A 3WTZA 1ETOA 1D0YA 1EH8A 5CVIA 1Z91A 2V1DA 4EEFG 2A6TA 3Q3SA 4LD5A 1B9NA 3VOEA 1FYKA 1D5YA 4XBFA 1HF0A 4I2OA 3TO9A 5E17F 3ZQIA 1WJAA 1SFOJ 4XLHA 2ISYA 2DFFA 4B43A 4BJ6C 5FFXA 3GCMA 2G7HA 1SFKA 2XGCA 3JRDA 4A3EJ 3FXUA 2F2EA 2LSOA 4DZJA 2DTRA 4RAZA 3EUAA 2CG4A 2EFPA 1I3QJ 1TT0A 3DPTA 4XL9A 4IXAA 1DGRM 2QBYA 2B0LA 2XAHA 4LG0B 1BI3A 1MMNA 4G6QA 1S5LC 3M8EA 4L0YB 3HUGB 3N4MA 1IO2A 2KP6A 1UB9A 2Y9YA 3PL8A 2X6OA 2QUFA 3MKZA 2MW8A 3BZ6A 1FP2A 2ZSIB 5ILVA 3OYKA 3JRGA 1KONA 1JT6A 3R0JA 2DYRH 3KEOA 4WXDA 4NNJA 3S3MA 3MAJA 4D5CA 1YIJI 3DTIA 2NVYJ 4A5MA 2CUJA 2V6EA 4A93J 3IWFA 3T0YA 4IHTA 4L9VA 1JKRC 2WAQN 4C2MJ 4E7LA 3CJNA 1P6RA 3RDIA 3K6GA 5CQEA 2P5KA 5DCMA 2F5EA 3HPHA 4IX7A 2BY0A 2JUGA 4AUXA 3H5NA 2M8EA 2KDOA 1NG6A 3TO7A 5IP6A 5LFAA 2VT2A 2BYVE 2DT7B 4KFCA 3C3WA 3H1CA 1ZN2A 2QQAA 1KQ8A 4YEJA 2VE8A 2FBHA 3CJQB 2P6TA 2K4BA 4I02A 2KIUA 2WB1N 3H3UA 2XROA 4OIOF 4MFEA 5FJ8J 2O3FA 4HQMA 4LOCA 2GZWA 2DT5A 2OC6A 2R7RA 3W3CA 1B6AA 4J19A 1KGSA 1Z9CA 1MSEC 1FSHA 4RLFA 3SZPA 2EFQA 4ZJZA 3HRSA 1HCRA 1JHFA 4A3FJ 3AG1H 5ILSA 2WC2A 3K1PA 2LBFB 4BH9A 2KISA 3ML6A 5L3GA 4HNTA 5K5RA 1R1UA 2IW5A 2XC7A 1T8IA 1S29A 5LEKA 4D0PA 1POGA 1IN4A 2GWRA 4EVIA 3F8MA 1HSJA 1MNDA 3BPXA 3C2BA 4CH7A 1WJ5A 2YU3A 1I39A 4MLOA 1IUYA 2BE5F 4C2UA 4HQEA 2ZFWA 2JJ7A 1AA7A 3ABKH 2L7FP 3E6DA 1AKHB 2V6CA 1A31A 1XCVA 4U7DA 1ZR2A 3F22A 4Y7NJ 4CDGA 5HOOA 3FXJA 2E5ZA 3R60A 5KAFC 3I4NJ 1CQTA 4ZZDA 1VQLI 2GXBA 1IXSB 1E3PA 1FSEA 2E2JJ 2FEZA 3WG7H 3JRFA 4P55A 3S1NJ 2IS1A 2PI0A 4KT6A 2JSCA 2R7UA 1LKXA 1RPWA 2XGXA 2Z33A 2DI3A 1T0FC 2QBYB 1BR1A 4A3KJ 2CUZA 4X0GA 3BR2A 1ONVA 2ADUA 4XLNF 5K5QA 4CCOA 1GV5A 3F6VA 1QRYA 1X58A 3BR1A 4BQOA 3I9V2 5KK1A 2JRTA 1FX7A 3PNVA 5IT9Z 1KQ9A 3TDZC 1J75A 3KX2A 4RB3C 1D1BA 2FD5A 4AYBN 1WJDA 2JSPA 2XUBA 4PJ0C 2O61A 2BBYA 3ZR8X 1ZREA 2KIMA 4PDKA 1GLNA 1IDYA 1S7AA 2MD0A 5JHUA 1JGGA 2MBFA 4A3DJ 4RAYA 3C1DA 4PSWA 3GFIA 4HRIA 3RYRA 4KISA 2IS4A 4B47A 3ZQGA 4MFDA 3S1MJ 3N97A 1STZA 2OA4A 2L9NA 2VB6A 2ZMEA 3F3XA 2ME6A 4II3A 1MNEA 4B3XA 2DYSH 3D5LA 1KU7A 4ZYDA 3WTSC 4XIDA 5ICGA 2HS5A 4ON0A 4RS8A 3M7GA 5D5VB 1J5YA 2WV1A 4XKVA 4P9UA 4ZYAA 1YJWI 1G3YA 3ZXSA 2A5WA 1WH5A 5FLXK 3TBIA 4PFOA 2IEKA 2K40A 2KT0A 2VUMJ 4IO9F 2DOAA 2HTSA 3FWEA 1TP4A 4N0BA 1IXRC 1B8IA 1HLVA 1E3OC 3ASOH 1R5GA 4YG2F 4XICA 3G1MA 4B44A 4NQWB 3BY6A 3PNTA 2L54A 1UHMA 5F27A 2RV8A 3HM5A 4BQQA 2VI6A 2ZXHA 2VBZA 3C2HA 1ZKGA 4JP0A 2GIVA 5E79C 3KCCA 4UXNA 2LG4A 2G0EA 4A3IJ 5FKKA 1TWCJ 3HSEA 1Y8RB 5HS7A 2OUMA 4EMSA 2R5YA 1SC7A 3HOWJ 1B59A 4A3CJ 2EQRA 3CMAI 2DU9A 1B1BA 4HPQA 4IRHA 1PVEA 3HBLA 5K7ZA 5CLSA 4K2EA 1ULYA 2CFXA 2E35A 1IGNA 3QYBA 4B3AA 2ESNA 1MW7A 1ZGWA 2CU7A 2PX9A 3SEQA 3KP3A 2CW7A 4IHSA 2BHYA 2VN2A 1U0JA 3ZMDA 1K4SA 1ETXA 5ILUA 3WTVC 3JRHA 1FYMA 1USSA 3WGGA 4W97A 4LITA 3DKYA 2DA6A 2W1OA 4ZTFA 1X1BA 2E7XA 1ZAOA 4QWQA 3FKIJ 4OMYA 1IRXA 3F8CA 2L4AA 4AIHA 3KLOA 4XLFA 4Y15A 2HWVA 4LFUA 4UUVA 1ENHA 3SXYA 3PO3J 2Z16A 2LNBA 1R49A 4M73A 1F36A 1Y56A 2J5PA 1JTXA 3BJ6A 4HX7A 3REOA 3FMQA 4KIBA 1MJ9A 4E4HA 2GOXB 2QQBA 5HLTA 1BR2A 1S7EA 1H89C 3FM5A 4BHCA 1U6GA 3KETA 2Q2EA 1HQCA 1JUPA 1E3HA 5LRSA 2EPFA 4IQJA 1UMQA 2FMYA 3G6EI 1FC3A 1QPMA 1VQKI 2CS3A 3L2VA 4HBLA 5CVUA 2IPQX 1NK3P 5KAIC 3GXOA 4GFBA 1P7JA 4M9SA 3K0LA 1FIPA 4I76A 2XSJC 3BTIA 4UVAA 1X4OA 5A2QZ 3GTJJ 2V9KA 4OIPF 2WA0A 3H5AA 4QSHA 4KYWA 3UNGC 3E6BA 3I54A 3LNQA 3KFWX 2FF4A 2XPVA 1U3EM 1ZGJA 2WB1A 5L3CA 5TRDA 3B6AA 3P9IA 3CDLA 3CLOA 4LK1F 3ZQ7A 2R7VA 4HDUA 4JYKA 4DGWB 3CUQA 2QYOA 2E71A 1J7KA 2R5ZA 4E7HA 2FOWA 3CCQI 2OQRA 2JT1A 1T2KA 2NNNA 3OIQA 1ZGAA 4U0YA 4HG2A 2HGCA 3RZOJ 3FDYA 2OCEA 1MDMA 1OQYA 4H0EA 5EG0A 1XDSA 1LVKA 1P4AA 2L7ZA 2ZXWH 3JW4A 4D1QA 5K1YA 1FOXA 3M07A 3I56I 2IJLA 4PJJA 4PJLA 4C30A 3QOPA 4B8XA 1P7IA 2MA3A 4A6DA 4WXCA 4LGWA 2K3FA 2ESHA 4NDLA 2X51A 3MWMA 4QTRA 3V4GA 3D1NI 2JN6A 1O3RA 2H27A 2NVQJ 3WG9A 5HDGA 3E3VA 2KLOA 4CZCA 2QKLB 3L00A 4M6YA 4Y13A 4KNYA 1VI0A 2HDCA 4EQQA 1SVOA 4FASD 5ICEA 3I3LA 2X6YA 3ZN1A 1TNTA 1N75A 2ELKA 3LSIA 4D5FA 4BDYA 3OS2A 4BXXJ 3BQYA 2A6HF 2XAFA 1T38A 2IAIA 2XIGA 4ENNA 5IT9K 3M1CA 2VJIA 3NAUA 1GVDA 1OKRA 5EZGA 2LFBA 2HTJA 1Z67A 2CW8A 2EZIA 1F43A 1I6XA 1LFBA 1U78A 4HLYA 1WJBA 3CC7I 1I27A 1JKQC 3DEWA 1BM9A 3BLYA 2L9VA 3HC7A 4Q47A 2XAQA 3I58A 2BY1A 4R8HA 3RIRA 4AYBA 2IVMA 3IWZA 1U5TB 3E7LA 3DWLE 5JLXA 2VE9A 4JX4A 3M3YJ 1SFUA 2JA5J 1OCOH 2K27A 4M3EA 4QLCU 4UUSA 3A01B 2OZUA 2X6XA 1W7PB 4BHPA 2M9HA 2BOLA 1SD7A 3P9CA 1FWZA 4AIJA 3ELKA 1W5TA 2MLKA 2Y75A 1FZPB 5FKOA 2IRFG 1R36A 2CQXA 4IOAF 3C2GA 4Q4ZF 4XOPA 3JTGA 3I71A 1HKQA 2XKPA 3OYDA 1X1CA 1XGMA 4FQGA 4NC7A 4AM3A 3S3OA 3M1EA 3U9GA 3HOTA 1KYZA 1SMYF 3E97A 1I6HJ 4CICA 1I1GA 3K1NA 2YX4A 1Z7LA 4BEHB 2E5NA 2Y9ZA 2W25A 2JA7J 4MNUA 2WTEA 3G1OA 2R5ZB 5JFRA 2HYFA 4BY1J 5C4XJ 1LPQA 3H9JA 2GAUA 3ZQFA 3CCYA 1U9OA 1UHSA 1QHGA 3IAS2 3WGIA 1MBKA 4S04A 3GFJA 1RC9A 3BG5A 3GYHX 1XSDA 2EK5A 2DOFA 2LKXA 2DQRA 3JR9A 2M4GA 3C18A 3H3ZA 2VXDA 2O03A 2O8KA 1XC5A 1MD0A 1RESA 1XN7A 1M1EB 1XSVA 3GTMJ 2L9RA 3O3KA 1GT0C 3D5SC 1TWFJ 5IOZA 1GXQA 1OR7A 4RM3A 4B09A 3GTKJ 2OU2A 5L3EA 4XLPF 2M7BA 2IA0A 3BZKA 3O8GA 5H6RA 4LK0F 1ODDA 3AL0B 2HOEA 4IRIA 2I5UA 2VJ4A 1BBYA 1PP8F 1YE9A 1JGSA 1G3WA 4V19K 2HQAA 1YRNB 3S14J 3ABTA 2R7SA 5LHIA 2VKEA 2BEOA 2LRDA 1T56A 2PFBA 5GP9A 3BG7A 1P4XA 4NBQA 1MBGA 1HKSA 1OYWA 1Z1DA 3KP4A 4CXFA 1K78B 3CQZJ 3I59B 1IRGA 2JK3A 2Q1ZB 2DN0A 3DLLF 4AVZA 1IF1A 4U0VA 2VASA 3LSGA 2BVMA 2WWYA 2GA2A 2R7WA 3SZGA 4I6ZA 2XHKA 5LHHA 3HYIA 2H6BA 3SQNA 4BL0B 2LOOA 2R7DA 3LL7A 2F4IA 4IKFA 1T95A 4Z6YA 3CMMA 4DIQA 1P9QC 3RJPA 1BIAA 1WQ2A 4OAZA 5CVVA 3L2CA 3CF2A 5C44J 4ZH4F 2L02A 4F91B 4XKBA 1ZARA 3K69A 1HA8A 4CZZA 2JVGA 3HXLA 2QSFX 2XAJA 3VWBA 4CGZA 1Y6IA 5A2QK 3BROA 1XGSA 3H9GA 5IT3A 4LJZF 3DXJF 1KU3A 3KE2A 3LSPA 1TWHJ 2GOMA 2HQ5A 2LP0A 4HF0A 2XB5A 3L09A 1WCMJ 4DBQA 1YLFA 1B4AA 4HX4A 3BCBA 5FLXZ 1A6IA 3K4LA 2LC2A 1BC8C 5EEHA 1UAAA 1AHDP 1KA8A 4ENMA 5IYCJ 1MZBA 5EDNA 2VC0A 5GADJ 4CA0A 2CQKA 3OMYA 2BHZA 1WH7A 4RB0A 5FKMA 5IYBJ 4GDFA 1HW2A 5D6FA 1S6LA 3PNYA 2M4KA 1JJ6C 3OWTA 2KIQA 2QF7A 2XV4S 4YFXF 4PFPA 1ZK8A 3L9FA 1XMXA 3CCEI 4L9TA 3BR5A 3GTLJ 4M71A 2BW3A 2DFIA 3DQVC 5C3EJ 4HNVA 3IKTA 2DMTA 2UUZA 4O5VA 3PSIA 1DU0A 1A04A 3HDDA 1YHQI 2KIFA 3V8KA 3S15J 2WY7Q 1IN6A 4EV0A 4ZDPA 4OU0A 1MKMA 2VQCA 4QIWN 4KICA 4KT5C 1SMTA 3DV8A 4A3BJ 1JI8A 3SYTA 3IHUA 3TP0A 4A0YA 1QVTA 2IGKA 2IT0A 2L3DA 2PQ8A 3MD2A 3VSLA 4I0BA 3GWZA 3M8JA 1SEUA 2P6SA 4XSXF 2BVLA 3S3NA 3SFZA 4IOCF 4HYEA 1FMWA 3BTLA 4D7MA 2NVXJ 2PJRA 3HOVJ 1EV7A 1YS7A 3HTSB 5BOXA 4ZTJA 1ITYA 2HFHA 3JRBA 2DA7A 1ZG5A 3K1MA 2XAGA 1R5HA 3MCZA 3GEZA 4CCNA 1OYIA 2R7XA 1HW5A 5M3MJ 1T98A 3ZQHA 5J8CA 1BL0A 1RRJA 1JTYA 2K9LA 3FF5A 1WFXA 1Q1VA 4J01A 1AWCA 1LVAA 4R79A 5GTHC 3ZQLA 5B5EC 1Z21A 5HNFA 4ENJA 1HXDA 5DV5A 2XGDA 4M6XA 3JSPA 3J80Z 1X3ZB 2UZKA 2XASA 2HPMA 2OZ6A 4N4OB 5DM6F 4M74A 4GYGA 1F5TA 2K4JA 3BDDA 2PMZN 2HXIA 1FTTA 4IHWA 1W5SA 5KCMA 5CQGA 1R71A 1X1AA 1X3UA 2HYGD 2V4JC 1BR4A 2OD5A 1XX5A 1X2MA 5J4VA 4ESJA 1WI3A 3B73A 2FSWA 2RNGA 5JI6A 1T0FA 2OPTA 3F0CA 3H92A 3DKXA 4FX4A 1W36C 3U2RA 1BI2A 2KL4A 2FNAA 3LFKA 3QYFA 3C7JA 4II2A 1G3SA 1CF7B 2XRNA 2EIMH 3QOEA 4TV7A 1ZG3A 3CP2A 3JAMZ 2HI3A 1B72A 2EZLA 1A6QA 2A68F 1OMIA 4A3MJ 3QODA 4B1RA 4DYRA 3ZN0A 1SFXA 1LEAA 5EEGA 3GVAA 4V2FA 2H1KA 1O57A 4KDPA 1DU6A 4JOMA 1OISA 1FJLA 1IUFA 3HOUJ 1EH6A 3WTYC 1N78A 4PUSA 4EGYA 4JQFA 5GPCA 3LAPA 3J81Z 2QCOA 3CCMI 4L5JA 3EPZA 2Z2SB 3KIOA 2PMUA 2JTVA 4FT8A 3T8RA 3RKQA 1HDDC 2X0LA 2Y31A 4LLLA 4G7HF 2CQNA 4I09A 1D8KA 5EJCA 1SAXA 1BOBA 1ZRCA 2MYSA 2P4WA 4I0AA 5FKLA 2FE3A 2DBBA 2ME0A 4U0WA 1PUFA 3S32A 2HU9A 1OYYA 1Y1WJ 3QPLA 3JREA 3HRUA 1WGXA 3OR1C 2M45A 4MGRA 1I5ZA 2W00A 2EB7A 1R23A 4NB5A 4EM1A 2JPBA 2VODA 5IP7J 4NHJA 1XDUA 2ICWG 2A61A 5EZHA 1PUEE 2EWNA 2K86A 2VIXA 3HHHA 5DCFA 3IC7A 3CTAA 1MMDA 1WZ2A 4CYDA 4ETSA 5TISC 1D5VA 5DYMA 1WHUA 3EUHC 1VQ7I 2E2HJ 5DUKA 1JKPC 3S2DJ 4XM3A 1E17A 3UKGA 3KYLA 3PUBA 4OAYA 4BU2A 2O6GE 5HLGA 4BAYA 2EH3A 2L4MA 3QRFF 3MQ0A 5F0FA 1MNMC 1RZ4A 1U8BA 2COBA 1O3QA 2Y69H 4BHBA 5DCMB 3L2WA 4A0ZA 3HOZJ 2K9QA 1Y39A 1E0EA 2STTA 3KZZA 2Q8KA 4DQ2A 2KMUA 3FZVA 1LE8A 4XONA 3WE3A 5D8KB 5D5WB 1J0RA 5JHFA 1RUNA 5HNHA 1W7PD 5CPRB 2W84A 3PSFA 2BXYA 3E6CC 1YJ9I 1JE8A 3CO6C 3OOPA 2QA4I 4WXHA 4E7IA 2F5FA 2V9PA 2OJED 5LHGA 5GAEJ 3ZMSA 3SFIA 2CJJA 3JRCA 2E36A 1NH3A 2DOEA 2QWWA 3LSHA 2ZJRF 4J00A 3CJRB 1BC7C 1Z6TA 1K83J 3DEUA 1MMGA 1YS6A 2FRHA 2VQHA 3Q9SA 2VOOA 1JHHA 2BGCA 4A0XA 2DK5A 3O8HA 1TWAJ 2NOJB 4Y3OA 3DP7A 2CW0F 3EYIA 1FYLA 3K70D 2KQRA 2DK8A 1OCPA 5ED4A 3HB9A 1WI9A 2MLGA 3WGHA 4BACA 2D1HA 1MBJA 4IJAA 2TDXA 4OMZA 2CWEA 3E1SA 1P92A 3VDXA 4E7JA 1ZH5A 3VODA 1JUMA 2K7LA 3SDBA 4Y17A 2C6YA 2L7MP 4KITB 3HOYJ 4UHTA 3GFMA 3CO7C 2VONA 2DA1A 1E2XA 4CYCA 2QQ9A 4UB8C 5EGOA 2EBIA 3K2AA 3A4CA 3ECHA 4E6KG 1BJZA 1IW7F 1QU3A 4YRVA 1KZHA 1RNLA 1Z7UA 4XQFA 2DXIA 1YW9A 2DPDA 5B3SH 3PM1A 4KMUX 3JCUC 3PUFA 3KP7A 1NTCA 4XOTA 3KP6A 2R7ZJ 4Q48A 3H0DA 4N9HA 2E1CA 1HC8A 3MZYA 1K61A 4G6TB 1X1DA 5DD4A 5DS9A 1ZRDA 1VQ4I 2KRCA 1KYWA 4BJ5C 2M1BA 3NQOA 4ZDOA 3U1DA 3O2PE 5J1YA 3MMYB 1EKEA 2FUG2 3Q0WA 4ZDLA 3VYTB 4JX6A 3GZ5A 3P7NA 5TJJA 3B02A 4G94A 2ZJ2A 5DEQA 4BQNA 4KIGA 3SDGA 1MJAA 3GBGA 3OYLA 2Y2ZA 3J80K 1O7LA 3W6KB 1SANA 2VBXA 2MABA 1X19A 5M3FJ 2OTLI 1RI7A 3TDUC 4P9FA 2ZMEB 3KP5A 1FOKA 4A3LJ 4P1WA 2L7KA 4BE1A 3V8LA 5M5WJ 4Y52J 4P5OA 1ZR4A 3LA7A 4M6VA 2R92J 4UNOA 2B9SA 1ERDA 3HKZN 2PMZA 2WAQA 1QVUA 3CDHA 3I53A 1ZRFA 2JPCA 3J7YJ 3F8FA 1VZ0A 3M8FA 4UV8A 2KFDA 1A5JA 1D1AA 1EH7A 1IN8A 3RKXA 2W48A 4AU7A 3RKWA 2LKSA 4XMYA 2D5VA 5FLVA 3ONQA 2E19A 2V1NA 4BE0A 1NHAA 3DTKA 2FU4A 3GZNB 2EILH 3EDPA 1B8IB 2OQGA 1HBXG 2PBIA 3SEZA 2RQPA 3JAMK 2RQQA 3ABMH 5B1BH 2DFHA 3HG9A 1Y8QB 1BW5A 1SVMA 3HOSA 3VYSB 4OOIA 1UHWA 2ZNZA 2IS2A 3GFLA 1TC3C 4LB5A 2R93J 2P7VB 3K4MA 4H4KC 2COMA 3CP8A 1WWXA 2IP2A 5JLWA 1V4RA 2MD5A 4XLEA 3ZCOA 2CYYA 4RGUA 1HKTA 2VXZA 4DNCA 5FROA 4UY8I 2AXLA 2HOSA 4CCJA 1YW8A 3G71I 2DQLA 3G1LA 3MEXA 2CO5A 2CUEA 2HXOA 4L9NA 4PGHA 2R5YB 1K79A 1BI0A 2P81A 3J81K 3TW7A 3CC2I 3OYNA 1B9MA 2RAEA 4PJMA 1ETWA 4FCYA 3IL2A 4M3BA 1LDKB 1LFPA 1TZLA 4N4NB 2VOPA 2IGNA 4EATA 3W6JB 3KPHA 2QSHX 5FD5A 5F1JA 3CUOA 2KZVA 1S8NA 1W4MA 4S0HB 2RNJA 3DBHB 5FLMJ 3RZDJ 1H0MA 4C2TA 2KZGA 5BNGA 2R7OA 2ZNYA 2EIKH 2EINH 3P9KA 1SVLA 2VL8A 2XGEA 3E5UA 3R61A 3A03A 4YIFA 1FLIA 3F72A 5F0CA 3VYRB 1WVRA 1YG2A 2Z1DA 2YX7A 3QP5A 3FMRA 4AC0A 5ICFA 4BGDA 4L18B 3SZTA 3CF5F 1Z05A 1W0UA 2DMNA 4EJVA 5F0HA 3A1YA 5EEAA 4IRGA 5K7FA 1W0TA 3JTHA 3FK7A 5DUIA 2L0KA 3FIWA 3WTTC 1MIJA 4XKWA 5EF6A 1FIAA 4XK4A 4RAGA 1YYVA 3WU1B 3LSKA 5DTDA 1FT9A 3V8JA 2E1OA 4L5IA 2QSGX 2VJJA 3GLXA 5GPAA 1TTYA 5CVJA 4G7OF 3FX3A 4D7NA 2FJ1A 1R9TJ 2Q2EB 1VQ9I 4FTHA 2FMLA 4AWXB 1FBUA 2DA5A 4NUBA 3OIPA 2XAUA 4E70A 1ETQA 2P0WA 3IV5A 1K4TA 3S2HJ 2PLYA 3KZIC 3K70C 4F52A 2D2WA 1R00A 3E5XA 3ZPLA 5LRRA 3CCLI 1RIOH 1FPQA 1J9IA 2HR3A 4XKCA 1QPIA 3HZJA 2KDZA 5EYRA 1VQOI 1DPRA 4C3HJ 2X1DA 1XS9A 3FBNB 3LQQA 2LLKA 2E1MC 1XMKA 2GIZA 5E3LA 3TKYA 2DT6A 2ZBKA 4IZZA 5D4RA 1X1PA 3AAFA 3HL2A 1APLC 4F55A 1KU9A 1XMAA 3LOCA 2NYXA 3CUQB 3E6MA 5AONA 2GXAA 2V26A 1AOYA 2GXGA 1IZ1A 5DD8A 3QU6A 3JRIA 1FBQA 2GA1A 3U21A 2CV1A 1DQUA 4M3GA 3H36A 1MDMB 2WY8Q 2DMPA 5EG0B 1HSTA 2R4GA 4PJNA 3OL3A 1G59A 3CJTB 4P96A 3NWSA 1K6YA 5H6QA 1I3AA 3AL0C 2NS0A 3BR6A 4BQAA 4UB6C 3Q9VA 3S17J 4KN7X 3CD6I 3H9QA 1ZLKA 2PN6A 1R22A 4IEJA 4ZYEA 2QGUA 3WHCA 3DU5A 2H8RA 4RBOA 2DA4A 1IC8A 4AIKA 1FOYA 4GGGA 3K2ZA 2YSRA 2LR8A 2X6WA 1KU2A 3GMEA 2KRFA 4EJUA 3T8TA 3L2UA 3QPTA 5D5UB 3FXOA 2LY2A 2DJNA 2E1NA 3J7ZI 1U9NA 2LH9A 2A6EF 4CCLA 2NNYA 1K7AA 1JUSA 2O0YA 1ZYRF 4RLQA 2CGPA 1TQIA 4M3FA 3OSGA 1FNNA 2N8GA 3LFUA 2R3SA 1XD7A 1FMVA 3D0SA 5HS9A 5IY5H 2JA6J 2XPWA 3OS0A 2CQQA 3R6SA 3ROUA 3JSOA 1I1SA 2R7FA 3ERMA 5E3MA 3CMEI 1F1ZA 4GRIA 1LUJB 3F9KA 4RMNA 1MBHA 2Q0OA 1G8XA 3V7SA 4HV5A 1VQPI 3DFGA 2ID6A 4UUSB 3AKZA 2JA8J 1QO0D 3BJOA 2J5OA 1R7JA 2L5QA 3IRQA 3DLAA 3LMMA 4FE4A 5B1AH 1H9TA 2YS9A 3F21A 2IGMA 3RKYA 2QM3A 3OYGA 2EA4A 3B6CA 2YUSA 3HTUA 2JMWA 1YX3A 5AIPA 4LG0A 4AVPA 1UJ8A 2GLOA 1BJAA 3HKZA 2DW4A 3DF8A 3HUGA 2MH9A 2DLLA 2DDAA 2FQ4A 2LREA 4XN0A 4WK8F 4Q5SF 1ZG1A 1XGOA 3EUKL 1TWGJ 2W82A 2EFOA 1MGTA 1W1WE 3L7WA 3IRRA 3D5RC 3H5RA 4IHXA 2XB0X 5FRNA 1YFHA 1IN5A 2X48A 4WX9A 4NC8A 1IDZA 3J7AO 2X4HA 3WTXC 3R4KA 2A07F 2BZTA 2Y30A 2K5CA 1YI2I 2CRGA 1YQAA 2WV0A 5IP9J 2O9LA 1ON1A 4EM2A 1IJWC 1L0OC 3LQRA 1CGPA 1XGNA 3CCJI 1XTAA 3DBRB 4A3JJ 2DCEA 2K9SA 3E5QA 3HOXJ 3RYPA 3FXLA 1V54H 5FB2A 3QQAA 3IKVA 4M3DA 2K9NA 4C9YA 5BS6A 2PMHA 1YTYA 5JVTA 2ZXIA 3RQ4A 2HKOA 3AG4H 3FXKA 2XPUA 1ZHFA 3RSNA 4UVCA 2KHMA 4ENKA 2XSDC 4MO7A 2Y0SN 4C3IJ 2YR2A 5F64A 2IA2A 3TEDA 3G73A 2TRTA 1OPCA 2XKOA 2QKMB 3OOUA 2L9SA 1J59A 2EV5A 4XRMA 3G4SI 5JVGF 4MTEA 4U87A 4QPQA 6PAXA 1IRZA 2ZO4A 5E8IA 2M87A 2VKHA 3RCOA 1TT5B 4HX8A 2YU9J 1BA5A 1FOWA 3IP4B 3G2BA 3FM3A 1G3TA 5FGMA 1ZTRA 3FHZA 5E8GA 4E7SA 1UCRA 4AD9A 4E7ZA 1QHHD 5IPAA 1AKHA 4HW0A 1U2WA 1T33A 3DU6A 5LBQA 1MSFC 4XSZF 1PJRA 1MMSA 4XORA 1DP3A 2F4MB 2DODA 1MBEA 2LD5A 1RR8C 5J1UA 2EA2A 2M0MA 3OYIA 2L01A 5IOYA 4ZYGA 3F23A 1GV2A 1VQ8I 4EJWA 2LY1A 1EA3A 2VKVA 3PJRA 3GTOJ 2R7QA 1D1CA 2HEOA 5CVRA 2OV7A 1TL8A 1OCCH 2M0CA 1D8JA 2RREA 5E20A 2NVUB 2VBWA 1UG0A 1D0ZA 1VQMI 3TL4X 1F4KA 3WU2C 2DAOA 2FNPA 4OIRF 2TCTA 2AS5F 2FOKA 3VYUB 1JT0A 2W57A 3ABUA 5B66C 4MHGA 2VQGA 4BUPA 3Q5FA 1R1VA 2ECBA 4BDZA 2PJPA 5J8FA 3PFIA 2NS8A 3FBIB 3FXRA 1Y1VJ 2XRLA 2LTPA 1PP7U 4B48A 2RKHA 4JBAA 1R1TA 2E34A 3BG3A 4XLCA 1GUUA 2WAFA 4QPOA 1QGPA 2ZJQF 2ZKZA 4PGGA 2NS7A 1WJCA 3FXMA 2V9VA 5H20A 2OCCH 2HVQA 3PO2J 5HODA 2MGQA 3K4CA 4BXUA 3ZQQA 1YW7A 3OYFA 2M34A 3OYCA 3BPVA 2EV6A 2XF7A 4Z2YA 3EUHA 4MQVA 2OBPA 3LSMA 3TMOA 2HQRA 2H09A 3BR0A 4EGZA 3DTEA 2BW3B 2M7AA 3OIOA 1WPKA 1LNWA 2DJIA 2FQ3A 2O8XA 3HGGA 3I5UA 3MZHA 3GF2A 4XLAA 3BG6A 4G9YA 3CLQA 2ISZA 1LDDA 4MEYF 2G7UA 2HQNA 2HZDA 4IQ4A 4LIVA 2VPRA 3BTCA 1FTZA 4IL6C 1UELB 5D8LB 3QAHA 4RM2A 2QVOA 3EYYA 2VPLA 1XB4A 3ZP5A 5J40A 1S3JA 3OY9A 2BV6A 2CSOA 1ZLJA 1TQPA 2JVHA 1DDNA 4ITVA 4M72A 1ETKA 5E18F 1TNSA 1YOVB 2M30A 3GW2A 3N05A 5J3LA 2ZB9A 3QYEA 3RPUA 2V1UA 4FISA 2PJRB 5E1ZB 4KUMA 4ESFA 4NQWA 2NVTJ 2NOGA 2MG4A 4RGSA 2AO9A 1X2NA 2FA5A 3ESWB 2X1EA 3DKWA 2ETHA 1RKTA 3M4OJ 3HHGA 4IHVA 1O7FA 1WSUA 2KJCA 3K10A 1X4PA 5GAGJ 4GXOA 1H88C 2QLZA 2EIJH 2HOAA 4F93B 2CFOA 1WJFA 2ZXJA 4UV9A 3BJAA 1O3TA 1PDNC 2Z99A 1ZELA 4N9IA 1H9GA 5F08A 2HZTA 4GCVA 5J6XA 3VEPA 3BTJA 4BBRJ 4D9JA 2DA2A 1DP7P 2X9DA 5TGTA 1S9HA 3WTWC 2LDUA 2MFZA 2VLAA 1HOMA 5J47A 4IHYA 3BR3A 3PIOF 1TLHB 3DBLB 1BIBA 2K02A 3CCSI 1A36A 1FY7A 3I4PA 3HRTA 4X1EA 4XN3A 3J7AY 3FHNA 1SAUA 3K4JA 2YPRA 4AIDA 4C3JJ 1DPUA 2MH2A 1IG7A 5ICCA 2KPMA 1SD4A 1GDTA 4B4CA 2G9WA 2HNHA 1JJ8C 1EJ9A 1G2HA 2MC3A 3BT9A 4MIMA 3I4MJ 1Z6RA 5LLQA 2H94A 1NG7A 2P8TA 5D6EA 5E1WA 1VFCA 5JR3A 1BW6A 3TGNA 2HDDA 1UG2A 4F7ZA 4XNFA 4EJOA 1Q1HA 1RETA 5KHDA 2UWMA 3IUOA 5ERIA 4DYQA 2JUCA 1GXPA 1R6RA 5E1XA 5L3FA 1B72B 2Y48A 4G8XA 3ZMUA 5DM7F 3ULQB 4X6AJ 3KYDB 4L9JA 3ZRGA 2QZ8A 4WF2A 1V3FA 1ETVA 4V2GA 1Z77A 1N77A 2RC4A 2B63J 3OV8A 1V5FA 3LAJA 2EFNA 2JQ7A 2M3AA 4HAMA 3MKLA 1V5GA 1R4MB 2CQ7A 2LVSA 1USTA 3CCUI 5L3DA 2P5LC 5FD6A 4BY7J 4CSWA 2HDWA 4RAFA 3V7CA 1WRJA 3COAC 2F5CA 1RKWA 1SFEA 2Y0SA 4HSRA 2CMPA 1Z0XA 4LG3A 3DPLC 2EJRA 3X2QH 1PUFB 1T08B 2VKDA 3CCVI 2DTZA 5F04A 2MSYA 5BPIA 4ZC3A 4F3QA 3BG9A 2M5WA 3QWLA 2HPIA 4LB6B 1XSXA 2ZMEC 1YJNI 4O6JA 3TP3A 3WTUC 2V79A 1MH3A 1VTNC 1OCZH 3V42A 2K3PA 2UXNA 4RA2A 3RQIA 3ZMVA 5M5YJ 2AXTC 3S8PA 1FEXA 1QQIA 1LQ1A 4BBSJ 2H6CA 2HVRA 4RGRA 3V7RA 2I10A 3KYCB 1MJBA 4M9ZA 3HSRA 5HDKA 2HYJA 3TQNA 1LJ9A 3GX4X 1D3YA 1X3WB 2MC4A 2KKOA 2X1CA 2F5DA 3VSKA 1ZQ3P 5E3OA 2E2IJ 1L3LA 2QEXI 3BZCA 2XF6A 3HJEA 3RPQA 3L2RA 4LLNA 2IBDA 2STWA 1N25A 2BY3A 3BP8A 2AQEA 1H8AC 4OIQF 5K5OA 1LE8B 3K4BA 4I99C 3AG3H 3ISPA 4L0ZB 3LA3A 3TOBA 2CV0A 1P2FA 5LGNA 2H1LA 4Y33A 5CKTA 1IRFA 3BCAA 2CH0A 4G7ZF 4Y4RA 1GVJA 2IS6A 3OYEA 2Z3YA 4A6EA 1O3SA 4A5NA 3F8NA 1U5TA 2DFEA 4KN4X 3KP2A 4S05A 1DUXC 5F6FA 4WCGA 3A01A 3H35A 4M9XA 2E60A 1W7PA 3F8BA 3K4NA 1ORKA 2XDVA 1C0WA 2LKPA 1T39A 1VQ5I 4ANJA 2V7FA 3OR2C 3I0TA 3HIFA 4HZFA 5HLIA 2W7NA 2D1VA 3OYJA 3A02A 4I7HA 4U88A 3OSFA 2F6CA 5CJ9A 5LD2C 2FBKA 1UFMA 2VJ5A 5C4JJ 3SJMA 4MQ9F 1IN7A 1MMAA 3PQJA 1TW3A 3NEUA 5FRMA 4HOBA 4YIIA 5D4SA 3BC8A 4BEHA 2I8DA 4ABZA 2M2EA 1O4XA 2GBYA 1MBFA 4A3GJ 2DDBA 3NARA 2KJBA 3IH2A 1QZZA 4FX0A 1HW1A 5HVQC 2WAEA 1HDPA 5LGUA 4DOZA 4CYCB 2QENA 5EGOB 5L3BA 1QZYA 3GZ6A 2IA1A 3BWGA 4O3MA 1GHCA 3OYMA 4NC6A 1OJLA 1R4NB 3WODF 4DBRA 4JX5A 1JXSA 3HSFA 3HGYA 2DO7A 2M8GX 3VFZA 3ZGKA 4ZYHA 2JA2A 3Q0UA 1U5TC 4MEXF 3LSJA 2Z9OA 4XR6A 3CMYA 5FO5A 1J09A 4YELA 4MTDA 1LDJA 2LY9A 3EETA 3FKJA 3T5XA 5D5XB 5M5XJ 3W2AA 1QA6A 5GAHJ 2OTJI 2RN7A 1F9NA 2QQ8A 1DGWY 1TQMA 4YIRX 3W2VA 4HSTA 2WADA 3CCRI 4CHUA 1YX5A 2PG4A 3MFKA 3A2KA 4DZPA 3H3VK 3ASNH 2A5YB 9ANTA 2BXZA 2O5RA 4PK4A 2FX0A 1Y0UA 4HEA2 4PZJA 4LIUA 2BY2A 5CYVA 3K7AJ 5HLHA 3GTQJ 1WJEA 2IGOA 3SHFA 3FMSA 4HF2A 1AU7A 1YRNA 3JRAA 4FETA
chains in the Genus database with same CATH topology
2K3FA 2E35A 1YHQI 2E34A 1YI2I 2ZJQF 1ACIA 4UY8I 3G71I 3CCJI 3CJTB 3CCMI 1YITI 2ZJPF 2NXNB 3CC2I 2H8WA 4V19K 4IOCF 5DM7F 1VQ5I 3CD6I 1YIJI 3I55I 3CC7I 1FOYA 2JQ7A 1HC8A 3DLLF 1S72I 3CCUI 1VQ4I 3G4SI 5JVGF 3J7ZI 1VQNI 3G6EI 3CF5F 1VQKI 1VQ7I 1YJWI 1FOWA 4IOAF 3CCVI 5DM6F 2OTLI 1VQ6I 4IO9F 3CMEI 3PIPF 1MMSA 1YJNI 1VQ9I 1VQPI 1Y39A 5GAGJ 1QA6A 5GAHJ 3CC4I 1VQ8I 2OTJI 3J7YJ 1YJ9I 2FOWA 3CCQI 2QA4I 3CCRI 5GADJ 3CCLI 5GAEJ 2E36A 1VQOI 3PIOF 2QEXI 1FOXA 1VQMI 3I56I 2ZJRF 3CCSI 3CMAI 3CCEI 1VQLI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K3F A;  2E35 A;  1YHQ I;  2E34 A;  1YI2 I;  2ZJQ F;  1ACI A;  4UY8 I;  3G71 I;  3CCJ I;  3CJT B;  3CCM I;  1YIT I;  2ZJP F;  2NXN B;  3CC2 I;  2H8W A;  4V19 K;  4IOC F;  5DM7 F;  1VQ5 I;  3CD6 I;  1YIJ I;  3I55 I;  3CC7 I;  1FOY A;  2JQ7 A;  1HC8 A;  3DLL F;  1S72 I;  3CCU I;  1VQ4 I;  3G4S I;  5JVG F;  3J7Z I;  1VQN I;  3G6E I;  3CF5 F;  1VQK I;  1VQ7 I;  1YJW I;  1FOW A;  4IOA F;  3CCV I;  5DM6 F;  2OTL I;  1VQ6 I;  4IO9 F;  3CME I;  3PIP F;  1MMS A;  1YJN I;  1VQ9 I;  1VQP I;  1Y39 A;  5GAG J;  1QA6 A;  5GAH J;  3CC4 I;  1VQ8 I;  2OTJ I;  3J7Y J;  1YJ9 I;  2FOW A;  3CCQ I;  2QA4 I;  3CCR I;  5GAD J;  3CCL I;  5GAE J;  2E36 A;  1VQO I;  3PIO F;  2QEX I;  1FOX A;  1VQM I;  3I56 I;  2ZJR F;  3CCS I;  3CMA I;  3CCE I;  1VQL I; 
#chains in the Genus database with same CATH topology
 2X85 A;  2VBY A;  4FE7 A;  3MKY B;  3CES A;  3VPR A;  4A69 C;  2VQL A;  3CUQ C;  4XRS A;  1S7O A;  2HOT A;  1T6S A;  4IVN A;  4ZZL A;  2EZK A;  1K6O A;  4UVB A;  2CUF A;  3I64 A;  2DMU A;  1K78 A;  3I59 A;  2R0Q C;  3ECO A;  3M9A A;  1OCT C;  3LSR A;  3HPG A;  5F1R A;  3S93 A;  3HRM A;  5E3N A;  1YIT I;  2ZJP F;  2FBI A;  2NXN B;  5K7H A;  4G6D A;  1XCB A;  4FHT A;  4KJZ A;  2H8W A;  2D45 A;  2XF5 A;  3RI4 A;  4R1H A;  4I98 B;  3KZY A;  2LYC A;  3UR3 C;  3ABL H;  4CUG A;  5BMZ A;  4CCM A;  3A0B C;  4BJT A;  3NRV A;  3LST A;  3RTR A;  3QPS A;  1NK2 P;  3LA2 A;  4EJT A;  1XG1 A;  2RGV A;  4IF4 A;  4IPA A;  2ACJ A;  2AQF A;  3E0J B;  2VC1 A;  5J4Y A;  2ZFU A;  3GTG J;  2W85 A;  5BQT A;  3TO6 A;  3S2W A;  5DDG A;  1S72 I;  3S1Q J;  2F48 A;  3VB2 A;  4DJA A;  1IV6 A;  4RDU A;  2LF8 A;  2W4S A;  2JRM A;  4ASN A;  1VQN I;  3FXQ A;  4HDV A;  1SD6 A;  4PCQ A;  4A2U A;  3NWT A;  4KA4 A;  1QZE A;  2O7O A;  1OLT A;  2ZCW A;  3MVP A;  3ZMT A;  4YFK F;  4LLG F;  5IYD J;  2RVC A;  3BOQ A;  4HLX A;  4WWC A;  4HF1 A;  3CZ6 A;  4CO8 A;  3TW6 A;  4LMY A;  3PFY A;  3PQK A;  2P7C B;  2E1M B;  2OF7 A;  3WE2 A;  1A35 A;  4U7B A;  2GQQ A;  3U1K A;  1VQ6 I;  1I50 J;  3PIP F;  1D0X A;  3BQZ A;  4A12 A;  2A3S A;  4RGX A;  1ON2 A;  4KIF A;  1REP C;  2A69 F;  4GYI A;  2IXS A;  1FBS A;  3IAM 2;  1R5I D;  3Q0V A;  4GO1 A;  4YFN F;  1QBJ A;  3W6V A;  4BNC A;  2R7T A;  1P4W A;  3CC4 I;  3IH3 A;  1J2X A;  2LK2 A;  4BE2 A;  2ZC2 A;  2V1X A;  1TBX A;  3GTP J;  3MN2 A;  2F4O B;  2F5V A;  2VT3 A;  4JK1 X;  1W36 D;  5HS8 A;  2ID3 A;  2EFW A;  1BOA A;  1XPX A;  5HDN A;  3OS1 A;  4PSX A;  4KMF A;  3OL4 A;  3DEE A;  3QP6 A;  4CCK A;  3ERE D;  3OYA A;  4RB2 C;  1SD5 A;  1MH4 A;  4UUT A;  1W5C C;  3CDI A;  2DPU A;  3FIS A;  2HVS A;  2W24 A;  3WU0 A;  3OYB A;  2UXX A;  3ZOB A;  2EZH A;  1U8R A;  1FP1 D;  1PYV A;  4E7K A;  4BS9 A;  2LF7 A;  3TOA A;  3F6O A;  2E7W A;  3H0G J;  2KRH A;  3S16 J;  1G6N A;  2DMQ A;  3GUD A;  2AHQ A;  1KQ0 A;  1WKM A;  3FK6 A;  4XRS G;  1QNT A;  4DYC A;  5KNL A;  1Y0N A;  3MZ8 A;  1ACI A;  3QU3 A;  2ECC A;  4BKX A;  4HNU A;  1LEB A;  1OFC X;  1VF9 A;  2PEX A;  3KEY A;  5BPD A;  1IV8 A;  3IH4 A;  1IAW A;  4DW6 A;  5J1R A;  1V5E A;  2ELH A;  4OWR B;  3W2W A;  4BYY A;  3DPU A;  3ZMZ A;  3T1B A;  4OIN F;  2JWT A;  3WHB A;  3I55 I;  1G4D A;  2A05 A;  2NAZ A;  3ZQC A;  3AFH A;  1LB2 A;  3OYH A;  3O6B B;  3K9T A;  4HV6 A;  2EV0 A;  3R0A A;  5FFZ A;  1ETY A;  1OR7 C;  4ESB A;  5GTI C;  2B7E A;  3L2Q A;  2Y0M A;  1UZC A;  2RDP A;  3GO5 A;  1OCR H;  3A0H C;  5AIQ A;  1YO5 C;  2LMD A;  3MKW B;  4L5E A;  3KEQ A;  2ELJ A;  1YIO A;  5LGT A;  5KVR A;  4W1U A;  3QPH A;  3DCF A;  2L2O A;  1V55 H;  3K4K A;  3G3Z A;  2DA3 A;  3LWF A;  2JZY A;  2P5V A;  2XVC A;  3P5J A;  2UV1 A;  2NRA C;  2ZSH B;  1LFU P;  3KLN A;  1TW2 A;  3S1R J;  3GLL A;  1JKO C;  1R58 A;  2WBM A;  4G12 A;  5LEJ A;  2Z5U A;  1CF7 A;  3HEF A;  1RR7 A;  2GM4 A;  2HKX A;  2LBF A;  2CV2 A;  3L1P A;  3EQL F;  2K85 A;  4F92 B;  1EF4 A;  2K9M A;  2OAZ A;  1VND A;  1Z3Y A;  5H2F C;  4HA8 A;  1BI1 A;  3AG2 H;  4I01 A;  1Z3X A;  4BXF A;  4EM0 B;  1BN5 A;  1RUO A;  2FXA A;  4XRF A;  1IXC A;  3RPU D;  5FKN A;  4RB1 A;  3WTZ A;  1ETO A;  1D0Y A;  1EH8 A;  5CVI A;  1Z91 A;  2V1D A;  4EEF G;  2A6T A;  3Q3S A;  4LD5 A;  1B9N A;  3VOE A;  1FYK A;  1D5Y A;  4XBF A;  1HF0 A;  4I2O A;  3TO9 A;  5E17 F;  3ZQI A;  1WJA A;  1SFO J;  4XLH A;  2ISY A;  2DFF A;  4B43 A;  4BJ6 C;  5FFX A;  3GCM A;  2G7H A;  1SFK A;  2XGC A;  3JRD A;  4A3E J;  3FXU A;  2F2E A;  2LSO A;  4DZJ A;  2DTR A;  4RAZ A;  3EUA A;  2CG4 A;  2EFP A;  1I3Q J;  1TT0 A;  3DPT A;  4XL9 A;  4IXA A;  1DGR M;  2QBY A;  2B0L A;  2XAH A;  4LG0 B;  1BI3 A;  1MMN A;  4G6Q A;  1S5L C;  3M8E A;  4L0Y B;  3HUG B;  3N4M A;  1IO2 A;  2KP6 A;  1UB9 A;  2Y9Y A;  3PL8 A;  2X6O A;  2QUF A;  3MKZ A;  2MW8 A;  3BZ6 A;  1FP2 A;  2ZSI B;  5ILV A;  3OYK A;  3JRG A;  1KON A;  1JT6 A;  3R0J A;  2DYR H;  3KEO A;  4WXD A;  4NNJ A;  3S3M A;  3MAJ A;  4D5C A;  1YIJ I;  3DTI A;  2NVY J;  4A5M A;  2CUJ A;  2V6E A;  4A93 J;  3IWF A;  3T0Y A;  4IHT A;  4L9V A;  1JKR C;  2WAQ N;  4C2M J;  4E7L A;  3CJN A;  1P6R A;  3RDI A;  3K6G A;  5CQE A;  2P5K A;  5DCM A;  2F5E A;  3HPH A;  4IX7 A;  2BY0 A;  2JUG A;  4AUX A;  3H5N A;  2M8E A;  2KDO A;  1NG6 A;  3TO7 A;  5IP6 A;  5LFA A;  2VT2 A;  2BYV E;  2DT7 B;  4KFC A;  3C3W A;  3H1C A;  1ZN2 A;  2QQA A;  1KQ8 A;  4YEJ A;  2VE8 A;  2FBH A;  3CJQ B;  2P6T A;  2K4B A;  4I02 A;  2KIU A;  2WB1 N;  3H3U A;  2XRO A;  4OIO F;  4MFE A;  5FJ8 J;  2O3F A;  4HQM A;  4LOC A;  2GZW A;  2DT5 A;  2OC6 A;  2R7R A;  3W3C A;  1B6A A;  4J19 A;  1KGS A;  1Z9C A;  1MSE C;  1FSH A;  4RLF A;  3SZP A;  2EFQ A;  4ZJZ A;  3HRS A;  1HCR A;  1JHF A;  4A3F J;  3AG1 H;  5ILS A;  2WC2 A;  3K1P A;  2LBF B;  4BH9 A;  2KIS A;  3ML6 A;  5L3G A;  4HNT A;  5K5R A;  1R1U A;  2IW5 A;  2XC7 A;  1T8I A;  1S29 A;  5LEK A;  4D0P A;  1POG A;  1IN4 A;  2GWR A;  4EVI A;  3F8M A;  1HSJ A;  1MND A;  3BPX A;  3C2B A;  4CH7 A;  1WJ5 A;  2YU3 A;  1I39 A;  4MLO A;  1IUY A;  2BE5 F;  4C2U A;  4HQE A;  2ZFW A;  2JJ7 A;  1AA7 A;  3ABK H;  2L7F P;  3E6D A;  1AKH B;  2V6C A;  1A31 A;  1XCV A;  4U7D A;  1ZR2 A;  3F22 A;  4Y7N J;  4CDG A;  5HOO A;  3FXJ A;  2E5Z A;  3R60 A;  5KAF C;  3I4N J;  1CQT A;  4ZZD A;  1VQL I;  2GXB A;  1IXS B;  1E3P A;  1FSE A;  2E2J J;  2FEZ A;  3WG7 H;  3JRF A;  4P55 A;  3S1N J;  2IS1 A;  2PI0 A;  4KT6 A;  2JSC A;  2R7U A;  1LKX A;  1RPW A;  2XGX A;  2Z33 A;  2DI3 A;  1T0F C;  2QBY B;  1BR1 A;  4A3K J;  2CUZ A;  4X0G A;  3BR2 A;  1ONV A;  2ADU A;  4XLN F;  5K5Q A;  4CCO A;  1GV5 A;  3F6V A;  1QRY A;  1X58 A;  3BR1 A;  4BQO A;  3I9V 2;  5KK1 A;  2JRT A;  1FX7 A;  3PNV A;  5IT9 Z;  1KQ9 A;  3TDZ C;  1J75 A;  3KX2 A;  4RB3 C;  1D1B A;  2FD5 A;  4AYB N;  1WJD A;  2JSP A;  2XUB A;  4PJ0 C;  2O61 A;  2BBY A;  3ZR8 X;  1ZRE A;  2KIM A;  4PDK A;  1GLN A;  1IDY A;  1S7A A;  2MD0 A;  5JHU A;  1JGG A;  2MBF A;  4A3D J;  4RAY A;  3C1D A;  4PSW A;  3GFI A;  4HRI A;  3RYR A;  4KIS A;  2IS4 A;  4B47 A;  3ZQG A;  4MFD A;  3S1M J;  3N97 A;  1STZ A;  2OA4 A;  2L9N A;  2VB6 A;  2ZME A;  3F3X A;  2ME6 A;  4II3 A;  1MNE A;  4B3X A;  2DYS H;  3D5L A;  1KU7 A;  4ZYD A;  3WTS C;  4XID A;  5ICG A;  2HS5 A;  4ON0 A;  4RS8 A;  3M7G A;  5D5V B;  1J5Y A;  2WV1 A;  4XKV A;  4P9U A;  4ZYA A;  1YJW I;  1G3Y A;  3ZXS A;  2A5W A;  1WH5 A;  5FLX K;  3TBI A;  4PFO A;  2IEK A;  2K40 A;  2KT0 A;  2VUM J;  4IO9 F;  2DOA A;  2HTS A;  3FWE A;  1TP4 A;  4N0B A;  1IXR C;  1B8I A;  1HLV A;  1E3O C;  3ASO H;  1R5G A;  4YG2 F;  4XIC A;  3G1M A;  4B44 A;  4NQW B;  3BY6 A;  3PNT A;  2L54 A;  1UHM A;  5F27 A;  2RV8 A;  3HM5 A;  4BQQ A;  2VI6 A;  2ZXH A;  2VBZ A;  3C2H A;  1ZKG A;  4JP0 A;  2GIV A;  5E79 C;  3KCC A;  4UXN A;  2LG4 A;  2G0E A;  4A3I J;  5FKK A;  1TWC J;  3HSE A;  1Y8R B;  5HS7 A;  2OUM A;  4EMS A;  2R5Y A;  1SC7 A;  3HOW J;  1B59 A;  4A3C J;  2EQR A;  3CMA I;  2DU9 A;  1B1B A;  4HPQ A;  4IRH A;  1PVE A;  3HBL A;  5K7Z A;  5CLS A;  4K2E A;  1ULY A;  2CFX A;  2E35 A;  1IGN A;  3QYB A;  4B3A A;  2ESN A;  1MW7 A;  1ZGW A;  2CU7 A;  2PX9 A;  3SEQ A;  3KP3 A;  2CW7 A;  4IHS A;  2BHY A;  2VN2 A;  1U0J A;  3ZMD A;  1K4S A;  1ETX A;  5ILU A;  3WTV C;  3JRH A;  1FYM A;  1USS A;  3WGG A;  4W97 A;  4LIT A;  3DKY A;  2DA6 A;  2W1O A;  4ZTF A;  1X1B A;  2E7X A;  1ZAO A;  4QWQ A;  3FKI J;  4OMY A;  1IRX A;  3F8C A;  2L4A A;  4AIH A;  3KLO A;  4XLF A;  4Y15 A;  2HWV A;  4LFU A;  4UUV A;  1ENH A;  3SXY A;  3PO3 J;  2Z16 A;  2LNB A;  1R49 A;  4M73 A;  1F36 A;  1Y56 A;  2J5P A;  1JTX A;  3BJ6 A;  4HX7 A;  3REO A;  3FMQ A;  4KIB A;  1MJ9 A;  4E4H A;  2GOX B;  2QQB A;  5HLT A;  1BR2 A;  1S7E A;  1H89 C;  3FM5 A;  4BHC A;  1U6G A;  3KET A;  2Q2E A;  1HQC A;  1JUP A;  1E3H A;  5LRS A;  2EPF A;  4IQJ A;  1UMQ A;  2FMY A;  3G6E I;  1FC3 A;  1QPM A;  1VQK I;  2CS3 A;  3L2V A;  4HBL A;  5CVU A;  2IPQ X;  1NK3 P;  5KAI C;  3GXO A;  4GFB A;  1P7J A;  4M9S A;  3K0L A;  1FIP A;  4I76 A;  2XSJ C;  3BTI A;  4UVA A;  1X4O A;  5A2Q Z;  3GTJ J;  2V9K A;  4OIP F;  2WA0 A;  3H5A A;  4QSH A;  4KYW A;  3UNG C;  3E6B A;  3I54 A;  3LNQ A;  3KFW X;  2FF4 A;  2XPV A;  1U3E M;  1ZGJ A;  2WB1 A;  5L3C A;  5TRD A;  3B6A A;  3P9I A;  3CDL A;  3CLO A;  4LK1 F;  3ZQ7 A;  2R7V A;  4HDU A;  4JYK A;  4DGW B;  3CUQ A;  2QYO A;  2E71 A;  1J7K A;  2R5Z A;  4E7H A;  2FOW A;  3CCQ I;  2OQR A;  2JT1 A;  1T2K A;  2NNN A;  3OIQ A;  1ZGA A;  4U0Y A;  4HG2 A;  2HGC A;  3RZO J;  3FDY A;  2OCE A;  1MDM A;  1OQY A;  4H0E A;  5EG0 A;  1XDS A;  1LVK A;  1P4A A;  2L7Z A;  2ZXW H;  3JW4 A;  4D1Q A;  5K1Y A;  1FOX A;  3M07 A;  3I56 I;  2IJL A;  4PJJ A;  4PJL A;  4C30 A;  3QOP A;  4B8X A;  1P7I A;  2MA3 A;  4A6D A;  4WXC A;  4LGW A;  2K3F A;  2ESH A;  4NDL A;  2X51 A;  3MWM A;  4QTR A;  3V4G A;  3D1N I;  2JN6 A;  1O3R A;  2H27 A;  2NVQ J;  3WG9 A;  5HDG A;  3E3V A;  2KLO A;  4CZC A;  2QKL B;  3L00 A;  4M6Y A;  4Y13 A;  4KNY A;  1VI0 A;  2HDC A;  4EQQ A;  1SVO A;  4FAS D;  5ICE A;  3I3L A;  2X6Y A;  3ZN1 A;  1TNT A;  1N75 A;  2ELK A;  3LSI A;  4D5F A;  4BDY A;  3OS2 A;  4BXX J;  3BQY A;  2A6H F;  2XAF A;  1T38 A;  2IAI A;  2XIG A;  4ENN A;  5IT9 K;  3M1C A;  2VJI A;  3NAU A;  1GVD A;  1OKR A;  5EZG A;  2LFB A;  2HTJ A;  1Z67 A;  2CW8 A;  2EZI A;  1F43 A;  1I6X A;  1LFB A;  1U78 A;  4HLY A;  1WJB A;  3CC7 I;  1I27 A;  1JKQ C;  3DEW A;  1BM9 A;  3BLY A;  2L9V A;  3HC7 A;  4Q47 A;  2XAQ A;  3I58 A;  2BY1 A;  4R8H A;  3RIR A;  4AYB A;  2IVM A;  3IWZ A;  1U5T B;  3E7L A;  3DWL E;  5JLX A;  2VE9 A;  4JX4 A;  3M3Y J;  1SFU A;  2JA5 J;  1OCO H;  2K27 A;  4M3E A;  4QLC U;  4UUS A;  3A01 B;  2OZU A;  2X6X A;  1W7P B;  4BHP A;  2M9H A;  2BOL A;  1SD7 A;  3P9C A;  1FWZ A;  4AIJ A;  3ELK A;  1W5T A;  2MLK A;  2Y75 A;  1FZP B;  5FKO A;  2IRF G;  1R36 A;  2CQX A;  4IOA F;  3C2G A;  4Q4Z F;  4XOP A;  3JTG A;  3I71 A;  1HKQ A;  2XKP A;  3OYD A;  1X1C A;  1XGM A;  4FQG A;  4NC7 A;  4AM3 A;  3S3O A;  3M1E A;  3U9G A;  3HOT A;  1KYZ A;  1SMY F;  3E97 A;  1I6H J;  4CIC A;  1I1G A;  3K1N A;  2YX4 A;  1Z7L A;  4BEH B;  2E5N A;  2Y9Z A;  2W25 A;  2JA7 J;  4MNU A;  2WTE A;  3G1O A;  2R5Z B;  5JFR A;  2HYF A;  4BY1 J;  5C4X J;  1LPQ A;  3H9J A;  2GAU A;  3ZQF A;  3CCY A;  1U9O A;  1UHS A;  1QHG A;  3IAS 2;  3WGI A;  1MBK A;  4S04 A;  3GFJ A;  1RC9 A;  3BG5 A;  3GYH X;  1XSD A;  2EK5 A;  2DOF A;  2LKX A;  2DQR A;  3JR9 A;  2M4G A;  3C18 A;  3H3Z A;  2VXD A;  2O03 A;  2O8K A;  1XC5 A;  1MD0 A;  1RES A;  1XN7 A;  1M1E B;  1XSV A;  3GTM J;  2L9R A;  3O3K A;  1GT0 C;  3D5S C;  1TWF J;  5IOZ A;  1GXQ A;  1OR7 A;  4RM3 A;  4B09 A;  3GTK J;  2OU2 A;  5L3E A;  4XLP F;  2M7B A;  2IA0 A;  3BZK A;  3O8G A;  5H6R A;  4LK0 F;  1ODD A;  3AL0 B;  2HOE A;  4IRI A;  2I5U A;  2VJ4 A;  1BBY A;  1PP8 F;  1YE9 A;  1JGS A;  1G3W A;  4V19 K;  2HQA A;  1YRN B;  3S14 J;  3ABT A;  2R7S A;  5LHI A;  2VKE A;  2BEO A;  2LRD A;  1T56 A;  2PFB A;  5GP9 A;  3BG7 A;  1P4X A;  4NBQ A;  1MBG A;  1HKS A;  1OYW A;  1Z1D A;  3KP4 A;  4CXF A;  1K78 B;  3CQZ J;  3I59 B;  1IRG A;  2JK3 A;  2Q1Z B;  2DN0 A;  3DLL F;  4AVZ A;  1IF1 A;  4U0V A;  2VAS A;  3LSG A;  2BVM A;  2WWY A;  2GA2 A;  2R7W A;  3SZG A;  4I6Z A;  2XHK A;  5LHH A;  3HYI A;  2H6B A;  3SQN A;  4BL0 B;  2LOO A;  2R7D A;  3LL7 A;  2F4I A;  4IKF A;  1T95 A;  4Z6Y A;  3CMM A;  4DIQ A;  1P9Q C;  3RJP A;  1BIA A;  1WQ2 A;  4OAZ A;  5CVV A;  3L2C A;  3CF2 A;  5C44 J;  4ZH4 F;  2L02 A;  4F91 B;  4XKB A;  1ZAR A;  3K69 A;  1HA8 A;  4CZZ A;  2JVG A;  3HXL A;  2QSF X;  2XAJ A;  3VWB A;  4CGZ A;  1Y6I A;  5A2Q K;  3BRO A;  1XGS A;  3H9G A;  5IT3 A;  4LJZ F;  3DXJ F;  1KU3 A;  3KE2 A;  3LSP A;  1TWH J;  2GOM A;  2HQ5 A;  2LP0 A;  4HF0 A;  2XB5 A;  3L09 A;  1WCM J;  4DBQ A;  1YLF A;  1B4A A;  4HX4 A;  3BCB A;  5FLX Z;  1A6I A;  3K4L A;  2LC2 A;  1BC8 C;  5EEH A;  1UAA A;  1AHD P;  1KA8 A;  4ENM A;  5IYC J;  1MZB A;  5EDN A;  2VC0 A;  5GAD J;  4CA0 A;  2CQK A;  3OMY A;  2BHZ A;  1WH7 A;  4RB0 A;  5FKM A;  5IYB J;  4GDF A;  1HW2 A;  5D6F A;  1S6L A;  3PNY A;  2M4K A;  1JJ6 C;  3OWT A;  2KIQ A;  2QF7 A;  2XV4 S;  4YFX F;  4PFP A;  1ZK8 A;  3L9F A;  1XMX A;  3CCE I;  4L9T A;  3BR5 A;  3GTL J;  4M71 A;  2BW3 A;  2DFI A;  3DQV C;  5C3E J;  4HNV A;  3IKT A;  2DMT A;  2UUZ A;  4O5V A;  3PSI A;  1DU0 A;  1A04 A;  3HDD A;  1YHQ I;  2KIF A;  3V8K A;  3S15 J;  2WY7 Q;  1IN6 A;  4EV0 A;  4ZDP A;  4OU0 A;  1MKM A;  2VQC A;  4QIW N;  4KIC A;  4KT5 C;  1SMT A;  3DV8 A;  4A3B J;  1JI8 A;  3SYT A;  3IHU A;  3TP0 A;  4A0Y A;  1QVT A;  2IGK A;  2IT0 A;  2L3D A;  2PQ8 A;  3MD2 A;  3VSL A;  4I0B A;  3GWZ A;  3M8J A;  1SEU A;  2P6S A;  4XSX F;  2BVL A;  3S3N A;  3SFZ A;  4IOC F;  4HYE A;  1FMW A;  3BTL A;  4D7M A;  2NVX J;  2PJR A;  3HOV J;  1EV7 A;  1YS7 A;  3HTS B;  5BOX A;  4ZTJ A;  1ITY A;  2HFH A;  3JRB A;  2DA7 A;  1ZG5 A;  3K1M A;  2XAG A;  1R5H A;  3MCZ A;  3GEZ A;  4CCN A;  1OYI A;  2R7X A;  1HW5 A;  5M3M J;  1T98 A;  3ZQH A;  5J8C A;  1BL0 A;  1RRJ A;  1JTY A;  2K9L A;  3FF5 A;  1WFX A;  1Q1V A;  4J01 A;  1AWC A;  1LVA A;  4R79 A;  5GTH C;  3ZQL A;  5B5E C;  1Z21 A;  5HNF A;  4ENJ A;  1HXD A;  5DV5 A;  2XGD A;  4M6X A;  3JSP A;  3J80 Z;  1X3Z B;  2UZK A;  2XAS A;  2HPM A;  2OZ6 A;  4N4O B;  5DM6 F;  4M74 A;  4GYG A;  1F5T A;  2K4J A;  3BDD A;  2PMZ N;  2HXI A;  1FTT A;  4IHW A;  1W5S A;  5KCM A;  5CQG A;  1R71 A;  1X1A A;  1X3U A;  2HYG D;  2V4J C;  1BR4 A;  2OD5 A;  1XX5 A;  1X2M A;  5J4V A;  4ESJ A;  1WI3 A;  3B73 A;  2FSW A;  2RNG A;  5JI6 A;  1T0F A;  2OPT A;  3F0C A;  3H92 A;  3DKX A;  4FX4 A;  1W36 C;  3U2R A;  1BI2 A;  2KL4 A;  2FNA A;  3LFK A;  3QYF A;  3C7J A;  4II2 A;  1G3S A;  1CF7 B;  2XRN A;  2EIM H;  3QOE A;  4TV7 A;  1ZG3 A;  3CP2 A;  3JAM Z;  2HI3 A;  1B72 A;  2EZL A;  1A6Q A;  2A68 F;  1OMI A;  4A3M J;  3QOD A;  4B1R A;  4DYR A;  3ZN0 A;  1SFX A;  1LEA A;  5EEG A;  3GVA A;  4V2F A;  2H1K A;  1O57 A;  4KDP A;  1DU6 A;  4JOM A;  1OIS A;  1FJL A;  1IUF A;  3HOU J;  1EH6 A;  3WTY C;  1N78 A;  4PUS A;  4EGY A;  4JQF A;  5GPC A;  3LAP A;  3J81 Z;  2QCO A;  3CCM I;  4L5J A;  3EPZ A;  2Z2S B;  3KIO A;  2PMU A;  2JTV A;  4FT8 A;  3T8R A;  3RKQ A;  1HDD C;  2X0L A;  2Y31 A;  4LLL A;  4G7H F;  2CQN A;  4I09 A;  1D8K A;  5EJC A;  1SAX A;  1BOB A;  1ZRC A;  2MYS A;  2P4W A;  4I0A A;  5FKL A;  2FE3 A;  2DBB A;  2ME0 A;  4U0W A;  1PUF A;  3S32 A;  2HU9 A;  1OYY A;  1Y1W J;  3QPL A;  3JRE A;  3HRU A;  1WGX A;  3OR1 C;  2M45 A;  4MGR A;  1I5Z A;  2W00 A;  2EB7 A;  1R23 A;  4NB5 A;  4EM1 A;  2JPB A;  2VOD A;  5IP7 J;  4NHJ A;  1XDU A;  2ICW G;  2A61 A;  5EZH A;  1PUE E;  2EWN A;  2K86 A;  2VIX A;  3HHH A;  5DCF A;  3IC7 A;  3CTA A;  1MMD A;  1WZ2 A;  4CYD A;  4ETS A;  5TIS C;  1D5V A;  5DYM A;  1WHU A;  3EUH C;  1VQ7 I;  2E2H J;  5DUK A;  1JKP C;  3S2D J;  4XM3 A;  1E17 A;  3UKG A;  3KYL A;  3PUB A;  4OAY A;  4BU2 A;  2O6G E;  5HLG A;  4BAY A;  2EH3 A;  2L4M A;  3QRF F;  3MQ0 A;  5F0F A;  1MNM C;  1RZ4 A;  1U8B A;  2COB A;  1O3Q A;  2Y69 H;  4BHB A;  5DCM B;  3L2W A;  4A0Z A;  3HOZ J;  2K9Q A;  1Y39 A;  1E0E A;  2STT A;  3KZZ A;  2Q8K A;  4DQ2 A;  2KMU A;  3FZV A;  1LE8 A;  4XON A;  3WE3 A;  5D8K B;  5D5W B;  1J0R A;  5JHF A;  1RUN A;  5HNH A;  1W7P D;  5CPR B;  2W84 A;  3PSF A;  2BXY A;  3E6C C;  1YJ9 I;  1JE8 A;  3CO6 C;  3OOP A;  2QA4 I;  4WXH A;  4E7I A;  2F5F A;  2V9P A;  2OJE D;  5LHG A;  5GAE J;  3ZMS A;  3SFI A;  2CJJ A;  3JRC A;  2E36 A;  1NH3 A;  2DOE A;  2QWW A;  3LSH A;  2ZJR F;  4J00 A;  3CJR B;  1BC7 C;  1Z6T A;  1K83 J;  3DEU A;  1MMG A;  1YS6 A;  2FRH A;  2VQH A;  3Q9S A;  2VOO A;  1JHH A;  2BGC A;  4A0X A;  2DK5 A;  3O8H A;  1TWA J;  2NOJ B;  4Y3O A;  3DP7 A;  2CW0 F;  3EYI A;  1FYL A;  3K70 D;  2KQR A;  2DK8 A;  1OCP A;  5ED4 A;  3HB9 A;  1WI9 A;  2MLG A;  3WGH A;  4BAC A;  2D1H A;  1MBJ A;  4IJA A;  2TDX A;  4OMZ A;  2CWE A;  3E1S A;  1P92 A;  3VDX A;  4E7J A;  1ZH5 A;  3VOD A;  1JUM A;  2K7L A;  3SDB A;  4Y17 A;  2C6Y A;  2L7M P;  4KIT B;  3HOY J;  4UHT A;  3GFM A;  3CO7 C;  2VON A;  2DA1 A;  1E2X A;  4CYC A;  2QQ9 A;  4UB8 C;  5EGO A;  2EBI A;  3K2A A;  3A4C A;  3ECH A;  4E6K G;  1BJZ A;  1IW7 F;  1QU3 A;  4YRV A;  1KZH A;  1RNL A;  1Z7U A;  4XQF A;  2DXI A;  1YW9 A;  2DPD A;  5B3S H;  3PM1 A;  4KMU X;  3JCU C;  3PUF A;  3KP7 A;  1NTC A;  4XOT A;  3KP6 A;  2R7Z J;  4Q48 A;  3H0D A;  4N9H A;  2E1C A;  1HC8 A;  3MZY A;  1K61 A;  4G6T B;  1X1D A;  5DD4 A;  5DS9 A;  1ZRD A;  1VQ4 I;  2KRC A;  1KYW A;  4BJ5 C;  2M1B A;  3NQO A;  4ZDO A;  3U1D A;  3O2P E;  5J1Y A;  3MMY B;  1EKE A;  2FUG 2;  3Q0W A;  4ZDL A;  3VYT B;  4JX6 A;  3GZ5 A;  3P7N A;  5TJJ A;  3B02 A;  4G94 A;  2ZJ2 A;  5DEQ A;  4BQN A;  4KIG A;  3SDG A;  1MJA A;  3GBG A;  3OYL A;  2Y2Z A;  3J80 K;  1O7L A;  3W6K B;  1SAN A;  2VBX A;  2MAB A;  1X19 A;  5M3F J;  2OTL I;  1RI7 A;  3TDU C;  4P9F A;  2ZME B;  3KP5 A;  1FOK A;  4A3L J;  4P1W A;  2L7K A;  4BE1 A;  3V8L A;  5M5W J;  4Y52 J;  4P5O A;  1ZR4 A;  3LA7 A;  4M6V A;  2R92 J;  4UNO A;  2B9S A;  1ERD A;  3HKZ N;  2PMZ A;  2WAQ A;  1QVU A;  3CDH A;  3I53 A;  1ZRF A;  2JPC A;  3J7Y J;  3F8F A;  1VZ0 A;  3M8F A;  4UV8 A;  2KFD A;  1A5J A;  1D1A A;  1EH7 A;  1IN8 A;  3RKX A;  2W48 A;  4AU7 A;  3RKW A;  2LKS A;  4XMY A;  2D5V A;  5FLV A;  3ONQ A;  2E19 A;  2V1N A;  4BE0 A;  1NHA A;  3DTK A;  2FU4 A;  3GZN B;  2EIL H;  3EDP A;  1B8I B;  2OQG A;  1HBX G;  2PBI A;  3SEZ A;  2RQP A;  3JAM K;  2RQQ A;  3ABM H;  5B1B H;  2DFH A;  3HG9 A;  1Y8Q B;  1BW5 A;  1SVM A;  3HOS A;  3VYS B;  4OOI A;  1UHW A;  2ZNZ A;  2IS2 A;  3GFL A;  1TC3 C;  4LB5 A;  2R93 J;  2P7V B;  3K4M A;  4H4K C;  2COM A;  3CP8 A;  1WWX A;  2IP2 A;  5JLW A;  1V4R A;  2MD5 A;  4XLE A;  3ZCO A;  2CYY A;  4RGU A;  1HKT A;  2VXZ A;  4DNC A;  5FRO A;  4UY8 I;  2AXL A;  2HOS A;  4CCJ A;  1YW8 A;  3G71 I;  2DQL A;  3G1L A;  3MEX A;  2CO5 A;  2CUE A;  2HXO A;  4L9N A;  4PGH A;  2R5Y B;  1K79 A;  1BI0 A;  2P81 A;  3J81 K;  3TW7 A;  3CC2 I;  3OYN A;  1B9M A;  2RAE A;  4PJM A;  1ETW A;  4FCY A;  3IL2 A;  4M3B A;  1LDK B;  1LFP A;  1TZL A;  4N4N B;  2VOP A;  2IGN A;  4EAT A;  3W6J B;  3KPH A;  2QSH X;  5FD5 A;  5F1J A;  3CUO A;  2KZV A;  1S8N A;  1W4M A;  4S0H B;  2RNJ A;  3DBH B;  5FLM J;  3RZD J;  1H0M A;  4C2T A;  2KZG A;  5BNG A;  2R7O A;  2ZNY A;  2EIK H;  2EIN H;  3P9K A;  1SVL A;  2VL8 A;  2XGE A;  3E5U A;  3R61 A;  3A03 A;  4YIF A;  1FLI A;  3F72 A;  5F0C A;  3VYR B;  1WVR A;  1YG2 A;  2Z1D A;  2YX7 A;  3QP5 A;  3FMR A;  4AC0 A;  5ICF A;  4BGD A;  4L18 B;  3SZT A;  3CF5 F;  1Z05 A;  1W0U A;  2DMN A;  4EJV A;  5F0H A;  3A1Y A;  5EEA A;  4IRG A;  5K7F A;  1W0T A;  3JTH A;  3FK7 A;  5DUI A;  2L0K A;  3FIW A;  3WTT C;  1MIJ A;  4XKW A;  5EF6 A;  1FIA A;  4XK4 A;  4RAG A;  1YYV A;  3WU1 B;  3LSK A;  5DTD A;  1FT9 A;  3V8J A;  2E1O A;  4L5I A;  2QSG X;  2VJJ A;  3GLX A;  5GPA A;  1TTY A;  5CVJ A;  4G7O F;  3FX3 A;  4D7N A;  2FJ1 A;  1R9T J;  2Q2E B;  1VQ9 I;  4FTH A;  2FML A;  4AWX B;  1FBU A;  2DA5 A;  4NUB A;  3OIP A;  2XAU A;  4E70 A;  1ETQ A;  2P0W A;  3IV5 A;  1K4T A;  3S2H J;  2PLY A;  3KZI C;  3K70 C;  4F52 A;  2D2W A;  1R00 A;  3E5X A;  3ZPL A;  5LRR A;  3CCL I;  1RIO H;  1FPQ A;  1J9I A;  2HR3 A;  4XKC A;  1QPI A;  3HZJ A;  2KDZ A;  5EYR A;  1VQO I;  1DPR A;  4C3H J;  2X1D A;  1XS9 A;  3FBN B;  3LQQ A;  2LLK A;  2E1M C;  1XMK A;  2GIZ A;  5E3L A;  3TKY A;  2DT6 A;  2ZBK A;  4IZZ A;  5D4R A;  1X1P A;  3AAF A;  3HL2 A;  1APL C;  4F55 A;  1KU9 A;  1XMA A;  3LOC A;  2NYX A;  3CUQ B;  3E6M A;  5AON A;  2GXA A;  2V26 A;  1AOY A;  2GXG A;  1IZ1 A;  5DD8 A;  3QU6 A;  3JRI A;  1FBQ A;  2GA1 A;  3U21 A;  2CV1 A;  1DQU A;  4M3G A;  3H36 A;  1MDM B;  2WY8 Q;  2DMP A;  5EG0 B;  1HST A;  2R4G A;  4PJN A;  3OL3 A;  1G59 A;  3CJT B;  4P96 A;  3NWS A;  1K6Y A;  5H6Q A;  1I3A A;  3AL0 C;  2NS0 A;  3BR6 A;  4BQA A;  4UB6 C;  3Q9V A;  3S17 J;  4KN7 X;  3CD6 I;  3H9Q A;  1ZLK A;  2PN6 A;  1R22 A;  4IEJ A;  4ZYE A;  2QGU A;  3WHC A;  3DU5 A;  2H8R A;  4RBO A;  2DA4 A;  1IC8 A;  4AIK A;  1FOY A;  4GGG A;  3K2Z A;  2YSR A;  2LR8 A;  2X6W A;  1KU2 A;  3GME A;  2KRF A;  4EJU A;  3T8T A;  3L2U A;  3QPT A;  5D5U B;  3FXO A;  2LY2 A;  2DJN A;  2E1N A;  3J7Z I;  1U9N A;  2LH9 A;  2A6E F;  4CCL A;  2NNY A;  1K7A A;  1JUS A;  2O0Y A;  1ZYR F;  4RLQ A;  2CGP A;  1TQI A;  4M3F A;  3OSG A;  1FNN A;  2N8G A;  3LFU A;  2R3S A;  1XD7 A;  1FMV A;  3D0S A;  5HS9 A;  5IY5 H;  2JA6 J;  2XPW A;  3OS0 A;  2CQQ A;  3R6S A;  3ROU A;  3JSO A;  1I1S A;  2R7F A;  3ERM A;  5E3M A;  3CME I;  1F1Z A;  4GRI A;  1LUJ B;  3F9K A;  4RMN A;  1MBH A;  2Q0O A;  1G8X A;  3V7S A;  4HV5 A;  1VQP I;  3DFG A;  2ID6 A;  4UUS B;  3AKZ A;  2JA8 J;  1QO0 D;  3BJO A;  2J5O A;  1R7J A;  2L5Q A;  3IRQ A;  3DLA A;  3LMM A;  4FE4 A;  5B1A H;  1H9T A;  2YS9 A;  3F21 A;  2IGM A;  3RKY A;  2QM3 A;  3OYG A;  2EA4 A;  3B6C A;  2YUS A;  3HTU A;  2JMW A;  1YX3 A;  5AIP A;  4LG0 A;  4AVP A;  1UJ8 A;  2GLO A;  1BJA A;  3HKZ A;  2DW4 A;  3DF8 A;  3HUG A;  2MH9 A;  2DLL A;  2DDA A;  2FQ4 A;  2LRE A;  4XN0 A;  4WK8 F;  4Q5S F;  1ZG1 A;  1XGO A;  3EUK L;  1TWG J;  2W82 A;  2EFO A;  1MGT A;  1W1W E;  3L7W A;  3IRR A;  3D5R C;  3H5R A;  4IHX A;  2XB0 X;  5FRN A;  1YFH A;  1IN5 A;  2X48 A;  4WX9 A;  4NC8 A;  1IDZ A;  3J7A O;  2X4H A;  3WTX C;  3R4K A;  2A07 F;  2BZT A;  2Y30 A;  2K5C A;  1YI2 I;  2CRG A;  1YQA A;  2WV0 A;  5IP9 J;  2O9L A;  1ON1 A;  4EM2 A;  1IJW C;  1L0O C;  3LQR A;  1CGP A;  1XGN A;  3CCJ I;  1XTA A;  3DBR B;  4A3J J;  2DCE A;  2K9S A;  3E5Q A;  3HOX J;  3RYP A;  3FXL A;  1V54 H;  5FB2 A;  3QQA A;  3IKV A;  4M3D A;  2K9N A;  4C9Y A;  5BS6 A;  2PMH A;  1YTY A;  5JVT A;  2ZXI A;  3RQ4 A;  2HKO A;  3AG4 H;  3FXK A;  2XPU A;  1ZHF A;  3RSN A;  4UVC A;  2KHM A;  4ENK A;  2XSD C;  4MO7 A;  2Y0S N;  4C3I J;  2YR2 A;  5F64 A;  2IA2 A;  3TED A;  3G73 A;  2TRT A;  1OPC A;  2XKO A;  2QKM B;  3OOU A;  2L9S A;  1J59 A;  2EV5 A;  4XRM A;  3G4S I;  5JVG F;  4MTE A;  4U87 A;  4QPQ A;  6PAX A;  1IRZ A;  2ZO4 A;  5E8I A;  2M87 A;  2VKH A;  3RCO A;  1TT5 B;  4HX8 A;  2YU9 J;  1BA5 A;  1FOW A;  3IP4 B;  3G2B A;  3FM3 A;  1G3T A;  5FGM A;  1ZTR A;  3FHZ A;  5E8G A;  4E7S A;  1UCR A;  4AD9 A;  4E7Z A;  1QHH D;  5IPA A;  1AKH A;  4HW0 A;  1U2W A;  1T33 A;  3DU6 A;  5LBQ A;  1MSF C;  4XSZ F;  1PJR A;  1MMS A;  4XOR A;  1DP3 A;  2F4M B;  2DOD A;  1MBE A;  2LD5 A;  1RR8 C;  5J1U A;  2EA2 A;  2M0M A;  3OYI A;  2L01 A;  5IOY A;  4ZYG A;  3F23 A;  1GV2 A;  1VQ8 I;  4EJW A;  2LY1 A;  1EA3 A;  2VKV A;  3PJR A;  3GTO J;  2R7Q A;  1D1C A;  2HEO A;  5CVR A;  2OV7 A;  1TL8 A;  1OCC H;  2M0C A;  1D8J A;  2RRE A;  5E20 A;  2NVU B;  2VBW A;  1UG0 A;  1D0Z A;  1VQM I;  3TL4 X;  1F4K A;  3WU2 C;  2DAO A;  2FNP A;  4OIR F;  2TCT A;  2AS5 F;  2FOK A;  3VYU B;  1JT0 A;  2W57 A;  3ABU A;  5B66 C;  4MHG A;  2VQG A;  4BUP A;  3Q5F A;  1R1V A;  2ECB A;  4BDZ A;  2PJP A;  5J8F A;  3PFI A;  2NS8 A;  3FBI B;  3FXR A;  1Y1V J;  2XRL A;  2LTP A;  1PP7 U;  4B48 A;  2RKH A;  4JBA A;  1R1T A;  2E34 A;  3BG3 A;  4XLC A;  1GUU A;  2WAF A;  4QPO A;  1QGP A;  2ZJQ F;  2ZKZ A;  4PGG A;  2NS7 A;  1WJC A;  3FXM A;  2V9V A;  5H20 A;  2OCC H;  2HVQ A;  3PO2 J;  5HOD A;  2MGQ A;  3K4C A;  4BXU A;  3ZQQ A;  1YW7 A;  3OYF A;  2M34 A;  3OYC A;  3BPV A;  2EV6 A;  2XF7 A;  4Z2Y A;  3EUH A;  4MQV A;  2OBP A;  3LSM A;  3TMO A;  2HQR A;  2H09 A;  3BR0 A;  4EGZ A;  3DTE A;  2BW3 B;  2M7A A;  3OIO A;  1WPK A;  1LNW A;  2DJI A;  2FQ3 A;  2O8X A;  3HGG A;  3I5U A;  3MZH A;  3GF2 A;  4XLA A;  3BG6 A;  4G9Y A;  3CLQ A;  2ISZ A;  1LDD A;  4MEY F;  2G7U A;  2HQN A;  2HZD A;  4IQ4 A;  4LIV A;  2VPR A;  3BTC A;  1FTZ A;  4IL6 C;  1UEL B;  5D8L B;  3QAH A;  4RM2 A;  2QVO A;  3EYY A;  2VPL A;  1XB4 A;  3ZP5 A;  5J40 A;  1S3J A;  3OY9 A;  2BV6 A;  2CSO A;  1ZLJ A;  1TQP A;  2JVH A;  1DDN A;  4ITV A;  4M72 A;  1ETK A;  5E18 F;  1TNS A;  1YOV B;  2M30 A;  3GW2 A;  3N05 A;  5J3L A;  2ZB9 A;  3QYE A;  3RPU A;  2V1U A;  4FIS A;  2PJR B;  5E1Z B;  4KUM A;  4ESF A;  4NQW A;  2NVT J;  2NOG A;  2MG4 A;  4RGS A;  2AO9 A;  1X2N A;  2FA5 A;  3ESW B;  2X1E A;  3DKW A;  2ETH A;  1RKT A;  3M4O J;  3HHG A;  4IHV A;  1O7F A;  1WSU A;  2KJC A;  3K10 A;  1X4P A;  5GAG J;  4GXO A;  1H88 C;  2QLZ A;  2EIJ H;  2HOA A;  4F93 B;  2CFO A;  1WJF A;  2ZXJ A;  4UV9 A;  3BJA A;  1O3T A;  1PDN C;  2Z99 A;  1ZEL A;  4N9I A;  1H9G A;  5F08 A;  2HZT A;  4GCV A;  5J6X A;  3VEP A;  3BTJ A;  4BBR J;  4D9J A;  2DA2 A;  1DP7 P;  2X9D A;  5TGT A;  1S9H A;  3WTW C;  2LDU A;  2MFZ A;  2VLA A;  1HOM A;  5J47 A;  4IHY A;  3BR3 A;  3PIO F;  1TLH B;  3DBL B;  1BIB A;  2K02 A;  3CCS I;  1A36 A;  1FY7 A;  3I4P A;  3HRT A;  4X1E A;  4XN3 A;  3J7A Y;  3FHN A;  1SAU A;  3K4J A;  2YPR A;  4AID A;  4C3J J;  1DPU A;  2MH2 A;  1IG7 A;  5ICC A;  2KPM A;  1SD4 A;  1GDT A;  4B4C A;  2G9W A;  2HNH A;  1JJ8 C;  1EJ9 A;  1G2H A;  2MC3 A;  3BT9 A;  4MIM A;  3I4M J;  1Z6R A;  5LLQ A;  2H94 A;  1NG7 A;  2P8T A;  5D6E A;  5E1W A;  1VFC A;  5JR3 A;  1BW6 A;  3TGN A;  2HDD A;  1UG2 A;  4F7Z A;  4XNF A;  4EJO A;  1Q1H A;  1RET A;  5KHD A;  2UWM A;  3IUO A;  5ERI A;  4DYQ A;  2JUC A;  1GXP A;  1R6R A;  5E1X A;  5L3F A;  1B72 B;  2Y48 A;  4G8X A;  3ZMU A;  5DM7 F;  3ULQ B;  4X6A J;  3KYD B;  4L9J A;  3ZRG A;  2QZ8 A;  4WF2 A;  1V3F A;  1ETV A;  4V2G A;  1Z77 A;  1N77 A;  2RC4 A;  2B63 J;  3OV8 A;  1V5F A;  3LAJ A;  2EFN A;  2JQ7 A;  2M3A A;  4HAM A;  3MKL A;  1V5G A;  1R4M B;  2CQ7 A;  2LVS A;  1UST A;  3CCU I;  5L3D A;  2P5L C;  5FD6 A;  4BY7 J;  4CSW A;  2HDW A;  4RAF A;  3V7C A;  1WRJ A;  3COA C;  2F5C A;  1RKW A;  1SFE A;  2Y0S A;  4HSR A;  2CMP A;  1Z0X A;  4LG3 A;  3DPL C;  2EJR A;  3X2Q H;  1PUF B;  1T08 B;  2VKD A;  3CCV I;  2DTZ A;  5F04 A;  2MSY A;  5BPI A;  4ZC3 A;  4F3Q A;  3BG9 A;  2M5W A;  3QWL A;  2HPI A;  4LB6 B;  1XSX A;  2ZME C;  1YJN I;  4O6J A;  3TP3 A;  3WTU C;  2V79 A;  1MH3 A;  1VTN C;  1OCZ H;  3V42 A;  2K3P A;  2UXN A;  4RA2 A;  3RQI A;  3ZMV A;  5M5Y J;  2AXT C;  3S8P A;  1FEX A;  1QQI A;  1LQ1 A;  4BBS J;  2H6C A;  2HVR A;  4RGR A;  3V7R A;  2I10 A;  3KYC B;  1MJB A;  4M9Z A;  3HSR A;  5HDK A;  2HYJ A;  3TQN A;  1LJ9 A;  3GX4 X;  1D3Y A;  1X3W B;  2MC4 A;  2KKO A;  2X1C A;  2F5D A;  3VSK A;  1ZQ3 P;  5E3O A;  2E2I J;  1L3L A;  2QEX I;  3BZC A;  2XF6 A;  3HJE A;  3RPQ A;  3L2R A;  4LLN A;  2IBD A;  2STW A;  1N25 A;  2BY3 A;  3BP8 A;  2AQE A;  1H8A C;  4OIQ F;  5K5O A;  1LE8 B;  3K4B A;  4I99 C;  3AG3 H;  3ISP A;  4L0Z B;  3LA3 A;  3TOB A;  2CV0 A;  1P2F A;  5LGN A;  2H1L A;  4Y33 A;  5CKT A;  1IRF A;  3BCA A;  2CH0 A;  4G7Z F;  4Y4R A;  1GVJ A;  2IS6 A;  3OYE A;  2Z3Y A;  4A6E A;  1O3S A;  4A5N A;  3F8N A;  1U5T A;  2DFE A;  4KN4 X;  3KP2 A;  4S05 A;  1DUX C;  5F6F A;  4WCG A;  3A01 A;  3H35 A;  4M9X A;  2E60 A;  1W7P A;  3F8B A;  3K4N A;  1ORK A;  2XDV A;  1C0W A;  2LKP A;  1T39 A;  1VQ5 I;  4ANJ A;  2V7F A;  3OR2 C;  3I0T A;  3HIF A;  4HZF A;  5HLI A;  2W7N A;  2D1V A;  3OYJ A;  3A02 A;  4I7H A;  4U88 A;  3OSF A;  2F6C A;  5CJ9 A;  5LD2 C;  2FBK A;  1UFM A;  2VJ5 A;  5C4J J;  3SJM A;  4MQ9 F;  1IN7 A;  1MMA A;  3PQJ A;  1TW3 A;  3NEU A;  5FRM A;  4HOB A;  4YII A;  5D4S A;  3BC8 A;  4BEH A;  2I8D A;  4ABZ A;  2M2E A;  1O4X A;  2GBY A;  1MBF A;  4A3G J;  2DDB A;  3NAR A;  2KJB A;  3IH2 A;  1QZZ A;  4FX0 A;  1HW1 A;  5HVQ C;  2WAE A;  1HDP A;  5LGU A;  4DOZ A;  4CYC B;  2QEN A;  5EGO B;  5L3B A;  1QZY A;  3GZ6 A;  2IA1 A;  3BWG A;  4O3M A;  1GHC A;  3OYM A;  4NC6 A;  1OJL A;  1R4N B;  3WOD F;  4DBR A;  4JX5 A;  1JXS A;  3HSF A;  3HGY A;  2DO7 A;  2M8G X;  3VFZ A;  3ZGK A;  4ZYH A;  2JA2 A;  3Q0U A;  1U5T C;  4MEX F;  3LSJ A;  2Z9O A;  4XR6 A;  3CMY A;  5FO5 A;  1J09 A;  4YEL A;  4MTD A;  1LDJ A;  2LY9 A;  3EET A;  3FKJ A;  3T5X A;  5D5X B;  5M5X J;  3W2A A;  1QA6 A;  5GAH J;  2OTJ I;  2RN7 A;  1F9N A;  2QQ8 A;  1DGW Y;  1TQM A;  4YIR X;  3W2V A;  4HST A;  2WAD A;  3CCR I;  4CHU A;  1YX5 A;  2PG4 A;  3MFK A;  3A2K A;  4DZP A;  3H3V K;  3ASN H;  2A5Y B;  9ANT A;  2BXZ A;  2O5R A;  4PK4 A;  2FX0 A;  1Y0U A;  4HEA 2;  4PZJ A;  4LIU A;  2BY2 A;  5CYV A;  3K7A J;  5HLH A;  3GTQ J;  1WJE A;  2IGO A;  3SHF A;  3FMS A;  4HF2 A;  1AU7 A;  1YRN A;  3JRA A;  4FET A; 
#chains in the Genus database with same CATH homology
 2K3F A;  2E35 A;  1YHQ I;  2E34 A;  1YI2 I;  2ZJQ F;  1ACI A;  4UY8 I;  3G71 I;  3CCJ I;  3CJT B;  3CCM I;  1YIT I;  2ZJP F;  2NXN B;  3CC2 I;  2H8W A;  4V19 K;  4IOC F;  5DM7 F;  1VQ5 I;  3CD6 I;  1YIJ I;  3I55 I;  3CC7 I;  1FOY A;  2JQ7 A;  1HC8 A;  3DLL F;  1S72 I;  3CCU I;  1VQ4 I;  3G4S I;  5JVG F;  3J7Z I;  1VQN I;  3G6E I;  3CF5 F;  1VQK I;  1VQ7 I;  1YJW I;  1FOW A;  4IOA F;  3CCV I;  5DM6 F;  2OTL I;  1VQ6 I;  4IO9 F;  3CME I;  3PIP F;  1MMS A;  1YJN I;  1VQ9 I;  1VQP I;  1Y39 A;  5GAG J;  1QA6 A;  5GAH J;  3CC4 I;  1VQ8 I;  2OTJ I;  3J7Y J;  1YJ9 I;  2FOW A;  3CCQ I;  2QA4 I;  3CCR I;  5GAD J;  3CCL I;  5GAE J;  2E36 A;  1VQO I;  3PIO F;  2QEX I;  1FOX A;  1VQM I;  3I56 I;  2ZJR F;  3CCS I;  3CMA I;  3CCE I;  1VQL I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...