3CCJP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
molecule tags Ribosome
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 42
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ccjP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ccjP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ccjP02
1VQMP 3CPWO 1QVGO 3CC2P 1VQLP 1YITP 1YJ9P 1S72P 1K73Q 1KD1Q 3CCLP 1KC8Q 3CCVP 1NJIQ 1VQKP 3CCQP 1KQSO 1VQ4P 1VQ7P 3CCRP 1VQ6P 1YIJP 3I56P 1YHQP 1N8RQ 3CCUP 1YJWP 1QVFO 1Q7YQ 3G6EP 1K9MQ 1VQNP 3I55P 3CCJP 1JJ2O 2OTJP 1VQ5P 1M90Q 1VQPP 3CD6P 3CC4P 3CCSP 1VQOP 1W2BO 2QEXP 3G71P 1YJNP 1Q86Q 1VQ9P 3OW2O 1VQ8P 3CCEP 2OTLP 1K8AQ 2QA4P 1Q82Q 3CCMP 3CXCO 1YI2P 1M1KQ 3G4SP 3CC7P 3CMAP 1Q81Q 3CMEP
chains in the Genus database with same CATH superfamily
3H1KJ 3VOPA 1HUCA 2RMZA 2HPCB 3TGUE 3H1HD 3DTJA 3AEDC 3G21A 2JBGA 2JU2A 1OIPA 1SFCB 2B88A 4C7RA 1A8OA 1LGHB 1RF1C 5L8RJ 1NTKK 1KB9H 2AEMA 2J58A 2ZYGA 1FOSF 1YQ3C 1AVOA 1FDMA 5HV8A 1RO0A 1RF1A 1NTMK 1KC8Q 2M8PA 2D2CD 2PEMA 1SQQD 2R3SA 2DW3A 2E5TA 5KLIB 2FQ1A 3F89A 2OYHA 5KAFH 2WPRA 4PV1C 4YPCA 3I5CA 1PPJG 3HUSC 1TU3F 2E76D 1AYIA 2XKMA 1KQFB 2KZJA 3WUVA 2JP3A 4JPZB 1SQVG 3U1CA 3AE2C 3GKLC 2MR8A 2YKPA 3Q1MA 2VLNA 4DT0A 3CMAP 2KGCA 3B5NA 3EFGA 3C1LA 3RL0C 4N78E 1NJIQ 1J2JB 3JSVC 1IUQA 1K9MQ 4H0LB 2FFDC 3BCCD 1GTWA 3R2PA 1NTZE 5GTIE 3AE5C 1ZRTD 3M9BA 5H2FE 3L71E 2K93A 4Y28J 3RBXA 5AVXB 1OX3A 3LW5J 1VQKP 1LTBC 1VQ7P 2OQQA 2M8NA 3RL0D 1ZMEC 3P8CE 1KYOH 3W68A 2QEXP 1MKMA 1PGJA 2JO0A 3PTZA 1QX8A 3TSIA 3A2AA 2CWOA 1S9KE 3CWBJ 2KODA 1LTJA 3D71A 3B8EB 2WITA 2BQ1E 3L75J 2K37A 2Y0EA 2WVRA 2E76C 3HUSB 1FZAA 1DEEG 1L0NJ 1HF9A 4I7ZC 3P05A 5KLVD 4L73A 2LXCB 1NTMJ 3AECC 2KI7B 3ITKA 5AVRB 2GZFA 3HUSA 3H1HE 1NAFA 3DS1A 4WVZA 1U57A 1G1JA 1S5LX 2FYUE 3SWKA 2H43A 1SQXK 1SQBJ 4N6JA 1CEIA 3CD6P 2NPSD 1JCCA 4H13B 1ZN5A 4H13D 4NPFX 4QNBA 2IFMA 2NRGA 1FZBA 1EXJA 1M1JC 3RK3B 1EC5A 2ZT9B 1VQ4P 3RK3D 5BS1A 2YO2A 1QEXA 1BE3J 1Z56A 1L4AB 1XTGB 2BUOA 1T2KC 2KW2A 1SFCD 2Z5IA 3C9IA 3G9RA 1VDFA 3PH0A 1M6NA 3NTNA 2JB0A 3FXEA 1PL5A 1PP9G 4GKGA 3CX5D 5K5GB 1UNKA 3L35A 5AW9B 4L75A 3L70G 1BSNA 4M0IA 2FQ0A 5KTBA 4BXLA 3CXCO 2KXPB 2Q9IA 2NO8A 3NTEA 3B5ND 5AW7B 2IBZG 1JUNA 5CCGA 2C0WA 2W83C 2X2BA 4I2LC 3VMYA 1BE3E 5AW2B 5DJTB 3OAKA 1LTJC 1M74A 5EJDA 1YI2P 2JO1A 2KLUA 3H1IG 1N7SD 2AVAA 1RF1B 3BRTB 1FR2A 3H0DA 2LIUA 2FVEA 4MN4C 4HB1A 4H13C 5AVTB 5BU8B 3L71J 3L70J 4N3YB 1BCCE 3TNUA 4BWNA 2A45H 4ZKPA 3CCMP 1FZCA 2AEJA 2JWAA 3U59A 4XFJA 4H44B 2IPPA 1VF5D 1S9KD 3TYYA 1RE3C 4GT1A 5GTIH 2JU1A 2N5HA 4LC1A 4LLHA 2YKQA 1LTJB 2FVFA 4DOJA 3L74G 7CEIA 2OYIA 3AE6C 2PEKA 4GOEA 2DGYA 1DD3A 1BXIA 1GXHA 4RKUJ 2ROQA 2VLPA 2KOPA 1AFOA 2FQ2A 5KJ7D 3LIDA 2KNCB 1PEOA 2ZVNB 2B9BA 3L4FA 1GU4A 1PP9D 1Q2NA 2BASA 1P84D 2WMMA 2HLOA 2QA4P 2PEQA 1N7SB 3L70D 4CA3A 2R3CA 1NHLA 1YITP 4JYBA 4W7YA 5CCHA 3H1LG 2J59M 3H32B 1LJ2A 2H89C 1KZUB 3CWBD 3CI9A 1UJZA 1HTLC 3H4EA 2C9NY 2AEFA 1YQ4C 3H1JG 3GF3A 1ACPA 1KILC 1S5LH 2K0XA 3BCCJ 3P32A 3VTPC 2QNWA 3JCUE 3HTKA 2RKLA 1A43A 1GW3A 5E79H 3RL0B 3TGUJ 2QJKC 1FE6A 1PEUA 3IR9A 2RH0A 2I1JA 3CCJP 3H1ID 2W6BA 1RQVA 5CCGC 3G28A 3G0VA 3OA7A 4DJGA 1JMBA 4RESB 4GODA 3VN0A 1OW8A 1S2EA 2LR2A 3H6PA 4H44D 2HODB 3GZLA 3H25A 1PZQA 1YYCA 3CXHE 2FYUG 2KP8A 1H89A 2O01N 2GDYA 3C8VA 2QIWA 3DS3A 2IZ1A 3H1LJ 1RE3A 1VKUA 1USDA 3E2DA 1KB9I 1QL2A 1NTMG 2GA1A 3A0HE 2KORA 2BCCJ 4U0AA 1PPJD 5HGNA 1DX7A 4KT0J 1FOSE 4WY4A 5TJHA 4Z1MH 2XT1A 1M57D 2KYVA 3CC4P 5CJ4A 3G29A 3L36A 1IFPA 1LTTC 5HGLA 2LMLA 4N78D 1BGYE 2AF8A 3KZIE 4XFXA 1KB9D 2QSIA 3AEEC 2GZGA 3GJNA 1S72P 2FXMA 2Q3EA 2OYIC 2FBWC 3L71D 1RE4C 5C39A 4F37A 2LXBA 4PWVB 1D7MA 2BHVA 3A0BH 2MVVA 4AUWA 3CCSP 3O6QB 2EHTA 4I7ZB 2KB7P 2K88A 3MHVA 3MP7B 1A02F 3CMEP 2E75B 2ONTA 3GW6A 2KWLA 1DEBA 3WU2E 1GK4A 2AXTH 1GU5A 5AW1B 2KSJA 5I4TG 1L0HA 2Z46A 1JTHA 3RL0g 2GM4A 5APYA 3AE3C 5M1BA 2AXTE 2IYOA 3H1LE 3KHUA 2N1TA 3QWOC 2VLQA 3TDKA 1SQPE 2FHSC 1AQ5A 3CC7P 2KGEA 1NTZD 1L4AD 3EJBA 2PY8A 1GL2B 1QRJA 2MY5A 1KD1Q 1JNMA 1SQVE 3AEGC 2JWDA 1IJDB 2PEJA 4YTPC 1KTMA 2ERHA 1N73C 1QLED 1JTHB 2BEZF 1VQOP 2E1MA 4Y99C 1NYHA 3MTUE 4U3FG 5HVCA 3HD7C 4IL6X 1X79B 3RG6C 1GD2E 2CGQA 2Y0DA 2LL8A 3AE8C 2FYNB 1UIXA 3H1HJ 4GR6A 1VPCA 2PP6A 1SQPJ 1FZCB 1AF8A 1D1DA 3T97A 1VQ9P 1NTZK 2UWJE 5F2OA 2HFED 3B5NB 1RNIA 2AXCA 2KS1A 3L72G 1HVVA 1FZEA 3WBHA 1GK6A 2N6YA 2WPVB 1LT9B 1SQXJ 1N73B 3TF5A 2WT7A 1SQBK 3LIEA 2L6EA 1USEA 5AW0B 1HGZA 2KG6A 1KYOI 4I6MC 4NPEA 3BVHA 1KQLA 2D2CB 1NO4A 2P2UA 1N7LA 1A02J 3AE4C 3DS2A 3RK2B 2AFDA 1N8RQ 2Q7CA 5B5EH 3JCUH 1VQ5P 4NPDA 1M6EX 1NU1D 4OWFA 1RHZB 2W27A 1K8AQ 3D70A 1IMQA 1FBMA 1S4XA 2N1TB 1WRGA 1NKZB 1CI6B 1U7MA 4R4LA 2KOOA 3L70E 2WQYC 1LT9C 1SQBD 3AE9C 3KDPB 2PENA 1T8ZA 3VMZA 2Z44A 1KN7A 2YO3A 5BVZA 1HJ0A 1GL2D 5TISH 3CWBE 1CW5A 2IYPA 4MRTC 3V2PA 2WPSA 2QJYB 2O1JA 1OVUA 4U3FD 3L75G 3G1GA 1PFIA 1JY3N 3CCUP 1YBKA 5AW6B 3HZQA 1DV5A 1AA0A 1AQTA 2XV5A 3M9HA 1ZNVA 1W2BO 3B5NC 4K3AA 2N9YB 4HJGH 4R0MA 2CQ8A 4XFZA 3G4SP 2NPSA 2JGPA 3Q2YA 2E43A 2FYUK 5APWA 4IPYA 3CX5I 1RY3A 1VQNP 2GZIA 3B5IA 1ZMBA 1EZVD 4PH0A 2PNGA 1NTZJ 1G2CA 3CCEP 2EG5A 4XE5B 1J1DB 1KILB 4H44C 4U0BA 4IL6H 1NH4A 2YIUC 2K2QA 1M7LA 1LT1A 4CPGA 3BCCG 3PHLA 2E74C 1M1JB 3F5HA 4K35A 2XU6A 2KR5A 4R4MA 2L22A 1KLPA 4DZOA 2FADA 3H1KE 1DD4A 3L72E 3AE1C 4PXHB 1HGVA 4WB4A 5EFWB 3MGEA 1T8KA 1MFZA 1BCCG 2QM7A 2FVAA 2IX7C 1S3JA 4IFMA 2LIWA 3B4QA 5CHXA 1IO4A 3GF7A 1SQVJ 2K94A 5AW5B 5KLVK 1P84I 1ZRTE 4U7JA 1SQBG 1CSBA 1X22A 3G71P 2E76B 3EJEA 3HE4A 2QJYC 3H1JD 1BDCA 4U0CA 2FYUJ 2NZ2A 4H2XC 1YJ9P 1OVVA 1PIXA 2E74B 5AW8B 2IBZI 1LTIC 5APUA 2QG4A 1FS0E 5F2NA 1L0LE 4WYMA 1JO5A 1PGOA 1FAVA 2JQ4A 5KP7B 1BSHA 2KSEA 1W5CE 4C46A 3CC2P 2XZ1C 2VLOA 3SFDC 2M3BA 2KNCA 1NWQA 3IN6A 1IC2A 2WZ7A 2O3JA 2ZXXA 1NQ4A 1SQXG 2M5AB 2YIUB 4ZKUA 3BATA 3PLNA 2MJZA 2B87A 5AVWB 2H88C 5CBOA 3VMXA 3L74J 4ASVA 2XNXA 2QJPC 3VMAA 4OGQB 1SQVK 2V4HA 2KOGA 3EJDA 3V5BA 2ZJSE 3MZWB 4EDFA 1BCCD 2OYIB 4IFDK 2N9BA 1EZVE 1ZR2A 3A5TA 1JJ2O 1LNQA 3EWKA 2G3AA 2IBZD 1T2KD 2L4BA 1X8YA 2QRXA 1KORA 3VP8A 2P10A 1EXIA 4AQRD 1FZCC 3VYIA 2K5XA 2J5UA 2LKMA 2WTYA 5H2FH 5TISE 3EQ2A 5AW4B 2QE7H 2LKIA 3MIWA 1IMPA 3HD7D 3CCRP 1IK7A 3TGUD 2W6AA 2PEOA 3FX0A 1HY8A 1N86A 1FZGA 3V4QA 1CZQA 2IZ0A 1X0TA 3H1JE 5APTA 4WWIA 2JYGA 4BRYA 2C9LY 1ZR4A 2K9JB 3DS0A 2KGAA 5CZDB 3A7OA 1DH3A 1YJWP 1MV8A 1L0NG 1SQQE 3L72J 3L73D 2LPKA 1S5LE 2Z4EA 4IL6E 2V7QJ 2HODA 3BRVB 3D6ZA 1SQPG 4COCA 3CCLP 4DG9A 3L72D 1L0NE 1P84H 1JY2P 3P7KA 3KQGA 5KLIC 4H2YC 2HYNA 1SFCC 2PRRA 5GTHE 1KILA 2G8YA 1MZ8A 1H88A 5B66E 3A0HH 2O01H 3K5BA 1DNYA 3L74E 1JY2N 3AEFC 1GL2A 1SQQJ 2DNWA 1IFIA 1Y8AA 4M3LA 1YJNP 4GIFA 2XNDH 1BGYG 4PV1B 2N5IA 1GL2C 4C7NA 1VQMP 5APVA 3H1KG 5JPAA 4W80A 2N50A 4XFYA 2ZAEB 2ZT9C 2OYOA 3O6QA 5DJUB 1KV4A 3CX5H 3W67A 2A06G 1SQPK 3BCCE 2CNRA 2R5BA 3H1IE 3RGUA 2Q1KA 1UIIA 1BAJA 1LTAC 2QM8A 3PRJA 3BASA 3LMOA 4KJMA 2OYHC 4BPHA 3KPEA 1GZLA 5APQA 2KOSA 1VQ6P 4COPA 3I55P 1CI6A 1KFNA 1LWUA 1IFDA 2JJLA 1NTMD 2IBZE 1K05A 1L0ND 4HKZH 1SQQK 4UHPB 1NTKG 5CBNA 3L73G 1Y47A 4WY4B 2R5DA 3M0DC 2HG5D 4O9BA 2CPBA 4IOIH 5KJ7A 4PD4E 1SQPD 3GHGA 3I56P 5E79E 3G1IA 4IZ6A 2EIAA 3WUUA 2JYLA 2I8DA 3M0AA 4YXDC 4YXWH 2QJPB 5KJ7C 1SQXE 1IFMA 1OFCX 2B87B 2B89A 2VSQA 2Y9YA 1BE3D 5F2KA 1L0LK 4BPGA 1AJYA 2K9JA 3T97B 5KP6B 3G26A 1NU1K 4U0EA 2IDBA 1JCDA 1L0NK 1SVFA 4UB6E 3L73E 3N7NA 4QMAA 2IFNA 4U3FJ 2K0DX 3USSA 2FFDA 1J1EB 1HJBA 2LF4A 2WT7B 2H8PD 2KGDA 3Q5SA 2LTEA 4JQ0D 3H1IJ 3WMM0 3EFFK 1N2DC 1KQSO 3FGAD 1T3UA 1PEQA 3H1HG 3CX5E 4D6TD 4PV1D 5BU5A 1SLQA 3HTKB 2A45G 3H1JJ 3AEAC 3FWNA 3JC22 5AVUB 2XDJA 5APSA 1ZLLA 2FAEA 1U7JA 2JEEA 4OGQD 2OYHB 2QJKB 1GXGA 2A06E 1NAYA 5APXA 3GMAA 1K04A 3S4RA 2WSFJ 1J1EC 1NU1J 2WSEH 4EYYQ 2XV6A 1RF0A 4ZMDA 1FDOA 1NTKD 3A0BE 4UB8H 3CCQP 3HE5B 4ASWA 4PD4I 3SFEC 1OR5A 3M0DA 1N7SA 1WT6A 4NEOA 1JY3O 2XZRA 2YMYA 2YXQB 2R44A 5AVQB 2PGDA 1T3JA 3M91A 1RE4A 1ZV8A 4WY4C 1SQXD 3HYBA 2CPSA 1H0TA 3ABVC 1GPJA 4TT3H 1Q7YQ 1MZ9A 2GZEA 4L76A 5AVZB 1FC2C 2OTJP 1R8EA 2NPSB 4HH2A 1LTSC 3Q5RA 3GHGC 5CMZA 2WSCH 1QVGO 4EI2A 1IFNA 5KP8B 1EZVI 2ZXEB 2VRSA 2I1KA 2FXOA 1JMMA 4GOFA 2M0BA 1PP9E 3PJSK 4IFFA 5CCHC 1JB0J 4D6TG 1JY3P 2C0XA 2GYKA 3CWBG 3RK3C 1K30A 4U0FA 4PJ0E 5B5EE 4H2WC 3Q20A 1EOQA 3G6EP 3HD7A 3NFQA 1R5LA 3B4SA 2FYUD 2L5GB 4L74A 3AE7C 1ZXGA 1Q82Q 1EDLA 5KAIE 5CCHD 5AVSB 2WSCJ 3L75D 5KAFE 2MKVA 2BCCD 5KLVG 3PP5A 1NOHA 1PGPA 3GLMA 1RF0C 2WSSH 3TGUG 1PP9J 5AW3B 3SWYA 2K1AA 2HPCA 3CE7A 3AEBC 1NTME 3E1RA 1J1DC 3DS4A 1JEKA 3Q5PA 2GDXA 2Q3IA 2O01J 1EZVG 1LP1B 2BEQD 2YXRB 1NGMB 3A3YB 2Q5UA 3CXHH 1KILE 2KS1B 2H7HA 1M90Q 2MVUA 2W8ZA 5KLVE 1GMJA 3GHGB 2JR8A 2AFEA 2R32A 1LWUC 2P67A 1VF5B 2ITAA 1N7SC 3H32A 4RO0A 2Y9ZA 3DS5A 3VP9A 4AYCA 2P9XA 4XROA 4BPFA 2M5AA 2N98A 1HWTC 4U3FE 4UB6H 2E75D 5KKZB 3L71G 1KYOD 2PAJA 1QGKB 4LGDE 2XZ0D 1L2PA 4U0DA 2BCCE 2EFJA 2O1KA 2ZYDA 3MD0A 1W2EA 3HE5A 3RG2A 2OTLP 1VQ8P 5CCGD 1BGYD 3DPHA 3N4XA 1KB9E 1M8OB 1XTCC 1OMIA 3SWFA 2E75C 1FJPA 1KFMA 1SQQG 2P7JA 3TNUB 2KG9A 2GDWA 4HKGA 1E79H 3MUDA 3H47A 1NKNA 2XXMA 1JY2O 2E74D 3CXHI 2YNYA 2L91A 3SSUA 2FACA 1SS1A 3B71A 1M56D 4ZNCA 1PPJE 4KHXA 1EQ7A 2D2CC 3M1MA 1RO2A 5HGMA 1N73A 1G1IA 4JYCA 3RBZA 3M06A 2K92A 1SQBE 2PFXA 1EDJA 3NMDA 1URQB 4DCKA 4D6TJ 1SQVD 2KK7A 3WU2H 1URQD 2FXPA 1GW4A 3Q3DA 2LOLA 3E7KA 1EDKA 1MUUA 3FWLA 4H0LC 3TK1A 4EIJA 2FFDB 1T6AA 1FZFA 3CXHD 1EDIA 4B86A 1AVYA 5B66H 4OGQC 3V2NA 3GZMA 1ZW0A 5AVVB 5CJ0A 1PGQA 3HE4B 1X3OA 2K0YA 2ZVOB 2JKVA 1VL2A 1AV1A 1HQBA 2W90A 3KZIH 1KMIZ 1KILD 5KAIH 1NTKJ 1RQUA 4OVNF 1S1CX 5EW5E 1OW6A 1NU1G 1X9VA 1R5SA 1BE3G 1HBWA 3V2RA 3H1LD 1L4AA 4UB8E 1LT9A 2N6ZA 1WMKA 3LRYA 2N1TD 2CG5B 3L73J 4PH1A 5DCKA 1L0LJ 1FU1A 1LWUB 1IFJA 1MFTA 2WSFH 3V2QA 1LTGC 3HD7B 2WSEJ 2POHA 1P84E 2ZYAA 2KOQA 2EHSA 3L75E 1EIAA 1H8AA 3LW5H 1NVOA 2FY8A 3II6A 3RK3E 4D6TE 1OWAA 2N1TC 4QKOA 1URQC 3G3ZA 2K9YA 2KZIA 1QVFO 2CK3H 3S9OA 1OW7A 3V6IA 3IF4A 2FKWB 4C7NB 2M8RA 2M3EA 2K3RA 1E6JP 4JBZA 1JOCA 2MF4A 2M5RA 1NTKE 3IAOA 2Y0CA 4RJTA 1Q81Q 2QVAA 3CCVP 5AVYB 1L0LG 3ZDMA 3KYQA 4TLFA 2NPSC 3QH9A 1LP1A 2RN0A 1PV3A 1DIPA 1NU1E 2E42A 2GZJA 1VQLP 4PD4D 3HRNA 1QL1A 3V4WA 3P8CD 3NXSA 4PD4H 4XRQA 2FYZA 1EMVA 3KXDA 4WBAA 2E5YA 1YTZI 1PEMA 4XA4A 1JM0A 1L4AC 1BGYJ 2WPQA 2MD9A 2P58A 3E1IA 4EOTA 5BS2A 1OVRA 3U1AA 3MGNA 4A7PA 3RK2C 4OH8B 3M9QA 3P8MC 2WPTA 2GUVA 2L0QA 2SPZA 2OGUA 2MR7A 2KG8A 2HR3A 4WY4D 1Q86Q 3H1KD 2W6JH 2P1JA 1YTZT 1E0HA 1Y9BA 1NTZG 1G2CB 1Z6MA 2A06D 2M8LA 1GDTA 2JDIH 3RK2D 3S1KA 1BCCJ 3OJAB 1OXZA 1M1JA 1E5WA 2A45I 1KYOE 2Z45A 3CPWO 1K73Q 1HH0A 3CLQA 2BCCG 2PEIA 1YIJP 2KIKA 3CL3D 1AUMA 4I1LA 1IZNB 4BRYB 1ZP0C 3L74D 1VQPP 1L0LD 2OARA 1URQA 2V7QH 4PJ0H 3MUDC 1VF5C 3FXDA 3O8ZA 2ZFCA 2JAZA 2OTKE 5KKZC 1BDDA 1KQGB 5KLVJ 3VRLC 5GTHH 3GG2A 1ZOYC 3D6YA 2Z5HA 1F80D 1YHQP 2L9FA 3L37A 1RH5B 5HGOA 1OZHA 2ZT9D 3OW2O 2KLVA 3WUTA 4W7ZA 1M1KQ 2Q6QA 4JF7A 2YKOA 3R4YA 4GDOA 4GR2A 1SFCA 4H0LD 2WWWA 2FYNC 3UIAA 1VHNA 1FJKA 4HYTB 1FDIA 1L0IA 3U43A 2GUSA 1SP4A 1H0TB 3NY7B 3IFMA 2KUBA 1IK9A 4Y99B 2YMKA 1Q90D
chains in the Genus database with same CATH topology
1RO2A 5HGMA 3HYBA 3RG6C 1YJ9P 5F2KA 1PEOA 5HGNA 2M8LA 1VQKP 3G1GA 3DTJA 1VQ7P 3G21A 1QVFO 3CCUP 3G26A 4GR6A 5F2NA 1Q7YQ 2M8NA 4WYMA 4U0EA 1A8OA 3HZQA 2OTJP 2XT1A 1M90Q 4M0IA 3CC4P 1W2BO 1E6JP 3G29A 2QEXP 1YJNP 1VQ9P 1D1DA 5F2OA 2QA4P 2PEQA 5HGLA 1RNIA 4XFZA 3CXCO 3G4SP 3NTEA 2JO0A 2LF4A 4XFXA 1Q81Q 1VQMP 2Z45A 1RO0A 3CPWO 1QVGO 3CC2P 1YITP 1K73Q 1S72P 3WBHA 2CWOA 1KC8Q 2M8PA 3DS5A 5JPAA 3CCVP 2PEIA 4IPYA 1KQSO 2PEMA 3CCRP 4XFYA 2KODA 1YIJP 1PEQA 1VQNP 2PEOA 3B5IA 1ZMBA 1AUMA 2L6EA 2P9XA 4PH0A 2BHVA 3H4EA 4XROA 1VQPP 2BQ1E 2OARA 3CCSP 3CCEP 1BAJA 1M74A 2EG5A 1YI2P 3P05A 4U0BA 2JYGA 3CMEP 3VRLC 1K30A 2ONTA 1VQLP 3DS0A 4U0FA 3DS2A 5I4TG 2Z46A 3Q20A 1A43A 3DS1A 1VQ6P 4COPA 1YHQP 1EOQA 1N8RQ 1YJWP 1PEUA 3G6EP 4XRQA 3I55P 3CCJP 4U0DA 3H0DA 2EFJA 5HGOA 1VQ5P 1PEMA 1M6EX 3G28A 3CD6P 3G0VA 3LRYA 4U0CA 3OW2O 1VQ8P 2OTLP 1K8AQ 1Q82Q 4PH1A 3MGEA 3CCMP 1M1KQ 3CC7P 5DCKA 3CMAP 2XV6A 4QNBA 3DPHA 5BS2A 4COCA 2PY8A 1QRJA 4GR2A 1KD1Q 3CCLP 1NJIQ 3CCQP 1VQ4P 2PENA 3I56P 5BS1A 1IUQA 3DS4A 2PEJA 2Z44A 1K9MQ 3H47A 3DS3A 3G1IA 1JJ2O 2XXMA 1EIAA 2EIAA 2JYLA 2BUOA 1VQOP 3E2DA 2E1MA 3G71P 1Q86Q 2PEKA 2DGYA 1M6NA 3M1MA 4U0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM P;  3CPW O;  1QVG O;  3CC2 P;  1VQL P;  1YIT P;  1YJ9 P;  1S72 P;  1K73 Q;  1KD1 Q;  3CCL P;  1KC8 Q;  3CCV P;  1NJI Q;  1VQK P;  3CCQ P;  1KQS O;  1VQ4 P;  1VQ7 P;  3CCR P;  1VQ6 P;  1YIJ P;  3I56 P;  1YHQ P;  1N8R Q;  3CCU P;  1YJW P;  1QVF O;  1Q7Y Q;  3G6E P;  1K9M Q;  1VQN P;  3I55 P;  3CCJ P;  1JJ2 O;  2OTJ P;  1VQ5 P;  1M90 Q;  1VQP P;  3CD6 P;  3CC4 P;  3CCS P;  1VQO P;  1W2B O;  2QEX P;  3G71 P;  1YJN P;  1Q86 Q;  1VQ9 P;  3OW2 O;  1VQ8 P;  3CCE P;  2OTL P;  1K8A Q;  2QA4 P;  1Q82 Q;  3CCM P;  3CXC O;  1YI2 P;  1M1K Q;  3G4S P;  3CC7 P;  3CMA P;  1Q81 Q;  3CME P; 
#chains in the Genus database with same CATH topology
 3H1K J;  3VOP A;  1HUC A;  2RMZ A;  2HPC B;  3TGU E;  3H1H D;  3DTJ A;  3AED C;  3G21 A;  2JBG A;  2JU2 A;  1OIP A;  1SFC B;  2B88 A;  4C7R A;  1A8O A;  1LGH B;  1RF1 C;  5L8R J;  1NTK K;  1KB9 H;  2AEM A;  2J58 A;  2ZYG A;  1FOS F;  1YQ3 C;  1AVO A;  1FDM A;  5HV8 A;  1RO0 A;  1RF1 A;  1NTM K;  1KC8 Q;  2M8P A;  2D2C D;  2PEM A;  1SQQ D;  2R3S A;  2DW3 A;  2E5T A;  5KLI B;  2FQ1 A;  3F89 A;  2OYH A;  5KAF H;  2WPR A;  4PV1 C;  4YPC A;  3I5C A;  1PPJ G;  3HUS C;  1TU3 F;  2E76 D;  1AYI A;  2XKM A;  1KQF B;  2KZJ A;  3WUV A;  2JP3 A;  4JPZ B;  1SQV G;  3U1C A;  3AE2 C;  3GKL C;  2MR8 A;  2YKP A;  3Q1M A;  2VLN A;  4DT0 A;  3CMA P;  2KGC A;  3B5N A;  3EFG A;  3C1L A;  3RL0 C;  4N78 E;  1NJI Q;  1J2J B;  3JSV C;  1IUQ A;  1K9M Q;  4H0L B;  2FFD C;  3BCC D;  1GTW A;  3R2P A;  1NTZ E;  5GTI E;  3AE5 C;  1ZRT D;  3M9B A;  5H2F E;  3L71 E;  2K93 A;  4Y28 J;  3RBX A;  5AVX B;  1OX3 A;  3LW5 J;  1VQK P;  1LTB C;  1VQ7 P;  2OQQ A;  2M8N A;  3RL0 D;  1ZME C;  3P8C E;  1KYO H;  3W68 A;  2QEX P;  1MKM A;  1PGJ A;  2JO0 A;  3PTZ A;  1QX8 A;  3TSI A;  3A2A A;  2CWO A;  1S9K E;  3CWB J;  2KOD A;  1LTJ A;  3D71 A;  3B8E B;  2WIT A;  2BQ1 E;  3L75 J;  2K37 A;  2Y0E A;  2WVR A;  2E76 C;  3HUS B;  1FZA A;  1DEE G;  1L0N J;  1HF9 A;  4I7Z C;  3P05 A;  5KLV D;  4L73 A;  2LXC B;  1NTM J;  3AEC C;  2KI7 B;  3ITK A;  5AVR B;  2GZF A;  3HUS A;  3H1H E;  1NAF A;  3DS1 A;  4WVZ A;  1U57 A;  1G1J A;  1S5L X;  2FYU E;  3SWK A;  2H43 A;  1SQX K;  1SQB J;  4N6J A;  1CEI A;  3CD6 P;  2NPS D;  1JCC A;  4H13 B;  1ZN5 A;  4H13 D;  4NPF X;  4QNB A;  2IFM A;  2NRG A;  1FZB A;  1EXJ A;  1M1J C;  3RK3 B;  1EC5 A;  2ZT9 B;  1VQ4 P;  3RK3 D;  5BS1 A;  2YO2 A;  1QEX A;  1BE3 J;  1Z56 A;  1L4A B;  1XTG B;  2BUO A;  1T2K C;  2KW2 A;  1SFC D;  2Z5I A;  3C9I A;  3G9R A;  1VDF A;  3PH0 A;  1M6N A;  3NTN A;  2JB0 A;  3FXE A;  1PL5 A;  1PP9 G;  4GKG A;  3CX5 D;  5K5G B;  1UNK A;  3L35 A;  5AW9 B;  4L75 A;  3L70 G;  1BSN A;  4M0I A;  2FQ0 A;  5KTB A;  4BXL A;  3CXC O;  2KXP B;  2Q9I A;  2NO8 A;  3NTE A;  3B5N D;  5AW7 B;  2IBZ G;  1JUN A;  5CCG A;  2C0W A;  2W83 C;  2X2B A;  4I2L C;  3VMY A;  1BE3 E;  5AW2 B;  5DJT B;  3OAK A;  1LTJ C;  1M74 A;  5EJD A;  1YI2 P;  2JO1 A;  2KLU A;  3H1I G;  1N7S D;  2AVA A;  1RF1 B;  3BRT B;  1FR2 A;  3H0D A;  2LIU A;  2FVE A;  4MN4 C;  4HB1 A;  4H13 C;  5AVT B;  5BU8 B;  3L71 J;  3L70 J;  4N3Y B;  1BCC E;  3TNU A;  4BWN A;  2A45 H;  4ZKP A;  3CCM P;  1FZC A;  2AEJ A;  2JWA A;  3U59 A;  4XFJ A;  4H44 B;  2IPP A;  1VF5 D;  1S9K D;  3TYY A;  1RE3 C;  4GT1 A;  5GTI H;  2JU1 A;  2N5H A;  4LC1 A;  4LLH A;  2YKQ A;  1LTJ B;  2FVF A;  4DOJ A;  3L74 G;  7CEI A;  2OYI A;  3AE6 C;  2PEK A;  4GOE A;  2DGY A;  1DD3 A;  1BXI A;  1GXH A;  4RKU J;  2ROQ A;  2VLP A;  2KOP A;  1AFO A;  2FQ2 A;  5KJ7 D;  3LID A;  2KNC B;  1PEO A;  2ZVN B;  2B9B A;  3L4F A;  1GU4 A;  1PP9 D;  1Q2N A;  2BAS A;  1P84 D;  2WMM A;  2HLO A;  2QA4 P;  2PEQ A;  1N7S B;  3L70 D;  4CA3 A;  2R3C A;  1NHL A;  1YIT P;  4JYB A;  4W7Y A;  5CCH A;  3H1L G;  2J59 M;  3H32 B;  1LJ2 A;  2H89 C;  1KZU B;  3CWB D;  3CI9 A;  1UJZ A;  1HTL C;  3H4E A;  2C9N Y;  2AEF A;  1YQ4 C;  3H1J G;  3GF3 A;  1ACP A;  1KIL C;  1S5L H;  2K0X A;  3BCC J;  3P32 A;  3VTP C;  2QNW A;  3JCU E;  3HTK A;  2RKL A;  1A43 A;  1GW3 A;  5E79 H;  3RL0 B;  3TGU J;  2QJK C;  1FE6 A;  1PEU A;  3IR9 A;  2RH0 A;  2I1J A;  3CCJ P;  3H1I D;  2W6B A;  1RQV A;  5CCG C;  3G28 A;  3G0V A;  3OA7 A;  4DJG A;  1JMB A;  4RES B;  4GOD A;  3VN0 A;  1OW8 A;  1S2E A;  2LR2 A;  3H6P A;  4H44 D;  2HOD B;  3GZL A;  3H25 A;  1PZQ A;  1YYC A;  3CXH E;  2FYU G;  2KP8 A;  1H89 A;  2O01 N;  2GDY A;  3C8V A;  2QIW A;  3DS3 A;  2IZ1 A;  3H1L J;  1RE3 A;  1VKU A;  1USD A;  3E2D A;  1KB9 I;  1QL2 A;  1NTM G;  2GA1 A;  3A0H E;  2KOR A;  2BCC J;  4U0A A;  1PPJ D;  5HGN A;  1DX7 A;  4KT0 J;  1FOS E;  4WY4 A;  5TJH A;  4Z1M H;  2XT1 A;  1M57 D;  2KYV A;  3CC4 P;  5CJ4 A;  3G29 A;  3L36 A;  1IFP A;  1LTT C;  5HGL A;  2LML A;  4N78 D;  1BGY E;  2AF8 A;  3KZI E;  4XFX A;  1KB9 D;  2QSI A;  3AEE C;  2GZG A;  3GJN A;  1S72 P;  2FXM A;  2Q3E A;  2OYI C;  2FBW C;  3L71 D;  1RE4 C;  5C39 A;  4F37 A;  2LXB A;  4PWV B;  1D7M A;  2BHV A;  3A0B H;  2MVV A;  4AUW A;  3CCS P;  3O6Q B;  2EHT A;  4I7Z B;  2KB7 P;  2K88 A;  3MHV A;  3MP7 B;  1A02 F;  3CME P;  2E75 B;  2ONT A;  3GW6 A;  2KWL A;  1DEB A;  3WU2 E;  1GK4 A;  2AXT H;  1GU5 A;  5AW1 B;  2KSJ A;  5I4T G;  1L0H A;  2Z46 A;  1JTH A;  3RL0 g;  2GM4 A;  5APY A;  3AE3 C;  5M1B A;  2AXT E;  2IYO A;  3H1L E;  3KHU A;  2N1T A;  3QWO C;  2VLQ A;  3TDK A;  1SQP E;  2FHS C;  1AQ5 A;  3CC7 P;  2KGE A;  1NTZ D;  1L4A D;  3EJB A;  2PY8 A;  1GL2 B;  1QRJ A;  2MY5 A;  1KD1 Q;  1JNM A;  1SQV E;  3AEG C;  2JWD A;  1IJD B;  2PEJ A;  4YTP C;  1KTM A;  2ERH A;  1N73 C;  1QLE D;  1JTH B;  2BEZ F;  1VQO P;  2E1M A;  4Y99 C;  1NYH A;  3MTU E;  4U3F G;  5HVC A;  3HD7 C;  4IL6 X;  1X79 B;  3RG6 C;  1GD2 E;  2CGQ A;  2Y0D A;  2LL8 A;  3AE8 C;  2FYN B;  1UIX A;  3H1H J;  4GR6 A;  1VPC A;  2PP6 A;  1SQP J;  1FZC B;  1AF8 A;  1D1D A;  3T97 A;  1VQ9 P;  1NTZ K;  2UWJ E;  5F2O A;  2HFE D;  3B5N B;  1RNI A;  2AXC A;  2KS1 A;  3L72 G;  1HVV A;  1FZE A;  3WBH A;  1GK6 A;  2N6Y A;  2WPV B;  1LT9 B;  1SQX J;  1N73 B;  3TF5 A;  2WT7 A;  1SQB K;  3LIE A;  2L6E A;  1USE A;  5AW0 B;  1HGZ A;  2KG6 A;  1KYO I;  4I6M C;  4NPE A;  3BVH A;  1KQL A;  2D2C B;  1NO4 A;  2P2U A;  1N7L A;  1A02 J;  3AE4 C;  3DS2 A;  3RK2 B;  2AFD A;  1N8R Q;  2Q7C A;  5B5E H;  3JCU H;  1VQ5 P;  4NPD A;  1M6E X;  1NU1 D;  4OWF A;  1RHZ B;  2W27 A;  1K8A Q;  3D70 A;  1IMQ A;  1FBM A;  1S4X A;  2N1T B;  1WRG A;  1NKZ B;  1CI6 B;  1U7M A;  4R4L A;  2KOO A;  3L70 E;  2WQY C;  1LT9 C;  1SQB D;  3AE9 C;  3KDP B;  2PEN A;  1T8Z A;  3VMZ A;  2Z44 A;  1KN7 A;  2YO3 A;  5BVZ A;  1HJ0 A;  1GL2 D;  5TIS H;  3CWB E;  1CW5 A;  2IYP A;  4MRT C;  3V2P A;  2WPS A;  2QJY B;  2O1J A;  1OVU A;  4U3F D;  3L75 G;  3G1G A;  1PFI A;  1JY3 N;  3CCU P;  1YBK A;  5AW6 B;  3HZQ A;  1DV5 A;  1AA0 A;  1AQT A;  2XV5 A;  3M9H A;  1ZNV A;  1W2B O;  3B5N C;  4K3A A;  2N9Y B;  4HJG H;  4R0M A;  2CQ8 A;  4XFZ A;  3G4S P;  2NPS A;  2JGP A;  3Q2Y A;  2E43 A;  2FYU K;  5APW A;  4IPY A;  3CX5 I;  1RY3 A;  1VQN P;  2GZI A;  3B5I A;  1ZMB A;  1EZV D;  4PH0 A;  2PNG A;  1NTZ J;  1G2C A;  3CCE P;  2EG5 A;  4XE5 B;  1J1D B;  1KIL B;  4H44 C;  4U0B A;  4IL6 H;  1NH4 A;  2YIU C;  2K2Q A;  1M7L A;  1LT1 A;  4CPG A;  3BCC G;  3PHL A;  2E74 C;  1M1J B;  3F5H A;  4K35 A;  2XU6 A;  2KR5 A;  4R4M A;  2L22 A;  1KLP A;  4DZO A;  2FAD A;  3H1K E;  1DD4 A;  3L72 E;  3AE1 C;  4PXH B;  1HGV A;  4WB4 A;  5EFW B;  3MGE A;  1T8K A;  1MFZ A;  1BCC G;  2QM7 A;  2FVA A;  2IX7 C;  1S3J A;  4IFM A;  2LIW A;  3B4Q A;  5CHX A;  1IO4 A;  3GF7 A;  1SQV J;  2K94 A;  5AW5 B;  5KLV K;  1P84 I;  1ZRT E;  4U7J A;  1SQB G;  1CSB A;  1X22 A;  3G71 P;  2E76 B;  3EJE A;  3HE4 A;  2QJY C;  3H1J D;  1BDC A;  4U0C A;  2FYU J;  2NZ2 A;  4H2X C;  1YJ9 P;  1OVV A;  1PIX A;  2E74 B;  5AW8 B;  2IBZ I;  1LTI C;  5APU A;  2QG4 A;  1FS0 E;  5F2N A;  1L0L E;  4WYM A;  1JO5 A;  1PGO A;  1FAV A;  2JQ4 A;  5KP7 B;  1BSH A;  2KSE A;  1W5C E;  4C46 A;  3CC2 P;  2XZ1 C;  2VLO A;  3SFD C;  2M3B A;  2KNC A;  1NWQ A;  3IN6 A;  1IC2 A;  2WZ7 A;  2O3J A;  2ZXX A;  1NQ4 A;  1SQX G;  2M5A B;  2YIU B;  4ZKU A;  3BAT A;  3PLN A;  2MJZ A;  2B87 A;  5AVW B;  2H88 C;  5CBO A;  3VMX A;  3L74 J;  4ASV A;  2XNX A;  2QJP C;  3VMA A;  4OGQ B;  1SQV K;  2V4H A;  2KOG A;  3EJD A;  3V5B A;  2ZJS E;  3MZW B;  4EDF A;  1BCC D;  2OYI B;  4IFD K;  2N9B A;  1EZV E;  1ZR2 A;  3A5T A;  1JJ2 O;  1LNQ A;  3EWK A;  2G3A A;  2IBZ D;  1T2K D;  2L4B A;  1X8Y A;  2QRX A;  1KOR A;  3VP8 A;  2P10 A;  1EXI A;  4AQR D;  1FZC C;  3VYI A;  2K5X A;  2J5U A;  2LKM A;  2WTY A;  5H2F H;  5TIS E;  3EQ2 A;  5AW4 B;  2QE7 H;  2LKI A;  3MIW A;  1IMP A;  3HD7 D;  3CCR P;  1IK7 A;  3TGU D;  2W6A A;  2PEO A;  3FX0 A;  1HY8 A;  1N86 A;  1FZG A;  3V4Q A;  1CZQ A;  2IZ0 A;  1X0T A;  3H1J E;  5APT A;  4WWI A;  2JYG A;  4BRY A;  2C9L Y;  1ZR4 A;  2K9J B;  3DS0 A;  2KGA A;  5CZD B;  3A7O A;  1DH3 A;  1YJW P;  1MV8 A;  1L0N G;  1SQQ E;  3L72 J;  3L73 D;  2LPK A;  1S5L E;  2Z4E A;  4IL6 E;  2V7Q J;  2HOD A;  3BRV B;  3D6Z A;  1SQP G;  4COC A;  3CCL P;  4DG9 A;  3L72 D;  1L0N E;  1P84 H;  1JY2 P;  3P7K A;  3KQG A;  5KLI C;  4H2Y C;  2HYN A;  1SFC C;  2PRR A;  5GTH E;  1KIL A;  2G8Y A;  1MZ8 A;  1H88 A;  5B66 E;  3A0H H;  2O01 H;  3K5B A;  1DNY A;  3L74 E;  1JY2 N;  3AEF C;  1GL2 A;  1SQQ J;  2DNW A;  1IFI A;  1Y8A A;  4M3L A;  1YJN P;  4GIF A;  2XND H;  1BGY G;  4PV1 B;  2N5I A;  1GL2 C;  4C7N A;  1VQM P;  5APV A;  3H1K G;  5JPA A;  4W80 A;  2N50 A;  4XFY A;  2ZAE B;  2ZT9 C;  2OYO A;  3O6Q A;  5DJU B;  1KV4 A;  3CX5 H;  3W67 A;  2A06 G;  1SQP K;  3BCC E;  2CNR A;  2R5B A;  3H1I E;  3RGU A;  2Q1K A;  1UII A;  1BAJ A;  1LTA C;  2QM8 A;  3PRJ A;  3BAS A;  3LMO A;  4KJM A;  2OYH C;  4BPH A;  3KPE A;  1GZL A;  5APQ A;  2KOS A;  1VQ6 P;  4COP A;  3I55 P;  1CI6 A;  1KFN A;  1LWU A;  1IFD A;  2JJL A;  1NTM D;  2IBZ E;  1K05 A;  1L0N D;  4HKZ H;  1SQQ K;  4UHP B;  1NTK G;  5CBN A;  3L73 G;  1Y47 A;  4WY4 B;  2R5D A;  3M0D C;  2HG5 D;  4O9B A;  2CPB A;  4IOI H;  5KJ7 A;  4PD4 E;  1SQP D;  3GHG A;  3I56 P;  5E79 E;  3G1I A;  4IZ6 A;  2EIA A;  3WUU A;  2JYL A;  2I8D A;  3M0A A;  4YXD C;  4YXW H;  2QJP B;  5KJ7 C;  1SQX E;  1IFM A;  1OFC X;  2B87 B;  2B89 A;  2VSQ A;  2Y9Y A;  1BE3 D;  5F2K A;  1L0L K;  4BPG A;  1AJY A;  2K9J A;  3T97 B;  5KP6 B;  3G26 A;  1NU1 K;  4U0E A;  2IDB A;  1JCD A;  1L0N K;  1SVF A;  4UB6 E;  3L73 E;  3N7N A;  4QMA A;  2IFN A;  4U3F J;  2K0D X;  3USS A;  2FFD A;  1J1E B;  1HJB A;  2LF4 A;  2WT7 B;  2H8P D;  2KGD A;  3Q5S A;  2LTE A;  4JQ0 D;  3H1I J;  3WMM 0;  3EFF K;  1N2D C;  1KQS O;  3FGA D;  1T3U A;  1PEQ A;  3H1H G;  3CX5 E;  4D6T D;  4PV1 D;  5BU5 A;  1SLQ A;  3HTK B;  2A45 G;  3H1J J;  3AEA C;  3FWN A;  3JC2 2;  5AVU B;  2XDJ A;  5APS A;  1ZLL A;  2FAE A;  1U7J A;  2JEE A;  4OGQ D;  2OYH B;  2QJK B;  1GXG A;  2A06 E;  1NAY A;  5APX A;  3GMA A;  1K04 A;  3S4R A;  2WSF J;  1J1E C;  1NU1 J;  2WSE H;  4EYY Q;  2XV6 A;  1RF0 A;  4ZMD A;  1FDO A;  1NTK D;  3A0B E;  4UB8 H;  3CCQ P;  3HE5 B;  4ASW A;  4PD4 I;  3SFE C;  1OR5 A;  3M0D A;  1N7S A;  1WT6 A;  4NEO A;  1JY3 O;  2XZR A;  2YMY A;  2YXQ B;  2R44 A;  5AVQ B;  2PGD A;  1T3J A;  3M91 A;  1RE4 A;  1ZV8 A;  4WY4 C;  1SQX D;  3HYB A;  2CPS A;  1H0T A;  3ABV C;  1GPJ A;  4TT3 H;  1Q7Y Q;  1MZ9 A;  2GZE A;  4L76 A;  5AVZ B;  1FC2 C;  2OTJ P;  1R8E A;  2NPS B;  4HH2 A;  1LTS C;  3Q5R A;  3GHG C;  5CMZ A;  2WSC H;  1QVG O;  4EI2 A;  1IFN A;  5KP8 B;  1EZV I;  2ZXE B;  2VRS A;  2I1K A;  2FXO A;  1JMM A;  4GOF A;  2M0B A;  1PP9 E;  3PJS K;  4IFF A;  5CCH C;  1JB0 J;  4D6T G;  1JY3 P;  2C0X A;  2GYK A;  3CWB G;  3RK3 C;  1K30 A;  4U0F A;  4PJ0 E;  5B5E E;  4H2W C;  3Q20 A;  1EOQ A;  3G6E P;  3HD7 A;  3NFQ A;  1R5L A;  3B4S A;  2FYU D;  2L5G B;  4L74 A;  3AE7 C;  1ZXG A;  1Q82 Q;  1EDL A;  5KAI E;  5CCH D;  5AVS B;  2WSC J;  3L75 D;  5KAF E;  2MKV A;  2BCC D;  5KLV G;  3PP5 A;  1NOH A;  1PGP A;  3GLM A;  1RF0 C;  2WSS H;  3TGU G;  1PP9 J;  5AW3 B;  3SWY A;  2K1A A;  2HPC A;  3CE7 A;  3AEB C;  1NTM E;  3E1R A;  1J1D C;  3DS4 A;  1JEK A;  3Q5P A;  2GDX A;  2Q3I A;  2O01 J;  1EZV G;  1LP1 B;  2BEQ D;  2YXR B;  1NGM B;  3A3Y B;  2Q5U A;  3CXH H;  1KIL E;  2KS1 B;  2H7H A;  1M90 Q;  2MVU A;  2W8Z A;  5KLV E;  1GMJ A;  3GHG B;  2JR8 A;  2AFE A;  2R32 A;  1LWU C;  2P67 A;  1VF5 B;  2ITA A;  1N7S C;  3H32 A;  4RO0 A;  2Y9Z A;  3DS5 A;  3VP9 A;  4AYC A;  2P9X A;  4XRO A;  4BPF A;  2M5A A;  2N98 A;  1HWT C;  4U3F E;  4UB6 H;  2E75 D;  5KKZ B;  3L71 G;  1KYO D;  2PAJ A;  1QGK B;  4LGD E;  2XZ0 D;  1L2P A;  4U0D A;  2BCC E;  2EFJ A;  2O1K A;  2ZYD A;  3MD0 A;  1W2E A;  3HE5 A;  3RG2 A;  2OTL P;  1VQ8 P;  5CCG D;  1BGY D;  3DPH A;  3N4X A;  1KB9 E;  1M8O B;  1XTC C;  1OMI A;  3SWF A;  2E75 C;  1FJP A;  1KFM A;  1SQQ G;  2P7J A;  3TNU B;  2KG9 A;  2GDW A;  4HKG A;  1E79 H;  3MUD A;  3H47 A;  1NKN A;  2XXM A;  1JY2 O;  2E74 D;  3CXH I;  2YNY A;  2L91 A;  3SSU A;  2FAC A;  1SS1 A;  3B71 A;  1M56 D;  4ZNC A;  1PPJ E;  4KHX A;  1EQ7 A;  2D2C C;  3M1M A;  1RO2 A;  5HGM A;  1N73 A;  1G1I A;  4JYC A;  3RBZ A;  3M06 A;  2K92 A;  1SQB E;  2PFX A;  1EDJ A;  3NMD A;  1URQ B;  4DCK A;  4D6T J;  1SQV D;  2KK7 A;  3WU2 H;  1URQ D;  2FXP A;  1GW4 A;  3Q3D A;  2LOL A;  3E7K A;  1EDK A;  1MUU A;  3FWL A;  4H0L C;  3TK1 A;  4EIJ A;  2FFD B;  1T6A A;  1FZF A;  3CXH D;  1EDI A;  4B86 A;  1AVY A;  5B66 H;  4OGQ C;  3V2N A;  3GZM A;  1ZW0 A;  5AVV B;  5CJ0 A;  1PGQ A;  3HE4 B;  1X3O A;  2K0Y A;  2ZVO B;  2JKV A;  1VL2 A;  1AV1 A;  1HQB A;  2W90 A;  3KZI H;  1KMI Z;  1KIL D;  5KAI H;  1NTK J;  1RQU A;  4OVN F;  1S1C X;  5EW5 E;  1OW6 A;  1NU1 G;  1X9V A;  1R5S A;  1BE3 G;  1HBW A;  3V2R A;  3H1L D;  1L4A A;  4UB8 E;  1LT9 A;  2N6Z A;  1WMK A;  3LRY A;  2N1T D;  2CG5 B;  3L73 J;  4PH1 A;  5DCK A;  1L0L J;  1FU1 A;  1LWU B;  1IFJ A;  1MFT A;  2WSF H;  3V2Q A;  1LTG C;  3HD7 B;  2WSE J;  2POH A;  1P84 E;  2ZYA A;  2KOQ A;  2EHS A;  3L75 E;  1EIA A;  1H8A A;  3LW5 H;  1NVO A;  2FY8 A;  3II6 A;  3RK3 E;  4D6T E;  1OWA A;  2N1T C;  4QKO A;  1URQ C;  3G3Z A;  2K9Y A;  2KZI A;  1QVF O;  2CK3 H;  3S9O A;  1OW7 A;  3V6I A;  3IF4 A;  2FKW B;  4C7N B;  2M8R A;  2M3E A;  2K3R A;  1E6J P;  4JBZ A;  1JOC A;  2MF4 A;  2M5R A;  1NTK E;  3IAO A;  2Y0C A;  4RJT A;  1Q81 Q;  2QVA A;  3CCV P;  5AVY B;  1L0L G;  3ZDM A;  3KYQ A;  4TLF A;  2NPS C;  3QH9 A;  1LP1 A;  2RN0 A;  1PV3 A;  1DIP A;  1NU1 E;  2E42 A;  2GZJ A;  1VQL P;  4PD4 D;  3HRN A;  1QL1 A;  3V4W A;  3P8C D;  3NXS A;  4PD4 H;  4XRQ A;  2FYZ A;  1EMV A;  3KXD A;  4WBA A;  2E5Y A;  1YTZ I;  1PEM A;  4XA4 A;  1JM0 A;  1L4A C;  1BGY J;  2WPQ A;  2MD9 A;  2P58 A;  3E1I A;  4EOT A;  5BS2 A;  1OVR A;  3U1A A;  3MGN A;  4A7P A;  3RK2 C;  4OH8 B;  3M9Q A;  3P8M C;  2WPT A;  2GUV A;  2L0Q A;  2SPZ A;  2OGU A;  2MR7 A;  2KG8 A;  2HR3 A;  4WY4 D;  1Q86 Q;  3H1K D;  2W6J H;  2P1J A;  1YTZ T;  1E0H A;  1Y9B A;  1NTZ G;  1G2C B;  1Z6M A;  2A06 D;  2M8L A;  1GDT A;  2JDI H;  3RK2 D;  3S1K A;  1BCC J;  3OJA B;  1OXZ A;  1M1J A;  1E5W A;  2A45 I;  1KYO E;  2Z45 A;  3CPW O;  1K73 Q;  1HH0 A;  3CLQ A;  2BCC G;  2PEI A;  1YIJ P;  2KIK A;  3CL3 D;  1AUM A;  4I1L A;  1IZN B;  4BRY B;  1ZP0 C;  3L74 D;  1VQP P;  1L0L D;  2OAR A;  1URQ A;  2V7Q H;  4PJ0 H;  3MUD C;  1VF5 C;  3FXD A;  3O8Z A;  2ZFC A;  2JAZ A;  2OTK E;  5KKZ C;  1BDD A;  1KQG B;  5KLV J;  3VRL C;  5GTH H;  3GG2 A;  1ZOY C;  3D6Y A;  2Z5H A;  1F80 D;  1YHQ P;  2L9F A;  3L37 A;  1RH5 B;  5HGO A;  1OZH A;  2ZT9 D;  3OW2 O;  2KLV A;  3WUT A;  4W7Z A;  1M1K Q;  2Q6Q A;  4JF7 A;  2YKO A;  3R4Y A;  4GDO A;  4GR2 A;  1SFC A;  4H0L D;  2WWW A;  2FYN C;  3UIA A;  1VHN A;  1FJK A;  4HYT B;  1FDI A;  1L0I A;  3U43 A;  2GUS A;  1SP4 A;  1H0T B;  3NY7 B;  3IFM A;  2KUB A;  1IK9 A;  4Y99 B;  2YMK A;  1Q90 D; 
#chains in the Genus database with same CATH homology
 1RO2 A;  5HGM A;  3HYB A;  3RG6 C;  1YJ9 P;  5F2K A;  1PEO A;  5HGN A;  2M8L A;  1VQK P;  3G1G A;  3DTJ A;  1VQ7 P;  3G21 A;  1QVF O;  3CCU P;  3G26 A;  4GR6 A;  5F2N A;  1Q7Y Q;  2M8N A;  4WYM A;  4U0E A;  1A8O A;  3HZQ A;  2OTJ P;  2XT1 A;  1M90 Q;  4M0I A;  3CC4 P;  1W2B O;  1E6J P;  3G29 A;  2QEX P;  1YJN P;  1VQ9 P;  1D1D A;  5F2O A;  2QA4 P;  2PEQ A;  5HGL A;  1RNI A;  4XFZ A;  3CXC O;  3G4S P;  3NTE A;  2JO0 A;  2LF4 A;  4XFX A;  1Q81 Q;  1VQM P;  2Z45 A;  1RO0 A;  3CPW O;  1QVG O;  3CC2 P;  1YIT P;  1K73 Q;  1S72 P;  3WBH A;  2CWO A;  1KC8 Q;  2M8P A;  3DS5 A;  5JPA A;  3CCV P;  2PEI A;  4IPY A;  1KQS O;  2PEM A;  3CCR P;  4XFY A;  2KOD A;  1YIJ P;  1PEQ A;  1VQN P;  2PEO A;  3B5I A;  1ZMB A;  1AUM A;  2L6E A;  2P9X A;  4PH0 A;  2BHV A;  3H4E A;  4XRO A;  1VQP P;  2BQ1 E;  2OAR A;  3CCS P;  3CCE P;  1BAJ A;  1M74 A;  2EG5 A;  1YI2 P;  3P05 A;  4U0B A;  2JYG A;  3CME P;  3VRL C;  1K30 A;  2ONT A;  1VQL P;  3DS0 A;  4U0F A;  3DS2 A;  5I4T G;  2Z46 A;  3Q20 A;  1A43 A;  3DS1 A;  1VQ6 P;  4COP A;  1YHQ P;  1EOQ A;  1N8R Q;  1YJW P;  1PEU A;  3G6E P;  4XRQ A;  3I55 P;  3CCJ P;  4U0D A;  3H0D A;  2EFJ A;  5HGO A;  1VQ5 P;  1PEM A;  1M6E X;  3G28 A;  3CD6 P;  3G0V A;  3LRY A;  4U0C A;  3OW2 O;  1VQ8 P;  2OTL P;  1K8A Q;  1Q82 Q;  4PH1 A;  3MGE A;  3CCM P;  1M1K Q;  3CC7 P;  5DCK A;  3CMA P;  2XV6 A;  4QNB A;  3DPH A;  5BS2 A;  4COC A;  2PY8 A;  1QRJ A;  4GR2 A;  1KD1 Q;  3CCL P;  1NJI Q;  3CCQ P;  1VQ4 P;  2PEN A;  3I56 P;  5BS1 A;  1IUQ A;  3DS4 A;  2PEJ A;  2Z44 A;  1K9M Q;  3H47 A;  3DS3 A;  3G1I A;  1JJ2 O;  2XXM A;  1EIA A;  2EIA A;  2JYL A;  2BUO A;  1VQO P;  3E2D A;  2E1M A;  3G71 P;  1Q86 Q;  2PEK A;  2DGY A;  1M6N A;  3M1M A;  4U0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...