3CCJI

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 11
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3ccjI00
3CF5F 1VQKI 2ZJRF 1VQMI 1FOYA 3J7ZI 3CCEI 1YI2I 1YHQI 1YJNI 5GAHJ 2K3FA 3CMAI 3CCVI 2E34A 2H8WA 3CCSI 3G71I 2E36A 3CCUI 3I56I 4IO9F 5DM6F 3PIPF 1S72I 1ACIA 3CCMI 1FOXA 1HC8A 3J7YJ 5GAGJ 1VQ7I 1VQ4I 3CCQI 3G6EI 3PIOF 5JVGF 1VQ8I 1FOWA 2QEXI 3CC4I 1Y39A 4UY8I 1VQLI 3CD6I 2QA4I 3CC7I 2JQ7A 4V19K 3CCRI 1YIJI 1YJ9I 1YITI 3G4SI 4IOAF 3CJTB 2E35A 2OTLI 3DLLF 1YJWI 5DM7F 2ZJQF 1VQPI 1VQNI 1VQ6I 2FOWA 5GAEJ 3CMEI 2ZJPF 3CC2I 2OTJI 1VQ5I 5GADJ 2NXNB 1QA6A 1VQOI 3CCJI 1MMSA 4IOCF 3CCLI 1VQ9I 3I55I
chains in the Genus database with same CATH superfamily
2MA3A 3IH2A 2QKLB 1YE9A 2FF4A 4YFNF 4P5OA 4A3KJ 2HGCA 3UR3C 1U8BA 2VASA 1TQPA 4LK1F 1MDMB 1IRXA 3HC7A 3BR6A 4V2FA 5HOOA 3DLAA 2CV0A 4GDFA 2KLOA 2GM4A 1CF7A 4BDYA 3OSGA 1U6GA 2KJCA 2KMUA 4M73A 1W7PD 4B8XA 1QHHD 1B8IB 3HB9A 1W5CC 1B72A 1Z91A 2P7CB 2V1UA 4XSZF 4ITVA 2E36A 4IZZA 1F4KA 1MW7A 3Q0WA 3JRGA 2HVSA 3OYGA 1YO5C 1O3RA 4BKXA 2PMZA 3WGIA 4OU0A 2DQRA 2NRAC 1XMKA 3H9JA 4Q48A 3RSNA 1VF9A 1ZK8A 4A6DA 2IEKA 2W57A 2EZHA 3ZMUA 1BIBA 3V7RA 2LKSA 2V9PA 5GADJ 3KETA 1SFOJ 3TP0A 5CVJA 3GMEA 1VQMI 2IGNA 5IPAA 5J1RA 3RZDJ 2QM3A 1O3SA 4G6QA 4KUMA 1JE8A 3GEZA 4N9HA 3J7YJ 1WCMJ 1ETXA 1SD5A 2K4BA 3BG7A 4LIVA 5HS8A 3V8LA 3BQYA 2XASA 3EDPA 3QPLA 3F8MA 5HS9A 5EYRA 3V42A 2RVCA 4PJNA 4CCLA 2L9SA 4A3MJ 4IHTA 4YFXF 1XDUA 1BOBA 1OYYA 3E3VA 4ZC3A 2EZKA 2AS5F 2XV4S 3TO6A 4A12A 5F64A 2AO9A 2XKOA 3FZVA 4Q4ZF 2DMTA 5GAHJ 5DD4A 2M8EA 5E3MA 3FMRA 1USSA 5A2QK 3B73A 4BXFA 5CQGA 1ZARA 3FBIB 1AWCA 2UV1A 1K61A 3BR0A 5C4JJ 4CCOA 5LLQA 2QF7A 2ELHA 4AU7A 3JR9A 1AKHA 2R7VA 3CCRI 5FFXA 4I02A 4XOPA 1YITI 2DU9A 2B7EA 1P7IA 3BJOA 1DU6A 1W0UA 3OYDA 4NUBA 2MLKA 2Q0OA 1UCRA 1X3UA 3QOPA 5LHIA 1T8IA 2UXNA 4RAGA 1VQ9I 5E3OA 3HEFA 5E1XA 2HZDA 1I3AA 2K02A 4H0EA 4IL6C 3CUQB 3CUQA 3B6CA 1MD0A 1W1WE 2YX4A 4OMYA 1IRGA 2RKHA 4CGZA 2ECCA 3JAMZ 3A01B 2NVXJ 4KN4X 3BR2A 3VDXA 3O8HA 5GTHC 4U88A 2EV6A 3BR5A 5D5WB 3OYCA 4J19A 2QZ8A 2K9NA 2R7OA 3H3VK 4KYWA 3V7CA 1ZGWA 2CUFA 3K4NA 2IRFG 3F8CA 2NXNB 4KN7X 4ESBA 2HWVA 5KK1A 1D1CA 5C44J 1RZ4A 1MBFA 1S7OA 2DMQA 3SDGA 2HDDA 4B47A 1FWZA 5DCFA 3QPTA 1D0XA 4G6DA 2P6TA 1Y8RB 3CJQB 5HDKA 2LYCA 1R1UA 2HKOA 2ZO4A 1I50J 2HVQA 1MMAA 4NC7A 4ON0A 1IDZA 3A03A 2Y0SN 4M3EA 4ESJA 1ETYA 4LB5A 1TNSA 2LY1A 4PZJA 3KZIC 1EH7A 4CZZA 2YS9A 1YIOA 1XGOA 3OOPA 1Z7LA 4LIUA 1H89C 2ICWG 3BZCA 2N8GA 3UNGC 4XN3A 2KKOA 4DYCA 5E1WA 2CJJA 3ABKH 4XMYA 2VJ4A 1IO2A 2HYGD 5F0FA 4PUSA 1V54H 1I27A 1W7PB 3ROUA 4UXNA 2QQ8A 4CA0A 2O61A 1DPUA 1X1CA 4D9JA 1PP7U 4CCJA 5M5WJ 3TGNA 2FE3A 1IN7A 1ZG1A 2R7TA 5J8CA 2HEOA 2BEOA 2K9MA 2Y2ZA 5L3EA 4A5NA 1VTNC 4OIOF 2NS7A 9ANTA 5HVQC 2DFIA 3PIPF 4ZYDA 2VC1A 2IA0A 4LB6B 2X1EA 4PDKA 2ZNYA 2L7FP 4IRGA 4XN0A 2XRNA 3AG2H 4XICA 1OPCA 4IKFA 2XPUA 2W4SA 3CDHA 3G4SI 5FLXZ 4E4HA 1F36A 1MNEA 2WV0A 4FHTA 4EJVA 1WHUA 1QPIA 2EB7A 4HV5A 3C3WA 3G1MA 1SVOA 4EMSA 2M3AA 2ID6A 4DBQA 2ME0A 3OYMA 3QP5A 3H92A 1UAAA 3CCSI 3BTIA 4IO9F 4CUGA 5D5XB 2DXIA 2H6CA 4BXUA 4EV0A 1TW2A 2M87A 2OZ6A 4ZJZA 3RKWA 4PSWA 2WB1A 3KP4A 3L9FA 5CVIA 3WTVC 3EUKL 1SVMA 3TOAA 2KZGA 3FISA 1IN8A 1Z3YA 5FD5A 3U9GA 2OV7A 2E1OA 3U1KA 4KNYA 2EQRA 3VFZA 4CCNA 1MMDA 1E3HA 3NWTA 4BY7J 3PSIA 4BHPA 1IJWC 1J7KA 1HXDA 3M3YJ 2H09A 2CS3A 5DM6F 4LJZF 2MD5A 1VZ0A 1Z6TA 2V6CA 3H5NA 2Z16A 1JGSA 2CQKA 1VQ8I 2BW3B 2W7NA 2OCCH 1QGPA 3G73A 2F2EA 1BC7C 5D8KB 3S1QJ 1TP4A 1RUNA 4Z2YA 3IUOA 1YQAA 3PUFA 2WTEA 1F1ZA 2KIUA 5FRNA 2DYSH 3NEUA 1WSUA 4BL0B 4F52A 3I59B 1BJAA 5F04A 1WJCA 3DEEA 2X0LA 1BA5A 2K9LA 3I64A 3A4CA 4XRSA 3FX3A 5FROA 1KU7A 3GTLJ 3HSFA 3LOCA 3VSKA 1NH3A 1MKMA 4A0ZA 4HSRA 4C3IJ 1VFCA 3BZKA 3HOZJ 1ZTRA 3JRHA 2ZXJA 4B43A 2O3FA 1K78B 2R7XA 4XRFA 1P92A 2BHYA 2Y0MA 1G3TA 2I8DA 2ZSHB 3F23A 4PK4A 1BL0A 3L2VA 1PDNC 1P6RA 2BHZA 2NOJB 2DA2A 2JWTA 4EJOA 1IN5A 2L02A 3IAM2 4KIFA 5J3LA 4PGGA 2E7WA 3NQOA 3HPHA 1ENHA 4QPOA 3ASOH 2LTPA 2QCOA 1T08B 2L2OA 2EBIA 1ON1A 1IV8A 1WGXA 2M45A 3I56I 1DDNA 2P7VB 3WTXC 2HOEA 1BI3A 3FXRA 2CRGA 4PGHA 2KFDA 1NG7A 1VQLI 1JKQC 1FSHA 1C0WA 4GGGA 2OC6A 3U1DA 5IP6A 1P9QC 3JTGA 4XR6A 4HX7A 3C7JA 5DDGA 3SDBA 4CCKA 5EGOA 3EUHA 5HODA 2VQLA 3DKYA 4LGWA 4YIRX 5FFZA 1HF0A 2WY7Q 2BXZA 2ZXIA 1FTTA 2Q2EB 1FOYA 1YI2I 2IW5A 3QWLA 5BQTA 2XB0X 1W5SA 3QPSA 4MHGA 5M3MJ 3KEYA 2VL8A 3HUGA 3HM5A 3K4KA 3S16J 1PYVA 1KQ9A 1XD7A 2RNJA 2DPUA 4X6AJ 3IKTA 2BOLA 1SEUA 4V19K 2HQ5A 2AXLA 1WH7A 1LFBA 1W7PA 5DCMA 2VKDA 3IH4A 4DBRA 4XQFA 3MZYA 2M2EA 3JRCA 1VQ6I 5CPRB 4WF2A 3KP7A 4OAZA 4ZTJA 1IXRC 2W85A 1JT0A 4JYKA 1XSXA 3RKQA 1IUFA 4BHCA 4BQAA 1OJLA 3CMAI 2ZC2A 2VJIA 2CO5A 3G71I 3KFWX 3MCZA 4BBSJ 4F55A 4ENKA 5CVUA 3VYTB 4RM2A 3FXUA 2Z99A 3W2VA 4GYGA 2IT0A 3RDIA 4HF0A 3RQ4A 3RYPA 4MIMA 1WJ5A 4DNCA 1XCBA 1YJ9I 1U3EM 4W1UA 4A0XA 1UHMA 2MC3A 3BTLA 3J80Z 5J4VA 2HKXA 2XGCA 3K7AJ 5F6FA 3H9QA 3BQZA 1BR4A 4WK8F 2GXGA 4OIRF 2YPRA 1CF7B 1R7JA 2Y9ZA 2R4GA 5ED4A 3PNVA 3PNTA 1R9TJ 5LHGA 3F8NA 3V8JA 1B8IA 1O7FA 1RKTA 3L2UA 3HOVJ 3Q3SA 3ERED 1Z05A 4XM3A 2O6GE 1MMGA 3GO5A 3FKIJ 2ZNZA 3HJEA 1Z67A 3RYRA 2ZJPF 1ODDA 5FKLA 3PO2J 3OOUA 1IN4A 1GVDA 2UZKA 2XHKA 1TNTA 3S3NA 1RKWA 1QQIA 2W24A 2ZFWA 3O2PE 3ABLH 3ZN1A 3I3LA 2DFFA 4RAYA 3S14J 2DA6A 4KT6A 2EWNA 3CESA 2R7WA 2O8KA 4P96A 5H20A 1A36A 3RQIA 4O5VA 3RCOA 3OY9A 5LEKA 3CQZJ 3NWSA 3EETA 2ZXWH 3R61A 2HZTA 2F4MB 1HKQA 1Z3XA 3I53A 2VE8A 3HRUA 1AKHB 2JZYA 5EJCA 1Z21A 1XC5A 1X1BA 4ETSA 1TW3A 2K7LA 3HPGA 1F43A 4L18B 2H6BA 2VE9A 3IWFA 2JVGA 3K4JA 1LVKA 3C1DA 2B9SA 1VQ4I 5ICGA 3S3OA 3CC4I 2DJNA 4QLCU 1WZ2A 1WRJA 2QBYB 3H3UA 4S0HB 4RA2A 5GTIC 1B59A 1WFXA 4XLAA 4ENNA 2X4HA 2EFQA 1FSEA 4M71A 1OMIA 3ZQFA 1Z0XA 5K5OA 2V1XA 3I55I 1O7LA 4A3LJ 4XK4A 1T2KA 1IF1A 2VBZA 5DTDA 2M0MA 1U78A 2IPQX 2WC2A 3OYEA 1S72I 1O3TA 4B48A 1HDPA 2FNAA 2M1BA 3DPLC 4UUVA 3BG5A 2X48A 1EKEA 3DKXA 4F3QA 4XLPF 3E5XA 4EGZA 3OYJA 3FHNA 1ZAOA 3VYSB 1NK3P 1UHWA 2F5DA 5E79C 3A2KA 3FBNB 2X9DA 1P4AA 3K4BA 2NNNA 2AQFA 4FE4A 5BOXA 2KDZA 2E2IJ 1XGSA 5ILUA 1ZR4A 1FYMA 2R5YB 3CZ6A 4Y17A 4IHXA 1V5EA 1TL8A 2A05A 3BG9A 2I10A 3PIOF 2CFXA 2DT5A 2ZMEC 3VOEA 4F7ZA 1QVTA 2F5FA 1K6YA 3FDYA 1J9IA 1G3WA 4A3BJ 1A5JA 1JTXA 3WG7H 2Z5UA 4D7NA 3GBGA 2VT2A 3JSOA 4DOZA 3ECHA 4MQVA 1MMNA 1TLHB 4FX4A 4DIQA 3BCBA 2L9NA 4IHSA 4C2MJ 3MN2A 1BC8C 2DAOA 5KAIC 1K79A 2VIXA 2EA4A 3H0GJ 5H2FC 2OAZA 3U2RA 1TC3C 2JQ7A 2ZMEB 4NC6A 4C30A 1D5YA 3BR1A 5H6RA 2XPWA 2ZJQF 2QLZA 4XKBA 3QPHA 2ME6A 2XF7A 1I39A 1MH3A 2K3PA 4YEJA 3WTYC 2ADUA 1B6AA 1FBQA 1OFCX 2C6YA 4M6XA 2A3SA 2MD0A 3CMYA 3GVAA 1E3PA 5F1RA 3CF5F 1G4DA 4A69C 4L0ZB 2YU3A 2M5WA 3OL4A 2HTJA 1UJ8A 1QU3A 3OYBA 2ZBKA 2PX9A 4L9JA 3EYIA 2FUG2 1K83J 3KE2A 1IRZA 4BY1J 2HS5A 2WAQA 1I3QJ 2DOFA 1OYWA 3CD6I 3GUDA 3RKYA 2A07F 2OBPA 4P9UA 1NHAA 1E3OC 2XAGA 3ZRGA 1S6LA 4M9SA 1FMVA 1P7JA 3R4KA 1X3WB 4MQ9F 5GPAA 1ZH5A 3OIQA 3VODA 3R0AA 2OTJI 1JUSA 4MO7A 1HSTA 2KJBA 1E17A 3S32A 2LD5A 3I4PA 3S2WA 4AD9A 1XX5A 3M1EA 1R71A 1ETWA 3HKZA 2WBMA 3L1PA 1ERDA 2G0EA 4NC8A 3M4OJ 1MIJA 1XMAA 2R5ZB 1NG6A 4ENMA 3ZQGA 5JHUA 2HR3A 1FOWA 3ZQHA 3OS2A 4L5IA 3GTPJ 2HQRA 4I7HA 1BN5A 4HG2A 2CSOA 2ACJA 2XGDA 1R23A 3BCAA 2NOGA 2IS2A 5HLIA 4P55A 5M3FJ 3GF2A 1A6IA 1X1PA 3F0CA 1MJAA 3LSKA 1G2HA 3KP5A 2ZSIB 4CSWA 2YU9J 3RI4A 5J1UA 2VC0A 2GZWA 4UUTA 2HYFA 4RB2C 1N25A 2E1CA 2CMPA 2HQAA 3ZQIA 3F9KA 2JTVA 4B1RA 4DZJA 2LKXA 2PMUA 1R49A 4EM1A 2VT3A 3SJMA 5KNLA 3K1PA 4WXCA 3ABUA 3P5JA 4FETA 1LQ1A 1WJEA 1FIAA 2KHMA 4YG2F 5C3EJ 4AUXA 1RNLA 2LKPA 2BE5F 3A01A 3KPHA 2K9QA 3ZR8X 3CO7C 3A0HC 3GWZA 5FD6A 2VONA 2DA1A 2BW3A 2TRTA 3PQKA 4WXDA 5EZHA 3OS1A 4ABZA 4RGUA 5HNHA 2IS1A 1UG2A 1Z9CA 1F5TA 2JUCA 2HOSA 2W48A 4DJAA 4G7OF 2LVSA 2KQRA 2D1VA 3KYCB 3CO6C 2H27A 3K2AA 1SC7A 2JK3A 2M4GA 3L09A 3TW6A 1PVEA 5CJ9A 4UY8I 1TWAJ 1OCCH 2OF7A 2XGEA 2OD5A 4IOAF 4DZPA 3GZ5A 1WI3A 1SD6A 2XAQA 3H9GA 4M3FA 2M0CA 3GFLA 1OR7A 4HSTA 1Y1VJ 3DWLE 3IC7A 2HDWA 1FYLA 1D8JA 3DXJF 1VI0A 1HA8A 1SMYF 4IRIA 5FKKA 1A04A 4HQMA 3FK6A 1V55H 2QEXI 1S7AA 4BEHA 2KIFA 2L7MP 1BR1A 2Y31A 1FBSA 2HNHA 5KVRA 5DUIA 5JVTA 2MG4A 4A3EJ 4U0WA 3HHHA 4PFPA 4ZDPA 1S8NA 2F5VA 1HDDC 3OIOA 5DS9A 3E1SA 3WHCA 2FU4A 5LGUA 1T95A 3E6BA 1S7EA 5ERIA 5BPDA 4HEA2 2VODA 3I4MJ 2DTZA 3MKYB 3PNYA 4LITA 5LRRA 1KYWA 2L01A 4P9FA 5E1ZB 2YSRA 1UMQA 2DT6A 3AG1H 2X1DA 3F8BA 4DYQA 5D5VB 1FX7A 2YR2A 2M9HA 4NB5A 4DQ2A 2YUSA 2OTLI 2MYSA 4EGYA 2V26A 4O6JA 2K4JA 5K1YA 2LY9A 2BY1A 1V5GA 3S2HJ 2OPTA 2A69F 2ISYA 2R7SA 1N75A 2HPMA 2KRCA 1TTYA 2HOAA 1STZA 3UKGA 2F6CA 1A35A 1X2NA 2R7ZJ 2RNGA 1RRJA 3ZN0A 3L00A 3SEQA 3RIRA 2FNPA 4A6EA 2P4WA 1XDSA 2FXAA 4CO8A 3SHFA 5EEAA 1KU9A 2D5VA 2DOEA 4C3JJ 1YJWI 2STTA 1VQPI 3ECOA 1BI0A 4PJLA 4BJ5C 1XG1A 3ELKA 1XSVA 2JSPA 3K4CA 2QQAA 2FRHA 4JQFA 3QP6A 2GXAA 5GPCA 2Z1DA 1UG0A 1R5HA 3G3ZA 5EG0A 2NS8A 2GLOA 1KU3A 1TWHJ 1T0FC 4Y15A 3RPQA 2JRMA 5HLTA 4KFCA 2BYVE 2H1KA 1FLIA 3LSTA 3BWGA 2GWRA 3QYBA 3COAC 2PEXA 1ACIA 5LGNA 3CCMI 4U7BA 4DGWB 3KYDB 4EM0B 1QBJA 4ASNA 3BDDA 3KIOA 4RLQA 3RTRA 3WGHA 4I09A 4LK0F 1S3JA 1SANA 1OCPA 2CFOA 2KRFA 5E3NA 4N4NB 3DLLF 4L5EA 2TDXA 2R0QC 4RAZA 4LG0B 4E7LA 1YYVA 3CCLI 4QWQA 2Y69H 3H3ZA 1TWGJ 2EPFA 2FBKA 3Q9VA 2VJJA 1SMTA 3HXLA 5LRSA 4RB1A 2ZB9A 4BHBA 2FD5A 1Q1VA 4ZDOA 4I6ZA 3ERMA 2CWEA 2CV2A 2ETHA 4YIFA 4CYDA 1B1BA 2HTSA 3S17J 4B4CA 2EZIA 1TQIA 4DW6A 2LMDA 1RR7A 5EEHA 2OUMA 4A93J 2P5VA 4EJUA 5TJJA 1RESA 1HOMA 4E7SA 3HOYJ 5ICFA 3O8GA 3M1CA 4IQ4A 1JI8A 2B0LA 2VXDA 4LMYA 4MFDA 4J01A 4HW0A 2VN2A 1GLNA 2PBIA 2F5EA 2CQXA 3HGYA 4UV9A 2LF8A 1LDKB 2G7HA 1YG2A 5FKMA 2DFHA 3HTSB 1GUUA 5CVVA 1X1AA 3DPUA 3GFMA 1FNNA 4Y7NJ 1PP8F 3LSPA 3BG6A 2CUEA 1L3LA 2MH2A 5TRDA 1TZLA 1MJ9A 3CJNA 3GFJA 3K6GA 3T5XA 3VSLA 5IT3A 5IYCJ 1EA3A 3CUQC 5EZGA 3L2CA 2NAZA 3KZZA 3PL8A 2VXZA 5EGOB 2QBYA 3C2BA 1XN7A 2W82A 1FIPA 2VQHA 1TWCJ 4AVPA 2XSDC 2VJ5A 4XONA 1IGNA 3BTCA 1H88C 4A2UA 4WXHA 1IW7F 2LNBA 4IXAA 2ESNA 2DODA 3KEOA 4GRIA 3OYIA 4ZYEA 5M5YJ 1HW1A 5FO5A 2XF5A 1I6XA 1WVRA 3ISPA 3ZMDA 2R93J 2ZXHA 3HRTA 1YW9A 2P81A 3BJ6A 4RGRA 2Q8KA 4JX6A 5D4RA 1ZHFA 3E6DA 4H4KC 2DT7B 3FMSA 4M6VA 2XAUA 3ZMSA 2BVLA 4HLXA 2E34A 1D5VA 1ETVA 3A1YA 2NVTJ 2LR8A 4LFUA 1FTZA 3TL4X 2JN6A 1UELB 4W97A 3GTMJ 3VWBA 1N78A 4I99C 1WJFA 3I71A 3GX4X 3HOWJ 3PUBA 4QSHA 3WTTC 1PUFB 1QRYA 4GYIA 3V8KA 2IAIA 1VQ5I 3T0YA 2LFBA 3OYKA 4CHUA 1LEBA 2DCEA 3BZ6A 3HHGA 4ZZLA 2K40A 1G3SA 1LDJA 2HOTA 4E6KG 1M1EB 1W5TA 4FASD 1U5TB 3HOTA 3LNQA 3ABMH 3FM5A 4CYCB 1SAUA 1AU7A 2H1LA 3IRQA 2GXBA 1MGTA 3QYEA 2M8GX 2OCEA 1X19A 2K5CA 1YOVB 1Y0NA 3K1NA 2CQNA 2OA4A 2L9RA 2Y9YA 2L7KA 1DU0A 1VQNI 2X6WA 3W6JB 3LFUA 2GQQA 1V5FA 4N9IA 4BJ6C 3GZNB 3I54A 1SFUA 2EJRA 1WWXA 2IJLA 4KIBA 4UNOA 2H94A 4XRMA 4BU2A 3PFYA 1X4OA 2ZFUA 3ZP5A 4II3A 3W6VA 5CKTA 1UB9A 1W36C 3MQ0A 1FZPB 2HYJA 1LFPA 3C2HA 2DQLA 4ZZDA 2Y48A 3H5RA 1XMXA 4MFEA 1CQTA 3PO3J 3AG4H 3C18A 1MBEA 1JKRC 5IYDJ 1P4WA 4CDGA 3LL7A 5IT9K 3TKYA 3ZOBA 3PJRA 3E0JB 3E5UA 2DMPA 4KISA 4AM3A 3PQJA 3F6OA 4IRHA 2W84A 3CCEI 4XL9A 1Y0UA 2F5CA 4C3HJ 3IV5A 2QSFX 2XDVA 5CQEA 1OCZH 1SAXA 4KIGA 3HSEA 2DA4A 1MSFC 2A6HF 1RIOH 1JKOC 3TQNA 5JFRA 3HRSA 3D0SA 3WTZA 3E6MA 3M7GA 3TO9A 5L3DA 5DM7F 2VBWA 3JRAA 2R5ZA 4E7JA 1WPKA 5JLXA 4G6TB 3ZQLA 2XAHA 2LH9A 3FMQA 4HOBA 5KHDA 3D5LA 1OYIA 5F27A 6PAXA 1R5GA 1ZGAA 3CCVI 3JTHA 1LUJB 4PJ0C 1X2MA 1IXSB 4XKWA 3KX2A 2E1NA 4BS9A 3WE3A 3N97A 2LREA 3X2QH 3JAMK 2XSJC 2RAEA 2VI6A 3IAS2 5D6EA 3QODA 1KQ8A 2CYYA 2FBIA 2ZCWA 1O4XA 1YTYA 3OR2C 4HDUA 1FP2A 4FE7A 3MZ8A 3JRIA 1IC8A 4A0YA 5CVRA 2WAFA 2XAFA 3HG9A 1R1TA 3GTJJ 4AC0A 1HW2A 5A2QZ 2PLYA 1GDTA 4P1WA 4XIDA 2ELJA 2VBXA 1JGGA 4CZCA 2DA3A 2MW8A 5J8FA 3QYFA 1ZRCA 3CUOA 2XGXA 1HCRA 5J6XA 2GA2A 5EEGA 4RB0A 1ZQ3P 4OINF 1Y39A 1A31A 4AWXB 1LVAA 3LA3A 2A5YB 1FJLA 2IGOA 2E19A 2XB5A 3DPTA 2L5QA 4RLFA 4KDPA 5E18F 5BPIA 2JMWA 2O8XA 5DYMA 4RDUA 3PFIA 2DJIA 3L7WA 2GIVA 2RC4A 1D1AA 5D8LB 3ZMZA 4FCYA 2EH3A 4XKVA 1YJNI 5TGTA 2NYXA 4E70A 4PJJA 4NNJA 5F08A 3SZPA 3ULQB 1SFEA 4ZTFA 1HC8A 3D5RC 1POGA 3G2BA 5ICEA 1KONA 1QVUA 3HL2A 4G7HF 1VQ7I 3K0LA 1MNMC 3QAHA 1DUXC 4HYEA 2OU2A 2V1DA 2Y30A 1USTA 3WODF 3J81K 4RM3A 1Y1WJ 3CDIA 1BI1A 4M9XA 5D4SA 3FXOA 1JHFA 2Z9OA 3GLLA 2JA7J 5F0CA 3LMMA 2R5YA 2DA7A 4D1QA 1Y8QB 4M3BA 4Y13A 1JHHA 3EPZA 4LLGF 3ZMVA 2JUGA 3K4LA 1Y6IA 2FSWA 2M4KA 1ZR2A 1G6NA 2AXTC 1R22A 1KA8A 1LDDA 1JKPC 4IHVA 1R36A 1WI9A 2KL4A 5ILVA 3ZGKA 5DEQA 3G6EI 3BG3A 1H0MA 4N4OB 3I5UA 3HOSA 2ECBA 1OCTC 4HF1A 3FKJA 1ZGJA 2R7UA 1S9HA 2DFEA 2Z2SB 3GYHX 5GP9A 2RGVA 2DYRH 1QO0D 2X1CA 5B1BH 5HDGA 3LSGA 2HVRA 1SFKA 3KLNA 2BZTA 3JSPA 2LOOA 2JRTA 1G8XA 1YLFA 4KICA 1YHQI 1B72B 3T8RA 2CQQA 3D5SC 5BNGA 2ZMEA 4AIHA 2V7FA 5D5UB 2WAEA 3HOXJ 1U5TC 4LLLA 5IOYA 1FOXA 4D5FA 2EFNA 1K6OA 4AYBN 2XUBA 4UV8A 1ONVA 2E1MB 2BY3A 1X1DA 2CUJA 1W36D 3OV8A 4II2A 2QVOA 3W2WA 3IL2A 1GXPA 2PFBA 3G1OA 3KCCA 3NRVA 4B09A 3JRFA 4BE0A 3K70D 4S04A 1J0RA 3FXMA 3H0DA 1H8AC 2K3FA 4DYRA 4HF2A 2JPBA 2EK5A 1I6HJ 1HKTA 1DP7P 4CICA 2P5KA 4HQEA 1QNTA 2OZUA 4M9ZA 3OR1C 3LAJA 4HPQA 3R0JA 4ZH4F 4HNUA 2XC7A 3F22A 5JVGF 1U2WA 4OMZA 5LEJA 5EG0B 1JXSA 4FTHA 2PI0A 1YS7A 5JR3A 2Y75A 3KP2A 3I4NJ 2IVMA 4L0YB 1VNDA 2M30A 2O03A 3IWZA 1KGSA 2L7ZA 1G3YA 3LWFA 2TCTA 2CGPA 2VUMJ 2DW4A 2QGUA 4NHJA 4L5JA 4XSXF 2VQGA 3OMYA 4JBAA 2JA2A 2KIMA 1DGRM 3FWEA 1IXCA 5K5QA 1TT5B 1R4MB 1MSEC 3S1RJ 3FIWA 1I1SA 1OISA 3HZJA 3S3MA 1FT9A 3JCUC 4LG0A 5L3FA 4M74A 4HDVA 1EH8A 4BNCA 4ZYAA 3F21A 3RPUA 4EVIA 4YFKF 1XGNA 3OYLA 4BH9A 3BTJA 4M3DA 4R8HA 1OQYA 4KMFA 3MEXA 5B3SH 3OYFA 1KU2A 4BYYA 4G94A 2COBA 2HPIA 3QOEA 4U0YA 3JREA 2WA0A 2G7UA 3TDUC 3AFHA 1D3YA 3TP3A 5E3LA 3W2AA 1JUPA 5EF6A 3ZMTA 3HSRA 4F91B 2EINH 3CCQI 1K78A 3Q0UA 1O57A 4IPAA 1LE8A 2GBYA 4BE2A 5L3BA 1YIJI 2JA6J 4EJTA 3A02A 1SD4A 3HIFA 3DP7A 4E7IA 3DV8A 2DBBA 4R79A 3MKZA 3WHBA 1FP1D 3K69A 3IRRA 3FF5A 1D8KA 1TBXA 2JA8J 3R60A 3E97A 2E2JJ 3EUAA 1R00A 4HX4A 2PN6A 3NAUA 2LK2A 3HGGA 2WAQN 1T98A 3MKWB 1D1BA 1MBJA 4PFOA 2QSGX 3CJRB 1R58A 3V4GA 3J7AY 3AG3H 3BROA 1P2FA 3LAPA 5BMZA 2XPVA 3KLOA 3MVPA 4KT5C 2LG4A 3B6AA 3N4MA 3VPRA 1BOAA 2M7AA 3HTUA 2WWYA 1O3QA 3LSMA 3MZHA 3HKZN 2ESHA 2W00A 3L2RA 1T33A 1SVLA 1B4AA 2ISZA 2XVCA 2LLKA 2Q2EA 1MBGA 2BY2A 4FT8A 3K4MA 1ZELA 2M34A 2PMZN 4HA8A 2ELKA 3HUGB 3W3CA 4AVZA 4Y33A 3VEPA 3FK7A 3KP3A 2DDAA 3WU2C 3S2DJ 3OYNA 5FKNA 3BY6A 2XKPA 2O9LA 2NVYJ 3PM1A 3U21A 1WJDA 4CXFA 2QA4I 4AIKA 3GCMA 2PJPA 3LQQA 2J5OA 4CYCA 2L54A 5E8IA 3JRBA 1V4RA 2FOWA 1MDMA 2MABA 2KISA 1XTAA 1TQMA 1Z6RA 2UXXA 3VYRB 2KT0A 4MNUA 4AIJA 1QA6A 3ZQ7A 1JJ8C 4JX5A 2A68F 1FEXA 3L2WA 2O7OA 1DQUA 2GIZA 4MEXF 4RB3C 5J40A 4RBOA 3GFIA 5L3CA 3DTIA 4RS8A 3IHUA 2PJRB 4I2OA 3J7AO 1E2XA 4YELA 5GAGJ 2DA5A 5HS7A 3R6SA 3K70C 3WGGA 3H1CA 2D45A 2HFHA 5LFAA 1A6QA 1LJ9A 3PSFA 1OLTA 2BV6A 3ONQA 3DBHB 2L9VA 2LC2A 4RGXA 5HLGA 5F0HA 3BP8A 3F72A 1FPQA 1GVJA 2AHQA 1RETA 2V9KA 1H9TA 1Z1DA 2WB1N 4GFBA 5K7FA 2EFWA 1G59A 5AIPA 1ETKA 3LFKA 4PJMA 2DTRA 2V4JC 3WE2A 2KZVA 4NBQA 4RMNA 2H8RA 3V7SA 4A3GJ 4Y3OA 5AONA 1QPMA 1FY7A 1U0JA 5K7HA 4EEFG 3BR3A 2VKVA 2L4AA 2KRHA 2E1MC 4A3FJ 2DDBA 4O3MA 1XSDA 3SYTA 4F93B 3E6CC 5K5RA 3SFZA 1OCOH 4TV7A 1T39A 3Q0VA 2Y0SA 2FBHA 1VQKI 2X51A 2DO7A 2MGQA 3F6VA 4UHTA 1LPQA 2LSOA 2COMA 2O0YA 2QQBA 4U0VA 1EJ9A 2IS6A 1UZCA 3BPXA 2P6SA 2FQ4A 4WX9A 2CG4A 2QQ9A 4E7HA 2WADA 4E7ZA 4JOMA 1MJBA 3CCYA 5KAFC 5FJ8J 2GOMA 1WKMA 4HZFA 3W6KB 1S5LC 4BJTA 3TDZC 4BUPA 1IG7A 1MNDA 1T0FA 3IH3A 1Q1HA 3CC2I 1ZRDA 1ZLKA 1BBYA 3H35A 4IHWA 3FXLA 3HYIA 5TISC 3DQVC 3LSIA 2PG4A 2DI3A 1F9NA 3K9TA 2LBFA 1MH4A 2CUZA 2CV1A 3AL0B 2E7XA 2HU9A 3SQNA 2IA2A 4ZYHA 1ITYA 4QIWN 3BOQA 1IDYA 2L3DA 2QKMB 3HBLA 5LBQA 4IX7A 3SZTA 2EIJH 2IBDA 5DD8A 3VYUB 5IT9Z 2R7DA 5K7ZA 3E5QA 4UVAA 3HOUJ 5GAEJ 2A6TA 5B5EC 4HRIA 4OAYA 4EQQA 1T38A 1XS9A 4J00A 1QZYA 5JI6A 1GHCA 2GAUA 3M9AA 3AAFA 4I0BA 5ILSA 2ID3A 2A61A 3DFGA 3G1LA 4G9YA 3SXYA 3ZXSA 1AHDP 3P7NA 3AL0C 1T6SA 4XBFA 1EF4A 4OWRB 4BDZA 4JP0A 5HDNA 2GA1A 2RV8A 2W1OA 3OYHA 1MBHA 4LOCA 1IN6A 1GT0C 1E0EA 4MTEA 2EV0A 4IJAA 2R3SA 5IY5H 3H5AA 1EH6A 3DF8A 1NTCA 2GOXB 3DBLB 3CP8A 3Q5FA 4FISA 2QYOA 5D6FA 4EJWA 2XRLA 1HKSA 3DTKA 3P9IA 4AYBA 4B3AA 3TEDA 2VKHA 1YRNB 3CCUI 5B66C 4M6YA 4IHYA 1REPC 2EILH 5DUKA 4E7KA 1FOKA 3GTOJ 2RQPA 3S1NJ 1Y56A 2JVHA 1U5TA 2J5PA 3CJTB 1LEAA 1V3FA 4KJZA 2IP2A 1KZHA 1JJ6C 3SEZA 2VB6A 4LLNA 1R6RA 2F4OB 2HQNA 3I58A 2ZJRF 3MFKA 1NK2P 3OS0A 2CH0A 4I98B 3SFIA 2R7QA 3RZOJ 4GXOA 2JPCA 4YRVA 1RUOA 2IGMA 1MZBA 5M5XJ 3VB2A 3BPVA 1EV7A 2F4IA 4Q47A 1J2XA 3FXJA 1IUYA 2BBYA 2Q1ZB 5LHHA 2MLGA 1T56A 2EV5A 3MAJA 4KMUX 3S1MJ 2E5NA 1XCVA 2PMHA 4C2UA 3MMYB 1DGWY 3T1BA 2P5LC 1JTYA 1I1GA 3L2QA 4BQNA 2QSHX 4A3CJ 3QU6A 4NQWB 3A0BC 4NQWA 3FHZA 4XORA 4OOIA 1L0OC 1CGPA 1X3ZB 2OQGA 3KP6A 2F48A 3ZQQA 2VOPA 1ZLJA 1UFMA 3CP2A 1RI7A 4K2EA 1LB2A 2QWWA 3QRFF 1BM9A 4XLFA 1WJAA 1HQCA 4L9VA 2P8TA 1ZRFA 1DP3A 5FLVA 2LF7A 3GZ6A 2FX0A 3GTQJ 1J59A 1DPRA 1YW8A 5E20A 3FXQA 3CLQA 1RC9A 2VLAA 1H9GA 1HW5A 4XRSG 1YFHA 4MEYF 2L0KA 1ON2A 3DBRB 3ZQCA 4XLEA 2JSCA 2LDUA 2E71A 4PSXA 2L4MA 2NNYA 1YX5A 3N05A 1W0TA 3GW2A 3CDLA 1KYZA 3BLYA 1K4SA 1ZYRF 1WJBA 2JJ7A 2HI3A 1GV2A 2FMYA 2FJ1A 3K10A 3WU1B 4LD5A 1S29A 2W25A 4FQGA 4XLHA 3J7ZI 1TT0A 1LNWA 3QU3A 2UWMA 1KQ0A 2H8WA 3CLOA 5FGMA 3T8TA 2AQEA 3REOA 2EZLA 1MBKA 3S15J 3I59A 2FQ3A 3LSHA 4ZDLA 2X6OA 2VPLA 4D5CA 5CYVA 1B9NA 2Z33A 1IAWA 2VQCA 3JW4A 4A3IJ 3FM3A 3I0TA 1OR7C 2IGKA 2QENA 4G12A 3S93A 4AIDA 1VQOI 2BY0A 4IOCF 3OWTA 2EFPA 4ZYGA 3LSRA 3DEUA 3M8JA 2XIGA 2BGCA 4M3GA 3RJPA 4XLCA 1R5ID 2WV1A 4B44A 2VBYA 1ETOA 3BT9A 2BVMA 2CU7A 3K2ZA 2KP6A 5J47A 3FXKA 2K85A 3CF2A 3OL3A 3EQLF 2VKEA 4L9TA 3TBIA 4B3XA 3CC7I 2NS0A 3BC8A 5KCMA 4IQJA 1R4NB 4BXXJ 3HDDA 3M07A 1OKRA 4Q5SF 1ZKGA 2QUFA 3SZGA 4G8XA 1IV6A 4M72A 2DK5A 5AIQA 2JT1A 3GXOA 3J81Z 4KA4A 1MMSA 2STWA 2UUZA 3F3XA 3IKVA 2Z3YA 3ML6A 4QPQA 2MFZA 2CQ7A 3DKWA 2OQRA 1R1VA 2XAJA 4HBLA 3DCFA 5CLSA 5C4XJ 1AOYA 4FX0A 2ZJ2A 1RPWA 3P9KA 2VPRA 2MSYA 1YW7A 4BEHB 2V1NA 1BIAA 4XLNF 1BR2A 5LD2C 4X1EA 2KIQA 2IXSA 4BQOA 3OSFA 3RPUD 3KZYA 1UHSA 3LQRA 4BQQA 5FLXK 1XGMA 1D0ZA 2EIKH 2P0WA 3WTSC 3GTGJ 4ESFA 2CW7A 4RGSA 4BAYA 5DCMB 2LP0A 2X85A 5FRMA 2EIMH 1TWFJ 3K1MA 1W4MA 4UVBA 5B1AH 1ZREA 4OIPF 4I76A 1FBUA 3TW7A 1U9NA 2D2WA 1APLC 4BGDA 5FB2A 5JLWA 4WCGA 1BW5A 3D1NI 1K4TA 4N0BA 1JUMA 4PCQA 2RN7A 3I9V2 1LFUP 1PJRA 1QHGA 2R92J 1U9OA 3DTEA 4KITB 4MTDA 3AKZA 2A5WA 3ABTA 2IS4A 3QQAA 4U7DA 3CMEI 4GO1A 5IP9J 1BI2A 4HX8A 4HLYA 2V79A 1J75A 2RREA 1OCRH 1X58A 5L3GA 1JT6A 5IOZA 3S8PA 1WQ2A 3OYAA 1XPXA 2V9VA 2FA5A 2EFOA 5IYBJ 2DN0A 1HSJA 1GXQA 1ZG5A 5E8GA 1ZN2A 2HXOA 4C2TA 1WH5A 2K86A 2X6YA 5J4YA 2K27A 4ANJA 2KPMA 2WY8Q 4D7MA 4I01A 2PJRA 1FC3A 4XNFA 3CTAA 4IEJA 2DMNA 3CCJI 3GTKJ 1SD7A 4RAFA 4R1HA 2DLLA 4BBRJ 2E5ZA 4A5MA 5DV5A 3F8FA 4ENJA 5F1JA 4L9NA 3EYYA 2DK8A 1J5YA 1Z7UA 1RR8C 1X4PA 2MBFA 1SFXA 2V6EA 3WTUC 2LY2A 2DMUA 4HAMA 3NARA 4JX4A 2XROA 2KDOA 2MH9A 2B63J 5FLMJ 3H36A 2E35A 4HNVA 4XKCA 3Q9SA 3B02A 3ZCOA 3WU0A 4IVNA 2ZKZA 5FKOA 5JHFA 4OIQF 2VOOA 2O5RA 2CW0F 4X0GA 2YX7A 2DPDA 2MC4A 3GLXA 4U87A 1QZZA 1ZG3A 3M8FA 2LBFB 3ASNH 1N77A 4CH7A 3IP4B 3RKXA 4NDLA 3KEQA 4UVCA 5IP7J 2PQ8A 2NVUB 5E17F 2E2HJ 1P4XA 4GCVA 3ZPLA 5LGTA 1YX3A 1QZEA 4YIIA 3MWMA 1LE8B 3E7LA 5J1YA 3WTWC 3DU6A 3ESWB 3MKLA 3MD2A 5EDNA 2HDCA 1ULYA 3J80K 1YS6A 2CW8A 4Y4RA 1ORKA 2EA2A 4A3JJ 2K9SA 4XOTA 4I0AA 3C2GA 2RQQA 3CMMA 2BXYA 1Z77A 3BJAA 2LRDA 2I5UA 1IZ1A 4BE1A 4BACA 4UB6C 1B9MA 1FYKA 5H6QA 5HLHA 1GV5A 2D1HA 1D0YA 2OJED 4JK1X 2FEZA 1XB4A 4LG3A 4G7ZF 3DU5A 4MLOA 4C9YA 4HNTA 1ETQA 3EUHC 3LA2A 4EATA 4UB8C 3HRMA 3OIPA 2HXIA 3M8EA 4V2GA 2R7RA 4Z6YA 4S05A 2FMLA 3LSJA 1I5ZA 1LKXA 2M7BA 1K7AA 1HBXG 2JA5J 1BW6A 2XF6A 4F92B 2DOAA 2G9WA 3LA7A 4EM2A 2IA1A 1PUEE 4A3DJ 3TOBA 3DEWA 1BJZA 4IF4A 3JRDA 4QTRA 4WWCA 5HNFA 2A6EF 2FOKA 3WG9A 4HV6A 2R7FA 3O6BB 1HLVA 3TMOA 1IRFA 2RDPA 1U8RA 2NVQJ 4Y52J 5BS6A 1AA7A 1J09A 5ICCA 1FMWA 4CCMA 2E60A 3TO7A 4MGRA 3KYLA 1PUFA 1YRNA 3P9CA 2X6XA 4D0PA 4UUSA 4UUSB 3O3KA
chains in the Genus database with same CATH topology
3CF5F 1VQKI 2ZJRF 1VQMI 1FOYA 3J7ZI 3CCEI 1YI2I 1YHQI 1YJNI 5GAHJ 2K3FA 3CMAI 3CCVI 2E34A 2H8WA 3CCSI 3G71I 2E36A 3CCUI 3I56I 4IO9F 5DM6F 3PIPF 1S72I 1ACIA 3CCMI 1FOXA 1HC8A 3J7YJ 5GAGJ 1VQ7I 1VQ4I 3CCQI 3G6EI 3PIOF 5JVGF 1VQ8I 1FOWA 2QEXI 3CC4I 1Y39A 4UY8I 1VQLI 3CD6I 2QA4I 3CC7I 2JQ7A 4V19K 3CCRI 1YIJI 1YJ9I 1YITI 3G4SI 4IOAF 3CJTB 2E35A 2OTLI 3DLLF 1YJWI 5DM7F 2ZJQF 1VQPI 1VQNI 1VQ6I 2FOWA 5GAEJ 3CMEI 2ZJPF 3CC2I 2OTJI 1VQ5I 5GADJ 2NXNB 1QA6A 1VQOI 3CCJI 1MMSA 4IOCF 3CCLI 1VQ9I 3I55I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CF5 F;  1VQK I;  2ZJR F;  1VQM I;  1FOY A;  3J7Z I;  3CCE I;  1YI2 I;  1YHQ I;  1YJN I;  5GAH J;  2K3F A;  3CMA I;  3CCV I;  2E34 A;  2H8W A;  3CCS I;  3G71 I;  2E36 A;  3CCU I;  3I56 I;  4IO9 F;  5DM6 F;  3PIP F;  1S72 I;  1ACI A;  3CCM I;  1FOX A;  1HC8 A;  3J7Y J;  5GAG J;  1VQ7 I;  1VQ4 I;  3CCQ I;  3G6E I;  3PIO F;  5JVG F;  1VQ8 I;  1FOW A;  2QEX I;  3CC4 I;  1Y39 A;  4UY8 I;  1VQL I;  3CD6 I;  2QA4 I;  3CC7 I;  2JQ7 A;  4V19 K;  3CCR I;  1YIJ I;  1YJ9 I;  1YIT I;  3G4S I;  4IOA F;  3CJT B;  2E35 A;  2OTL I;  3DLL F;  1YJW I;  5DM7 F;  2ZJQ F;  1VQP I;  1VQN I;  1VQ6 I;  2FOW A;  5GAE J;  3CME I;  2ZJP F;  3CC2 I;  2OTJ I;  1VQ5 I;  5GAD J;  2NXN B;  1QA6 A;  1VQO I;  3CCJ I;  1MMS A;  4IOC F;  3CCL I;  1VQ9 I;  3I55 I; 
#chains in the Genus database with same CATH topology
 2MA3 A;  3IH2 A;  2QKL B;  1YE9 A;  2FF4 A;  4YFN F;  4P5O A;  4A3K J;  2HGC A;  3UR3 C;  1U8B A;  2VAS A;  1TQP A;  4LK1 F;  1MDM B;  1IRX A;  3HC7 A;  3BR6 A;  4V2F A;  5HOO A;  3DLA A;  2CV0 A;  4GDF A;  2KLO A;  2GM4 A;  1CF7 A;  4BDY A;  3OSG A;  1U6G A;  2KJC A;  2KMU A;  4M73 A;  1W7P D;  4B8X A;  1QHH D;  1B8I B;  3HB9 A;  1W5C C;  1B72 A;  1Z91 A;  2P7C B;  2V1U A;  4XSZ F;  4ITV A;  2E36 A;  4IZZ A;  1F4K A;  1MW7 A;  3Q0W A;  3JRG A;  2HVS A;  3OYG A;  1YO5 C;  1O3R A;  4BKX A;  2PMZ A;  3WGI A;  4OU0 A;  2DQR A;  2NRA C;  1XMK A;  3H9J A;  4Q48 A;  3RSN A;  1VF9 A;  1ZK8 A;  4A6D A;  2IEK A;  2W57 A;  2EZH A;  3ZMU A;  1BIB A;  3V7R A;  2LKS A;  2V9P A;  5GAD J;  3KET A;  1SFO J;  3TP0 A;  5CVJ A;  3GME A;  1VQM I;  2IGN A;  5IPA A;  5J1R A;  3RZD J;  2QM3 A;  1O3S A;  4G6Q A;  4KUM A;  1JE8 A;  3GEZ A;  4N9H A;  3J7Y J;  1WCM J;  1ETX A;  1SD5 A;  2K4B A;  3BG7 A;  4LIV A;  5HS8 A;  3V8L A;  3BQY A;  2XAS A;  3EDP A;  3QPL A;  3F8M A;  5HS9 A;  5EYR A;  3V42 A;  2RVC A;  4PJN A;  4CCL A;  2L9S A;  4A3M J;  4IHT A;  4YFX F;  1XDU A;  1BOB A;  1OYY A;  3E3V A;  4ZC3 A;  2EZK A;  2AS5 F;  2XV4 S;  3TO6 A;  4A12 A;  5F64 A;  2AO9 A;  2XKO A;  3FZV A;  4Q4Z F;  2DMT A;  5GAH J;  5DD4 A;  2M8E A;  5E3M A;  3FMR A;  1USS A;  5A2Q K;  3B73 A;  4BXF A;  5CQG A;  1ZAR A;  3FBI B;  1AWC A;  2UV1 A;  1K61 A;  3BR0 A;  5C4J J;  4CCO A;  5LLQ A;  2QF7 A;  2ELH A;  4AU7 A;  3JR9 A;  1AKH A;  2R7V A;  3CCR I;  5FFX A;  4I02 A;  4XOP A;  1YIT I;  2DU9 A;  2B7E A;  1P7I A;  3BJO A;  1DU6 A;  1W0U A;  3OYD A;  4NUB A;  2MLK A;  2Q0O A;  1UCR A;  1X3U A;  3QOP A;  5LHI A;  1T8I A;  2UXN A;  4RAG A;  1VQ9 I;  5E3O A;  3HEF A;  5E1X A;  2HZD A;  1I3A A;  2K02 A;  4H0E A;  4IL6 C;  3CUQ B;  3CUQ A;  3B6C A;  1MD0 A;  1W1W E;  2YX4 A;  4OMY A;  1IRG A;  2RKH A;  4CGZ A;  2ECC A;  3JAM Z;  3A01 B;  2NVX J;  4KN4 X;  3BR2 A;  3VDX A;  3O8H A;  5GTH C;  4U88 A;  2EV6 A;  3BR5 A;  5D5W B;  3OYC A;  4J19 A;  2QZ8 A;  2K9N A;  2R7O A;  3H3V K;  4KYW A;  3V7C A;  1ZGW A;  2CUF A;  3K4N A;  2IRF G;  3F8C A;  2NXN B;  4KN7 X;  4ESB A;  2HWV A;  5KK1 A;  1D1C A;  5C44 J;  1RZ4 A;  1MBF A;  1S7O A;  2DMQ A;  3SDG A;  2HDD A;  4B47 A;  1FWZ A;  5DCF A;  3QPT A;  1D0X A;  4G6D A;  2P6T A;  1Y8R B;  3CJQ B;  5HDK A;  2LYC A;  1R1U A;  2HKO A;  2ZO4 A;  1I50 J;  2HVQ A;  1MMA A;  4NC7 A;  4ON0 A;  1IDZ A;  3A03 A;  2Y0S N;  4M3E A;  4ESJ A;  1ETY A;  4LB5 A;  1TNS A;  2LY1 A;  4PZJ A;  3KZI C;  1EH7 A;  4CZZ A;  2YS9 A;  1YIO A;  1XGO A;  3OOP A;  1Z7L A;  4LIU A;  1H89 C;  2ICW G;  3BZC A;  2N8G A;  3UNG C;  4XN3 A;  2KKO A;  4DYC A;  5E1W A;  2CJJ A;  3ABK H;  4XMY A;  2VJ4 A;  1IO2 A;  2HYG D;  5F0F A;  4PUS A;  1V54 H;  1I27 A;  1W7P B;  3ROU A;  4UXN A;  2QQ8 A;  4CA0 A;  2O61 A;  1DPU A;  1X1C A;  4D9J A;  1PP7 U;  4CCJ A;  5M5W J;  3TGN A;  2FE3 A;  1IN7 A;  1ZG1 A;  2R7T A;  5J8C A;  2HEO A;  2BEO A;  2K9M A;  2Y2Z A;  5L3E A;  4A5N A;  1VTN C;  4OIO F;  2NS7 A;  9ANT A;  5HVQ C;  2DFI A;  3PIP F;  4ZYD A;  2VC1 A;  2IA0 A;  4LB6 B;  2X1E A;  4PDK A;  2ZNY A;  2L7F P;  4IRG A;  4XN0 A;  2XRN A;  3AG2 H;  4XIC A;  1OPC A;  4IKF A;  2XPU A;  2W4S A;  3CDH A;  3G4S I;  5FLX Z;  4E4H A;  1F36 A;  1MNE A;  2WV0 A;  4FHT A;  4EJV A;  1WHU A;  1QPI A;  2EB7 A;  4HV5 A;  3C3W A;  3G1M A;  1SVO A;  4EMS A;  2M3A A;  2ID6 A;  4DBQ A;  2ME0 A;  3OYM A;  3QP5 A;  3H92 A;  1UAA A;  3CCS I;  3BTI A;  4IO9 F;  4CUG A;  5D5X B;  2DXI A;  2H6C A;  4BXU A;  4EV0 A;  1TW2 A;  2M87 A;  2OZ6 A;  4ZJZ A;  3RKW A;  4PSW A;  2WB1 A;  3KP4 A;  3L9F A;  5CVI A;  3WTV C;  3EUK L;  1SVM A;  3TOA A;  2KZG A;  3FIS A;  1IN8 A;  1Z3Y A;  5FD5 A;  3U9G A;  2OV7 A;  2E1O A;  3U1K A;  4KNY A;  2EQR A;  3VFZ A;  4CCN A;  1MMD A;  1E3H A;  3NWT A;  4BY7 J;  3PSI A;  4BHP A;  1IJW C;  1J7K A;  1HXD A;  3M3Y J;  2H09 A;  2CS3 A;  5DM6 F;  4LJZ F;  2MD5 A;  1VZ0 A;  1Z6T A;  2V6C A;  3H5N A;  2Z16 A;  1JGS A;  2CQK A;  1VQ8 I;  2BW3 B;  2W7N A;  2OCC H;  1QGP A;  3G73 A;  2F2E A;  1BC7 C;  5D8K B;  3S1Q J;  1TP4 A;  1RUN A;  4Z2Y A;  3IUO A;  1YQA A;  3PUF A;  2WTE A;  1F1Z A;  2KIU A;  5FRN A;  2DYS H;  3NEU A;  1WSU A;  4BL0 B;  4F52 A;  3I59 B;  1BJA A;  5F04 A;  1WJC A;  3DEE A;  2X0L A;  1BA5 A;  2K9L A;  3I64 A;  3A4C A;  4XRS A;  3FX3 A;  5FRO A;  1KU7 A;  3GTL J;  3HSF A;  3LOC A;  3VSK A;  1NH3 A;  1MKM A;  4A0Z A;  4HSR A;  4C3I J;  1VFC A;  3BZK A;  3HOZ J;  1ZTR A;  3JRH A;  2ZXJ A;  4B43 A;  2O3F A;  1K78 B;  2R7X A;  4XRF A;  1P92 A;  2BHY A;  2Y0M A;  1G3T A;  2I8D A;  2ZSH B;  3F23 A;  4PK4 A;  1BL0 A;  3L2V A;  1PDN C;  1P6R A;  2BHZ A;  2NOJ B;  2DA2 A;  2JWT A;  4EJO A;  1IN5 A;  2L02 A;  3IAM 2;  4KIF A;  5J3L A;  4PGG A;  2E7W A;  3NQO A;  3HPH A;  1ENH A;  4QPO A;  3ASO H;  2LTP A;  2QCO A;  1T08 B;  2L2O A;  2EBI A;  1ON1 A;  1IV8 A;  1WGX A;  2M45 A;  3I56 I;  1DDN A;  2P7V B;  3WTX C;  2HOE A;  1BI3 A;  3FXR A;  2CRG A;  4PGH A;  2KFD A;  1NG7 A;  1VQL I;  1JKQ C;  1FSH A;  1C0W A;  4GGG A;  2OC6 A;  3U1D A;  5IP6 A;  1P9Q C;  3JTG A;  4XR6 A;  4HX7 A;  3C7J A;  5DDG A;  3SDB A;  4CCK A;  5EGO A;  3EUH A;  5HOD A;  2VQL A;  3DKY A;  4LGW A;  4YIR X;  5FFZ A;  1HF0 A;  2WY7 Q;  2BXZ A;  2ZXI A;  1FTT A;  2Q2E B;  1FOY A;  1YI2 I;  2IW5 A;  3QWL A;  5BQT A;  2XB0 X;  1W5S A;  3QPS A;  4MHG A;  5M3M J;  3KEY A;  2VL8 A;  3HUG A;  3HM5 A;  3K4K A;  3S16 J;  1PYV A;  1KQ9 A;  1XD7 A;  2RNJ A;  2DPU A;  4X6A J;  3IKT A;  2BOL A;  1SEU A;  4V19 K;  2HQ5 A;  2AXL A;  1WH7 A;  1LFB A;  1W7P A;  5DCM A;  2VKD A;  3IH4 A;  4DBR A;  4XQF A;  3MZY A;  2M2E A;  3JRC A;  1VQ6 I;  5CPR B;  4WF2 A;  3KP7 A;  4OAZ A;  4ZTJ A;  1IXR C;  2W85 A;  1JT0 A;  4JYK A;  1XSX A;  3RKQ A;  1IUF A;  4BHC A;  4BQA A;  1OJL A;  3CMA I;  2ZC2 A;  2VJI A;  2CO5 A;  3G71 I;  3KFW X;  3MCZ A;  4BBS J;  4F55 A;  4ENK A;  5CVU A;  3VYT B;  4RM2 A;  3FXU A;  2Z99 A;  3W2V A;  4GYG A;  2IT0 A;  3RDI A;  4HF0 A;  3RQ4 A;  3RYP A;  4MIM A;  1WJ5 A;  4DNC A;  1XCB A;  1YJ9 I;  1U3E M;  4W1U A;  4A0X A;  1UHM A;  2MC3 A;  3BTL A;  3J80 Z;  5J4V A;  2HKX A;  2XGC A;  3K7A J;  5F6F A;  3H9Q A;  3BQZ A;  1BR4 A;  4WK8 F;  2GXG A;  4OIR F;  2YPR A;  1CF7 B;  1R7J A;  2Y9Z A;  2R4G A;  5ED4 A;  3PNV A;  3PNT A;  1R9T J;  5LHG A;  3F8N A;  3V8J A;  1B8I A;  1O7F A;  1RKT A;  3L2U A;  3HOV J;  3Q3S A;  3ERE D;  1Z05 A;  4XM3 A;  2O6G E;  1MMG A;  3GO5 A;  3FKI J;  2ZNZ A;  3HJE A;  1Z67 A;  3RYR A;  2ZJP F;  1ODD A;  5FKL A;  3PO2 J;  3OOU A;  1IN4 A;  1GVD A;  2UZK A;  2XHK A;  1TNT A;  3S3N A;  1RKW A;  1QQI A;  2W24 A;  2ZFW A;  3O2P E;  3ABL H;  3ZN1 A;  3I3L A;  2DFF A;  4RAY A;  3S14 J;  2DA6 A;  4KT6 A;  2EWN A;  3CES A;  2R7W A;  2O8K A;  4P96 A;  5H20 A;  1A36 A;  3RQI A;  4O5V A;  3RCO A;  3OY9 A;  5LEK A;  3CQZ J;  3NWS A;  3EET A;  2ZXW H;  3R61 A;  2HZT A;  2F4M B;  1HKQ A;  1Z3X A;  3I53 A;  2VE8 A;  3HRU A;  1AKH B;  2JZY A;  5EJC A;  1Z21 A;  1XC5 A;  1X1B A;  4ETS A;  1TW3 A;  2K7L A;  3HPG A;  1F43 A;  4L18 B;  2H6B A;  2VE9 A;  3IWF A;  2JVG A;  3K4J A;  1LVK A;  3C1D A;  2B9S A;  1VQ4 I;  5ICG A;  3S3O A;  3CC4 I;  2DJN A;  4QLC U;  1WZ2 A;  1WRJ A;  2QBY B;  3H3U A;  4S0H B;  4RA2 A;  5GTI C;  1B59 A;  1WFX A;  4XLA A;  4ENN A;  2X4H A;  2EFQ A;  1FSE A;  4M71 A;  1OMI A;  3ZQF A;  1Z0X A;  5K5O A;  2V1X A;  3I55 I;  1O7L A;  4A3L J;  4XK4 A;  1T2K A;  1IF1 A;  2VBZ A;  5DTD A;  2M0M A;  1U78 A;  2IPQ X;  2WC2 A;  3OYE A;  1S72 I;  1O3T A;  4B48 A;  1HDP A;  2FNA A;  2M1B A;  3DPL C;  4UUV A;  3BG5 A;  2X48 A;  1EKE A;  3DKX A;  4F3Q A;  4XLP F;  3E5X A;  4EGZ A;  3OYJ A;  3FHN A;  1ZAO A;  3VYS B;  1NK3 P;  1UHW A;  2F5D A;  5E79 C;  3A2K A;  3FBN B;  2X9D A;  1P4A A;  3K4B A;  2NNN A;  2AQF A;  4FE4 A;  5BOX A;  2KDZ A;  2E2I J;  1XGS A;  5ILU A;  1ZR4 A;  1FYM A;  2R5Y B;  3CZ6 A;  4Y17 A;  4IHX A;  1V5E A;  1TL8 A;  2A05 A;  3BG9 A;  2I10 A;  3PIO F;  2CFX A;  2DT5 A;  2ZME C;  3VOE A;  4F7Z A;  1QVT A;  2F5F A;  1K6Y A;  3FDY A;  1J9I A;  1G3W A;  4A3B J;  1A5J A;  1JTX A;  3WG7 H;  2Z5U A;  4D7N A;  3GBG A;  2VT2 A;  3JSO A;  4DOZ A;  3ECH A;  4MQV A;  1MMN A;  1TLH B;  4FX4 A;  4DIQ A;  3BCB A;  2L9N A;  4IHS A;  4C2M J;  3MN2 A;  1BC8 C;  2DAO A;  5KAI C;  1K79 A;  2VIX A;  2EA4 A;  3H0G J;  5H2F C;  2OAZ A;  3U2R A;  1TC3 C;  2JQ7 A;  2ZME B;  4NC6 A;  4C30 A;  1D5Y A;  3BR1 A;  5H6R A;  2XPW A;  2ZJQ F;  2QLZ A;  4XKB A;  3QPH A;  2ME6 A;  2XF7 A;  1I39 A;  1MH3 A;  2K3P A;  4YEJ A;  3WTY C;  2ADU A;  1B6A A;  1FBQ A;  1OFC X;  2C6Y A;  4M6X A;  2A3S A;  2MD0 A;  3CMY A;  3GVA A;  1E3P A;  5F1R A;  3CF5 F;  1G4D A;  4A69 C;  4L0Z B;  2YU3 A;  2M5W A;  3OL4 A;  2HTJ A;  1UJ8 A;  1QU3 A;  3OYB A;  2ZBK A;  2PX9 A;  4L9J A;  3EYI A;  2FUG 2;  1K83 J;  3KE2 A;  1IRZ A;  4BY1 J;  2HS5 A;  2WAQ A;  1I3Q J;  2DOF A;  1OYW A;  3CD6 I;  3GUD A;  3RKY A;  2A07 F;  2OBP A;  4P9U A;  1NHA A;  1E3O C;  2XAG A;  3ZRG A;  1S6L A;  4M9S A;  1FMV A;  1P7J A;  3R4K A;  1X3W B;  4MQ9 F;  5GPA A;  1ZH5 A;  3OIQ A;  3VOD A;  3R0A A;  2OTJ I;  1JUS A;  4MO7 A;  1HST A;  2KJB A;  1E17 A;  3S32 A;  2LD5 A;  3I4P A;  3S2W A;  4AD9 A;  1XX5 A;  3M1E A;  1R71 A;  1ETW A;  3HKZ A;  2WBM A;  3L1P A;  1ERD A;  2G0E A;  4NC8 A;  3M4O J;  1MIJ A;  1XMA A;  2R5Z B;  1NG6 A;  4ENM A;  3ZQG A;  5JHU A;  2HR3 A;  1FOW A;  3ZQH A;  3OS2 A;  4L5I A;  3GTP J;  2HQR A;  4I7H A;  1BN5 A;  4HG2 A;  2CSO A;  2ACJ A;  2XGD A;  1R23 A;  3BCA A;  2NOG A;  2IS2 A;  5HLI A;  4P55 A;  5M3F J;  3GF2 A;  1A6I A;  1X1P A;  3F0C A;  1MJA A;  3LSK A;  1G2H A;  3KP5 A;  2ZSI B;  4CSW A;  2YU9 J;  3RI4 A;  5J1U A;  2VC0 A;  2GZW A;  4UUT A;  2HYF A;  4RB2 C;  1N25 A;  2E1C A;  2CMP A;  2HQA A;  3ZQI A;  3F9K A;  2JTV A;  4B1R A;  4DZJ A;  2LKX A;  2PMU A;  1R49 A;  4EM1 A;  2VT3 A;  3SJM A;  5KNL A;  3K1P A;  4WXC A;  3ABU A;  3P5J A;  4FET A;  1LQ1 A;  1WJE A;  1FIA A;  2KHM A;  4YG2 F;  5C3E J;  4AUX A;  1RNL A;  2LKP A;  2BE5 F;  3A01 A;  3KPH A;  2K9Q A;  3ZR8 X;  3CO7 C;  3A0H C;  3GWZ A;  5FD6 A;  2VON A;  2DA1 A;  2BW3 A;  2TRT A;  3PQK A;  4WXD A;  5EZH A;  3OS1 A;  4ABZ A;  4RGU A;  5HNH A;  2IS1 A;  1UG2 A;  1Z9C A;  1F5T A;  2JUC A;  2HOS A;  2W48 A;  4DJA A;  4G7O F;  2LVS A;  2KQR A;  2D1V A;  3KYC B;  3CO6 C;  2H27 A;  3K2A A;  1SC7 A;  2JK3 A;  2M4G A;  3L09 A;  3TW6 A;  1PVE A;  5CJ9 A;  4UY8 I;  1TWA J;  1OCC H;  2OF7 A;  2XGE A;  2OD5 A;  4IOA F;  4DZP A;  3GZ5 A;  1WI3 A;  1SD6 A;  2XAQ A;  3H9G A;  4M3F A;  2M0C A;  3GFL A;  1OR7 A;  4HST A;  1Y1V J;  3DWL E;  3IC7 A;  2HDW A;  1FYL A;  1D8J A;  3DXJ F;  1VI0 A;  1HA8 A;  1SMY F;  4IRI A;  5FKK A;  1A04 A;  4HQM A;  3FK6 A;  1V55 H;  2QEX I;  1S7A A;  4BEH A;  2KIF A;  2L7M P;  1BR1 A;  2Y31 A;  1FBS A;  2HNH A;  5KVR A;  5DUI A;  5JVT A;  2MG4 A;  4A3E J;  4U0W A;  3HHH A;  4PFP A;  4ZDP A;  1S8N A;  2F5V A;  1HDD C;  3OIO A;  5DS9 A;  3E1S A;  3WHC A;  2FU4 A;  5LGU A;  1T95 A;  3E6B A;  1S7E A;  5ERI A;  5BPD A;  4HEA 2;  2VOD A;  3I4M J;  2DTZ A;  3MKY B;  3PNY A;  4LIT A;  5LRR A;  1KYW A;  2L01 A;  4P9F A;  5E1Z B;  2YSR A;  1UMQ A;  2DT6 A;  3AG1 H;  2X1D A;  3F8B A;  4DYQ A;  5D5V B;  1FX7 A;  2YR2 A;  2M9H A;  4NB5 A;  4DQ2 A;  2YUS A;  2OTL I;  2MYS A;  4EGY A;  2V26 A;  4O6J A;  2K4J A;  5K1Y A;  2LY9 A;  2BY1 A;  1V5G A;  3S2H J;  2OPT A;  2A69 F;  2ISY A;  2R7S A;  1N75 A;  2HPM A;  2KRC A;  1TTY A;  2HOA A;  1STZ A;  3UKG A;  2F6C A;  1A35 A;  1X2N A;  2R7Z J;  2RNG A;  1RRJ A;  3ZN0 A;  3L00 A;  3SEQ A;  3RIR A;  2FNP A;  4A6E A;  2P4W A;  1XDS A;  2FXA A;  4CO8 A;  3SHF A;  5EEA A;  1KU9 A;  2D5V A;  2DOE A;  4C3J J;  1YJW I;  2STT A;  1VQP I;  3ECO A;  1BI0 A;  4PJL A;  4BJ5 C;  1XG1 A;  3ELK A;  1XSV A;  2JSP A;  3K4C A;  2QQA A;  2FRH A;  4JQF A;  3QP6 A;  2GXA A;  5GPC A;  2Z1D A;  1UG0 A;  1R5H A;  3G3Z A;  5EG0 A;  2NS8 A;  2GLO A;  1KU3 A;  1TWH J;  1T0F C;  4Y15 A;  3RPQ A;  2JRM A;  5HLT A;  4KFC A;  2BYV E;  2H1K A;  1FLI A;  3LST A;  3BWG A;  2GWR A;  3QYB A;  3COA C;  2PEX A;  1ACI A;  5LGN A;  3CCM I;  4U7B A;  4DGW B;  3KYD B;  4EM0 B;  1QBJ A;  4ASN A;  3BDD A;  3KIO A;  4RLQ A;  3RTR A;  3WGH A;  4I09 A;  4LK0 F;  1S3J A;  1SAN A;  1OCP A;  2CFO A;  2KRF A;  5E3N A;  4N4N B;  3DLL F;  4L5E A;  2TDX A;  2R0Q C;  4RAZ A;  4LG0 B;  4E7L A;  1YYV A;  3CCL I;  4QWQ A;  2Y69 H;  3H3Z A;  1TWG J;  2EPF A;  2FBK A;  3Q9V A;  2VJJ A;  1SMT A;  3HXL A;  5LRS A;  4RB1 A;  2ZB9 A;  4BHB A;  2FD5 A;  1Q1V A;  4ZDO A;  4I6Z A;  3ERM A;  2CWE A;  2CV2 A;  2ETH A;  4YIF A;  4CYD A;  1B1B A;  2HTS A;  3S17 J;  4B4C A;  2EZI A;  1TQI A;  4DW6 A;  2LMD A;  1RR7 A;  5EEH A;  2OUM A;  4A93 J;  2P5V A;  4EJU A;  5TJJ A;  1RES A;  1HOM A;  4E7S A;  3HOY J;  5ICF A;  3O8G A;  3M1C A;  4IQ4 A;  1JI8 A;  2B0L A;  2VXD A;  4LMY A;  4MFD A;  4J01 A;  4HW0 A;  2VN2 A;  1GLN A;  2PBI A;  2F5E A;  2CQX A;  3HGY A;  4UV9 A;  2LF8 A;  1LDK B;  2G7H A;  1YG2 A;  5FKM A;  2DFH A;  3HTS B;  1GUU A;  5CVV A;  1X1A A;  3DPU A;  3GFM A;  1FNN A;  4Y7N J;  1PP8 F;  3LSP A;  3BG6 A;  2CUE A;  1L3L A;  2MH2 A;  5TRD A;  1TZL A;  1MJ9 A;  3CJN A;  3GFJ A;  3K6G A;  3T5X A;  3VSL A;  5IT3 A;  5IYC J;  1EA3 A;  3CUQ C;  5EZG A;  3L2C A;  2NAZ A;  3KZZ A;  3PL8 A;  2VXZ A;  5EGO B;  2QBY A;  3C2B A;  1XN7 A;  2W82 A;  1FIP A;  2VQH A;  1TWC J;  4AVP A;  2XSD C;  2VJ5 A;  4XON A;  1IGN A;  3BTC A;  1H88 C;  4A2U A;  4WXH A;  1IW7 F;  2LNB A;  4IXA A;  2ESN A;  2DOD A;  3KEO A;  4GRI A;  3OYI A;  4ZYE A;  5M5Y J;  1HW1 A;  5FO5 A;  2XF5 A;  1I6X A;  1WVR A;  3ISP A;  3ZMD A;  2R93 J;  2ZXH A;  3HRT A;  1YW9 A;  2P81 A;  3BJ6 A;  4RGR A;  2Q8K A;  4JX6 A;  5D4R A;  1ZHF A;  3E6D A;  4H4K C;  2DT7 B;  3FMS A;  4M6V A;  2XAU A;  3ZMS A;  2BVL A;  4HLX A;  2E34 A;  1D5V A;  1ETV A;  3A1Y A;  2NVT J;  2LR8 A;  4LFU A;  1FTZ A;  3TL4 X;  2JN6 A;  1UEL B;  4W97 A;  3GTM J;  3VWB A;  1N78 A;  4I99 C;  1WJF A;  3I71 A;  3GX4 X;  3HOW J;  3PUB A;  4QSH A;  3WTT C;  1PUF B;  1QRY A;  4GYI A;  3V8K A;  2IAI A;  1VQ5 I;  3T0Y A;  2LFB A;  3OYK A;  4CHU A;  1LEB A;  2DCE A;  3BZ6 A;  3HHG A;  4ZZL A;  2K40 A;  1G3S A;  1LDJ A;  2HOT A;  4E6K G;  1M1E B;  1W5T A;  4FAS D;  1U5T B;  3HOT A;  3LNQ A;  3ABM H;  3FM5 A;  4CYC B;  1SAU A;  1AU7 A;  2H1L A;  3IRQ A;  2GXB A;  1MGT A;  3QYE A;  2M8G X;  2OCE A;  1X19 A;  2K5C A;  1YOV B;  1Y0N A;  3K1N A;  2CQN A;  2OA4 A;  2L9R A;  2Y9Y A;  2L7K A;  1DU0 A;  1VQN I;  2X6W A;  3W6J B;  3LFU A;  2GQQ A;  1V5F A;  4N9I A;  4BJ6 C;  3GZN B;  3I54 A;  1SFU A;  2EJR A;  1WWX A;  2IJL A;  4KIB A;  4UNO A;  2H94 A;  4XRM A;  4BU2 A;  3PFY A;  1X4O A;  2ZFU A;  3ZP5 A;  4II3 A;  3W6V A;  5CKT A;  1UB9 A;  1W36 C;  3MQ0 A;  1FZP B;  2HYJ A;  1LFP A;  3C2H A;  2DQL A;  4ZZD A;  2Y48 A;  3H5R A;  1XMX A;  4MFE A;  1CQT A;  3PO3 J;  3AG4 H;  3C18 A;  1MBE A;  1JKR C;  5IYD J;  1P4W A;  4CDG A;  3LL7 A;  5IT9 K;  3TKY A;  3ZOB A;  3PJR A;  3E0J B;  3E5U A;  2DMP A;  4KIS A;  4AM3 A;  3PQJ A;  3F6O A;  4IRH A;  2W84 A;  3CCE I;  4XL9 A;  1Y0U A;  2F5C A;  4C3H J;  3IV5 A;  2QSF X;  2XDV A;  5CQE A;  1OCZ H;  1SAX A;  4KIG A;  3HSE A;  2DA4 A;  1MSF C;  2A6H F;  1RIO H;  1JKO C;  3TQN A;  5JFR A;  3HRS A;  3D0S A;  3WTZ A;  3E6M A;  3M7G A;  3TO9 A;  5L3D A;  5DM7 F;  2VBW A;  3JRA A;  2R5Z A;  4E7J A;  1WPK A;  5JLX A;  4G6T B;  3ZQL A;  2XAH A;  2LH9 A;  3FMQ A;  4HOB A;  5KHD A;  3D5L A;  1OYI A;  5F27 A;  6PAX A;  1R5G A;  1ZGA A;  3CCV I;  3JTH A;  1LUJ B;  4PJ0 C;  1X2M A;  1IXS B;  4XKW A;  3KX2 A;  2E1N A;  4BS9 A;  3WE3 A;  3N97 A;  2LRE A;  3X2Q H;  3JAM K;  2XSJ C;  2RAE A;  2VI6 A;  3IAS 2;  5D6E A;  3QOD A;  1KQ8 A;  2CYY A;  2FBI A;  2ZCW A;  1O4X A;  1YTY A;  3OR2 C;  4HDU A;  1FP2 A;  4FE7 A;  3MZ8 A;  3JRI A;  1IC8 A;  4A0Y A;  5CVR A;  2WAF A;  2XAF A;  3HG9 A;  1R1T A;  3GTJ J;  4AC0 A;  1HW2 A;  5A2Q Z;  2PLY A;  1GDT A;  4P1W A;  4XID A;  2ELJ A;  2VBX A;  1JGG A;  4CZC A;  2DA3 A;  2MW8 A;  5J8F A;  3QYF A;  1ZRC A;  3CUO A;  2XGX A;  1HCR A;  5J6X A;  2GA2 A;  5EEG A;  4RB0 A;  1ZQ3 P;  4OIN F;  1Y39 A;  1A31 A;  4AWX B;  1LVA A;  3LA3 A;  2A5Y B;  1FJL A;  2IGO A;  2E19 A;  2XB5 A;  3DPT A;  2L5Q A;  4RLF A;  4KDP A;  5E18 F;  5BPI A;  2JMW A;  2O8X A;  5DYM A;  4RDU A;  3PFI A;  2DJI A;  3L7W A;  2GIV A;  2RC4 A;  1D1A A;  5D8L B;  3ZMZ A;  4FCY A;  2EH3 A;  4XKV A;  1YJN I;  5TGT A;  2NYX A;  4E70 A;  4PJJ A;  4NNJ A;  5F08 A;  3SZP A;  3ULQ B;  1SFE A;  4ZTF A;  1HC8 A;  3D5R C;  1POG A;  3G2B A;  5ICE A;  1KON A;  1QVU A;  3HL2 A;  4G7H F;  1VQ7 I;  3K0L A;  1MNM C;  3QAH A;  1DUX C;  4HYE A;  2OU2 A;  2V1D A;  2Y30 A;  1UST A;  3WOD F;  3J81 K;  4RM3 A;  1Y1W J;  3CDI A;  1BI1 A;  4M9X A;  5D4S A;  3FXO A;  1JHF A;  2Z9O A;  3GLL A;  2JA7 J;  5F0C A;  3LMM A;  2R5Y A;  2DA7 A;  4D1Q A;  1Y8Q B;  4M3B A;  4Y13 A;  1JHH A;  3EPZ A;  4LLG F;  3ZMV A;  2JUG A;  3K4L A;  1Y6I A;  2FSW A;  2M4K A;  1ZR2 A;  1G6N A;  2AXT C;  1R22 A;  1KA8 A;  1LDD A;  1JKP C;  4IHV A;  1R36 A;  1WI9 A;  2KL4 A;  5ILV A;  3ZGK A;  5DEQ A;  3G6E I;  3BG3 A;  1H0M A;  4N4O B;  3I5U A;  3HOS A;  2ECB A;  1OCT C;  4HF1 A;  3FKJ A;  1ZGJ A;  2R7U A;  1S9H A;  2DFE A;  2Z2S B;  3GYH X;  5GP9 A;  2RGV A;  2DYR H;  1QO0 D;  2X1C A;  5B1B H;  5HDG A;  3LSG A;  2HVR A;  1SFK A;  3KLN A;  2BZT A;  3JSP A;  2LOO A;  2JRT A;  1G8X A;  1YLF A;  4KIC A;  1YHQ I;  1B72 B;  3T8R A;  2CQQ A;  3D5S C;  5BNG A;  2ZME A;  4AIH A;  2V7F A;  5D5U B;  2WAE A;  3HOX J;  1U5T C;  4LLL A;  5IOY A;  1FOX A;  4D5F A;  2EFN A;  1K6O A;  4AYB N;  2XUB A;  4UV8 A;  1ONV A;  2E1M B;  2BY3 A;  1X1D A;  2CUJ A;  1W36 D;  3OV8 A;  4II2 A;  2QVO A;  3W2W A;  3IL2 A;  1GXP A;  2PFB A;  3G1O A;  3KCC A;  3NRV A;  4B09 A;  3JRF A;  4BE0 A;  3K70 D;  4S04 A;  1J0R A;  3FXM A;  3H0D A;  1H8A C;  2K3F A;  4DYR A;  4HF2 A;  2JPB A;  2EK5 A;  1I6H J;  1HKT A;  1DP7 P;  4CIC A;  2P5K A;  4HQE A;  1QNT A;  2OZU A;  4M9Z A;  3OR1 C;  3LAJ A;  4HPQ A;  3R0J A;  4ZH4 F;  4HNU A;  2XC7 A;  3F22 A;  5JVG F;  1U2W A;  4OMZ A;  5LEJ A;  5EG0 B;  1JXS A;  4FTH A;  2PI0 A;  1YS7 A;  5JR3 A;  2Y75 A;  3KP2 A;  3I4N J;  2IVM A;  4L0Y B;  1VND A;  2M30 A;  2O03 A;  3IWZ A;  1KGS A;  2L7Z A;  1G3Y A;  3LWF A;  2TCT A;  2CGP A;  2VUM J;  2DW4 A;  2QGU A;  4NHJ A;  4L5J A;  4XSX F;  2VQG A;  3OMY A;  4JBA A;  2JA2 A;  2KIM A;  1DGR M;  3FWE A;  1IXC A;  5K5Q A;  1TT5 B;  1R4M B;  1MSE C;  3S1R J;  3FIW A;  1I1S A;  1OIS A;  3HZJ A;  3S3M A;  1FT9 A;  3JCU C;  4LG0 A;  5L3F A;  4M74 A;  4HDV A;  1EH8 A;  4BNC A;  4ZYA A;  3F21 A;  3RPU A;  4EVI A;  4YFK F;  1XGN A;  3OYL A;  4BH9 A;  3BTJ A;  4M3D A;  4R8H A;  1OQY A;  4KMF A;  3MEX A;  5B3S H;  3OYF A;  1KU2 A;  4BYY A;  4G94 A;  2COB A;  2HPI A;  3QOE A;  4U0Y A;  3JRE A;  2WA0 A;  2G7U A;  3TDU C;  3AFH A;  1D3Y A;  3TP3 A;  5E3L A;  3W2A A;  1JUP A;  5EF6 A;  3ZMT A;  3HSR A;  4F91 B;  2EIN H;  3CCQ I;  1K78 A;  3Q0U A;  1O57 A;  4IPA A;  1LE8 A;  2GBY A;  4BE2 A;  5L3B A;  1YIJ I;  2JA6 J;  4EJT A;  3A02 A;  1SD4 A;  3HIF A;  3DP7 A;  4E7I A;  3DV8 A;  2DBB A;  4R79 A;  3MKZ A;  3WHB A;  1FP1 D;  3K69 A;  3IRR A;  3FF5 A;  1D8K A;  1TBX A;  2JA8 J;  3R60 A;  3E97 A;  2E2J J;  3EUA A;  1R00 A;  4HX4 A;  2PN6 A;  3NAU A;  2LK2 A;  3HGG A;  2WAQ N;  1T98 A;  3MKW B;  1D1B A;  1MBJ A;  4PFO A;  2QSG X;  3CJR B;  1R58 A;  3V4G A;  3J7A Y;  3AG3 H;  3BRO A;  1P2F A;  3LAP A;  5BMZ A;  2XPV A;  3KLO A;  3MVP A;  4KT5 C;  2LG4 A;  3B6A A;  3N4M A;  3VPR A;  1BOA A;  2M7A A;  3HTU A;  2WWY A;  1O3Q A;  3LSM A;  3MZH A;  3HKZ N;  2ESH A;  2W00 A;  3L2R A;  1T33 A;  1SVL A;  1B4A A;  2ISZ A;  2XVC A;  2LLK A;  2Q2E A;  1MBG A;  2BY2 A;  4FT8 A;  3K4M A;  1ZEL A;  2M34 A;  2PMZ N;  4HA8 A;  2ELK A;  3HUG B;  3W3C A;  4AVZ A;  4Y33 A;  3VEP A;  3FK7 A;  3KP3 A;  2DDA A;  3WU2 C;  3S2D J;  3OYN A;  5FKN A;  3BY6 A;  2XKP A;  2O9L A;  2NVY J;  3PM1 A;  3U21 A;  1WJD A;  4CXF A;  2QA4 I;  4AIK A;  3GCM A;  2PJP A;  3LQQ A;  2J5O A;  4CYC A;  2L54 A;  5E8I A;  3JRB A;  1V4R A;  2FOW A;  1MDM A;  2MAB A;  2KIS A;  1XTA A;  1TQM A;  1Z6R A;  2UXX A;  3VYR B;  2KT0 A;  4MNU A;  4AIJ A;  1QA6 A;  3ZQ7 A;  1JJ8 C;  4JX5 A;  2A68 F;  1FEX A;  3L2W A;  2O7O A;  1DQU A;  2GIZ A;  4MEX F;  4RB3 C;  5J40 A;  4RBO A;  3GFI A;  5L3C A;  3DTI A;  4RS8 A;  3IHU A;  2PJR B;  4I2O A;  3J7A O;  1E2X A;  4YEL A;  5GAG J;  2DA5 A;  5HS7 A;  3R6S A;  3K70 C;  3WGG A;  3H1C A;  2D45 A;  2HFH A;  5LFA A;  1A6Q A;  1LJ9 A;  3PSF A;  1OLT A;  2BV6 A;  3ONQ A;  3DBH B;  2L9V A;  2LC2 A;  4RGX A;  5HLG A;  5F0H A;  3BP8 A;  3F72 A;  1FPQ A;  1GVJ A;  2AHQ A;  1RET A;  2V9K A;  1H9T A;  1Z1D A;  2WB1 N;  4GFB A;  5K7F A;  2EFW A;  1G59 A;  5AIP A;  1ETK A;  3LFK A;  4PJM A;  2DTR A;  2V4J C;  3WE2 A;  2KZV A;  4NBQ A;  4RMN A;  2H8R A;  3V7S A;  4A3G J;  4Y3O A;  5AON A;  1QPM A;  1FY7 A;  1U0J A;  5K7H A;  4EEF G;  3BR3 A;  2VKV A;  2L4A A;  2KRH A;  2E1M C;  4A3F J;  2DDB A;  4O3M A;  1XSD A;  3SYT A;  4F93 B;  3E6C C;  5K5R A;  3SFZ A;  1OCO H;  4TV7 A;  1T39 A;  3Q0V A;  2Y0S A;  2FBH A;  1VQK I;  2X51 A;  2DO7 A;  2MGQ A;  3F6V A;  4UHT A;  1LPQ A;  2LSO A;  2COM A;  2O0Y A;  2QQB A;  4U0V A;  1EJ9 A;  2IS6 A;  1UZC A;  3BPX A;  2P6S A;  2FQ4 A;  4WX9 A;  2CG4 A;  2QQ9 A;  4E7H A;  2WAD A;  4E7Z A;  4JOM A;  1MJB A;  3CCY A;  5KAF C;  5FJ8 J;  2GOM A;  1WKM A;  4HZF A;  3W6K B;  1S5L C;  4BJT A;  3TDZ C;  4BUP A;  1IG7 A;  1MND A;  1T0F A;  3IH3 A;  1Q1H A;  3CC2 I;  1ZRD A;  1ZLK A;  1BBY A;  3H35 A;  4IHW A;  3FXL A;  3HYI A;  5TIS C;  3DQV C;  3LSI A;  2PG4 A;  2DI3 A;  1F9N A;  3K9T A;  2LBF A;  1MH4 A;  2CUZ A;  2CV1 A;  3AL0 B;  2E7X A;  2HU9 A;  3SQN A;  2IA2 A;  4ZYH A;  1ITY A;  4QIW N;  3BOQ A;  1IDY A;  2L3D A;  2QKM B;  3HBL A;  5LBQ A;  4IX7 A;  3SZT A;  2EIJ H;  2IBD A;  5DD8 A;  3VYU B;  5IT9 Z;  2R7D A;  5K7Z A;  3E5Q A;  4UVA A;  3HOU J;  5GAE J;  2A6T A;  5B5E C;  4HRI A;  4OAY A;  4EQQ A;  1T38 A;  1XS9 A;  4J00 A;  1QZY A;  5JI6 A;  1GHC A;  2GAU A;  3M9A A;  3AAF A;  4I0B A;  5ILS A;  2ID3 A;  2A61 A;  3DFG A;  3G1L A;  4G9Y A;  3SXY A;  3ZXS A;  1AHD P;  3P7N A;  3AL0 C;  1T6S A;  4XBF A;  1EF4 A;  4OWR B;  4BDZ A;  4JP0 A;  5HDN A;  2GA1 A;  2RV8 A;  2W1O A;  3OYH A;  1MBH A;  4LOC A;  1IN6 A;  1GT0 C;  1E0E A;  4MTE A;  2EV0 A;  4IJA A;  2R3S A;  5IY5 H;  3H5A A;  1EH6 A;  3DF8 A;  1NTC A;  2GOX B;  3DBL B;  3CP8 A;  3Q5F A;  4FIS A;  2QYO A;  5D6F A;  4EJW A;  2XRL A;  1HKS A;  3DTK A;  3P9I A;  4AYB A;  4B3A A;  3TED A;  2VKH A;  1YRN B;  3CCU I;  5B66 C;  4M6Y A;  4IHY A;  1REP C;  2EIL H;  5DUK A;  4E7K A;  1FOK A;  3GTO J;  2RQP A;  3S1N J;  1Y56 A;  2JVH A;  1U5T A;  2J5P A;  3CJT B;  1LEA A;  1V3F A;  4KJZ A;  2IP2 A;  1KZH A;  1JJ6 C;  3SEZ A;  2VB6 A;  4LLN A;  1R6R A;  2F4O B;  2HQN A;  3I58 A;  2ZJR F;  3MFK A;  1NK2 P;  3OS0 A;  2CH0 A;  4I98 B;  3SFI A;  2R7Q A;  3RZO J;  4GXO A;  2JPC A;  4YRV A;  1RUO A;  2IGM A;  1MZB A;  5M5X J;  3VB2 A;  3BPV A;  1EV7 A;  2F4I A;  4Q47 A;  1J2X A;  3FXJ A;  1IUY A;  2BBY A;  2Q1Z B;  5LHH A;  2MLG A;  1T56 A;  2EV5 A;  3MAJ A;  4KMU X;  3S1M J;  2E5N A;  1XCV A;  2PMH A;  4C2U A;  3MMY B;  1DGW Y;  3T1B A;  2P5L C;  1JTY A;  1I1G A;  3L2Q A;  4BQN A;  2QSH X;  4A3C J;  3QU6 A;  4NQW B;  3A0B C;  4NQW A;  3FHZ A;  4XOR A;  4OOI A;  1L0O C;  1CGP A;  1X3Z B;  2OQG A;  3KP6 A;  2F48 A;  3ZQQ A;  2VOP A;  1ZLJ A;  1UFM A;  3CP2 A;  1RI7 A;  4K2E A;  1LB2 A;  2QWW A;  3QRF F;  1BM9 A;  4XLF A;  1WJA A;  1HQC A;  4L9V A;  2P8T A;  1ZRF A;  1DP3 A;  5FLV A;  2LF7 A;  3GZ6 A;  2FX0 A;  3GTQ J;  1J59 A;  1DPR A;  1YW8 A;  5E20 A;  3FXQ A;  3CLQ A;  1RC9 A;  2VLA A;  1H9G A;  1HW5 A;  4XRS G;  1YFH A;  4MEY F;  2L0K A;  1ON2 A;  3DBR B;  3ZQC A;  4XLE A;  2JSC A;  2LDU A;  2E71 A;  4PSX A;  2L4M A;  2NNY A;  1YX5 A;  3N05 A;  1W0T A;  3GW2 A;  3CDL A;  1KYZ A;  3BLY A;  1K4S A;  1ZYR F;  1WJB A;  2JJ7 A;  2HI3 A;  1GV2 A;  2FMY A;  2FJ1 A;  3K10 A;  3WU1 B;  4LD5 A;  1S29 A;  2W25 A;  4FQG A;  4XLH A;  3J7Z I;  1TT0 A;  1LNW A;  3QU3 A;  2UWM A;  1KQ0 A;  2H8W A;  3CLO A;  5FGM A;  3T8T A;  2AQE A;  3REO A;  2EZL A;  1MBK A;  3S15 J;  3I59 A;  2FQ3 A;  3LSH A;  4ZDL A;  2X6O A;  2VPL A;  4D5C A;  5CYV A;  1B9N A;  2Z33 A;  1IAW A;  2VQC A;  3JW4 A;  4A3I J;  3FM3 A;  3I0T A;  1OR7 C;  2IGK A;  2QEN A;  4G12 A;  3S93 A;  4AID A;  1VQO I;  2BY0 A;  4IOC F;  3OWT A;  2EFP A;  4ZYG A;  3LSR A;  3DEU A;  3M8J A;  2XIG A;  2BGC A;  4M3G A;  3RJP A;  4XLC A;  1R5I D;  2WV1 A;  4B44 A;  2VBY A;  1ETO A;  3BT9 A;  2BVM A;  2CU7 A;  3K2Z A;  2KP6 A;  5J47 A;  3FXK A;  2K85 A;  3CF2 A;  3OL3 A;  3EQL F;  2VKE A;  4L9T A;  3TBI A;  4B3X A;  3CC7 I;  2NS0 A;  3BC8 A;  5KCM A;  4IQJ A;  1R4N B;  4BXX J;  3HDD A;  3M07 A;  1OKR A;  4Q5S F;  1ZKG A;  2QUF A;  3SZG A;  4G8X A;  1IV6 A;  4M72 A;  2DK5 A;  5AIQ A;  2JT1 A;  3GXO A;  3J81 Z;  4KA4 A;  1MMS A;  2STW A;  2UUZ A;  3F3X A;  3IKV A;  2Z3Y A;  3ML6 A;  4QPQ A;  2MFZ A;  2CQ7 A;  3DKW A;  2OQR A;  1R1V A;  2XAJ A;  4HBL A;  3DCF A;  5CLS A;  5C4X J;  1AOY A;  4FX0 A;  2ZJ2 A;  1RPW A;  3P9K A;  2VPR A;  2MSY A;  1YW7 A;  4BEH B;  2V1N A;  1BIA A;  4XLN F;  1BR2 A;  5LD2 C;  4X1E A;  2KIQ A;  2IXS A;  4BQO A;  3OSF A;  3RPU D;  3KZY A;  1UHS A;  3LQR A;  4BQQ A;  5FLX K;  1XGM A;  1D0Z A;  2EIK H;  2P0W A;  3WTS C;  3GTG J;  4ESF A;  2CW7 A;  4RGS A;  4BAY A;  5DCM B;  2LP0 A;  2X85 A;  5FRM A;  2EIM H;  1TWF J;  3K1M A;  1W4M A;  4UVB A;  5B1A H;  1ZRE A;  4OIP F;  4I76 A;  1FBU A;  3TW7 A;  1U9N A;  2D2W A;  1APL C;  4BGD A;  5FB2 A;  5JLW A;  4WCG A;  1BW5 A;  3D1N I;  1K4T A;  4N0B A;  1JUM A;  4PCQ A;  2RN7 A;  3I9V 2;  1LFU P;  1PJR A;  1QHG A;  2R92 J;  1U9O A;  3DTE A;  4KIT B;  4MTD A;  3AKZ A;  2A5W A;  3ABT A;  2IS4 A;  3QQA A;  4U7D A;  3CME I;  4GO1 A;  5IP9 J;  1BI2 A;  4HX8 A;  4HLY A;  2V79 A;  1J75 A;  2RRE A;  1OCR H;  1X58 A;  5L3G A;  1JT6 A;  5IOZ A;  3S8P A;  1WQ2 A;  3OYA A;  1XPX A;  2V9V A;  2FA5 A;  2EFO A;  5IYB J;  2DN0 A;  1HSJ A;  1GXQ A;  1ZG5 A;  5E8G A;  1ZN2 A;  2HXO A;  4C2T A;  1WH5 A;  2K86 A;  2X6Y A;  5J4Y A;  2K27 A;  4ANJ A;  2KPM A;  2WY8 Q;  4D7M A;  4I01 A;  2PJR A;  1FC3 A;  4XNF A;  3CTA A;  4IEJ A;  2DMN A;  3CCJ I;  3GTK J;  1SD7 A;  4RAF A;  4R1H A;  2DLL A;  4BBR J;  2E5Z A;  4A5M A;  5DV5 A;  3F8F A;  4ENJ A;  5F1J A;  4L9N A;  3EYY A;  2DK8 A;  1J5Y A;  1Z7U A;  1RR8 C;  1X4P A;  2MBF A;  1SFX A;  2V6E A;  3WTU C;  2LY2 A;  2DMU A;  4HAM A;  3NAR A;  4JX4 A;  2XRO A;  2KDO A;  2MH9 A;  2B63 J;  5FLM J;  3H36 A;  2E35 A;  4HNV A;  4XKC A;  3Q9S A;  3B02 A;  3ZCO A;  3WU0 A;  4IVN A;  2ZKZ A;  5FKO A;  5JHF A;  4OIQ F;  2VOO A;  2O5R A;  2CW0 F;  4X0G A;  2YX7 A;  2DPD A;  2MC4 A;  3GLX A;  4U87 A;  1QZZ A;  1ZG3 A;  3M8F A;  2LBF B;  3ASN H;  1N77 A;  4CH7 A;  3IP4 B;  3RKX A;  4NDL A;  3KEQ A;  4UVC A;  5IP7 J;  2PQ8 A;  2NVU B;  5E17 F;  2E2H J;  1P4X A;  4GCV A;  3ZPL A;  5LGT A;  1YX3 A;  1QZE A;  4YII A;  3MWM A;  1LE8 B;  3E7L A;  5J1Y A;  3WTW C;  3DU6 A;  3ESW B;  3MKL A;  3MD2 A;  5EDN A;  2HDC A;  1ULY A;  3J80 K;  1YS6 A;  2CW8 A;  4Y4R A;  1ORK A;  2EA2 A;  4A3J J;  2K9S A;  4XOT A;  4I0A A;  3C2G A;  2RQQ A;  3CMM A;  2BXY A;  1Z77 A;  3BJA A;  2LRD A;  2I5U A;  1IZ1 A;  4BE1 A;  4BAC A;  4UB6 C;  1B9M A;  1FYK A;  5H6Q A;  5HLH A;  1GV5 A;  2D1H A;  1D0Y A;  2OJE D;  4JK1 X;  2FEZ A;  1XB4 A;  4LG3 A;  4G7Z F;  3DU5 A;  4MLO A;  4C9Y A;  4HNT A;  1ETQ A;  3EUH C;  3LA2 A;  4EAT A;  4UB8 C;  3HRM A;  3OIP A;  2HXI A;  3M8E A;  4V2G A;  2R7R A;  4Z6Y A;  4S05 A;  2FML A;  3LSJ A;  1I5Z A;  1LKX A;  2M7B A;  1K7A A;  1HBX G;  2JA5 J;  1BW6 A;  2XF6 A;  4F92 B;  2DOA A;  2G9W A;  3LA7 A;  4EM2 A;  2IA1 A;  1PUE E;  4A3D J;  3TOB A;  3DEW A;  1BJZ A;  4IF4 A;  3JRD A;  4QTR A;  4WWC A;  5HNF A;  2A6E F;  2FOK A;  3WG9 A;  4HV6 A;  2R7F A;  3O6B B;  1HLV A;  3TMO A;  1IRF A;  2RDP A;  1U8R A;  2NVQ J;  4Y52 J;  5BS6 A;  1AA7 A;  1J09 A;  5ICC A;  1FMW A;  4CCM A;  2E60 A;  3TO7 A;  4MGR A;  3KYL A;  1PUF A;  1YRN A;  3P9C A;  2X6X A;  4D0P A;  4UUS A;  4UUS B;  3O3K A; 
#chains in the Genus database with same CATH homology
 3CF5 F;  1VQK I;  2ZJR F;  1VQM I;  1FOY A;  3J7Z I;  3CCE I;  1YI2 I;  1YHQ I;  1YJN I;  5GAH J;  2K3F A;  3CMA I;  3CCV I;  2E34 A;  2H8W A;  3CCS I;  3G71 I;  2E36 A;  3CCU I;  3I56 I;  4IO9 F;  5DM6 F;  3PIP F;  1S72 I;  1ACI A;  3CCM I;  1FOX A;  1HC8 A;  3J7Y J;  5GAG J;  1VQ7 I;  1VQ4 I;  3CCQ I;  3G6E I;  3PIO F;  5JVG F;  1VQ8 I;  1FOW A;  2QEX I;  3CC4 I;  1Y39 A;  4UY8 I;  1VQL I;  3CD6 I;  2QA4 I;  3CC7 I;  2JQ7 A;  4V19 K;  3CCR I;  1YIJ I;  1YJ9 I;  1YIT I;  3G4S I;  4IOA F;  3CJT B;  2E35 A;  2OTL I;  3DLL F;  1YJW I;  5DM7 F;  2ZJQ F;  1VQP I;  1VQN I;  1VQ6 I;  2FOW A;  5GAE J;  3CME I;  2ZJP F;  3CC2 I;  2OTJ I;  1VQ5 I;  5GAD J;  2NXN B;  1QA6 A;  1VQO I;  3CCJ I;  1MMS A;  4IOC F;  3CCL I;  1VQ9 I;  3I55 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...