3CCJP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 42
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ccjP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ccjP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ccjP02
1K73Q 3I55P 1Q81Q 1YHQP 3CC7P 3CCJP 1JJ2O 1VQ5P 1Q86Q 3CPWO 1YJ9P 1YJNP 3CMAP 1W2BO 3CCEP 3CCLP 1S72P 1YJWP 3CCRP 3CCSP 3CC4P 1Q82Q 1VQ7P 1K8AQ 1YI2P 3G6EP 3CCUP 3G71P 1VQNP 1VQOP 1K9MQ 2OTLP 1KD1Q 1M1KQ 1YITP 1VQ8P 1VQ9P 1NJIQ 1VQ6P 3CD6P 3CCQP 1VQLP 1VQMP 1KC8Q 1N8RQ 1VQKP 2QA4P 1VQPP 3G4SP 1QVGO 2QEXP 1Q7YQ 3CC2P 3OW2O 3CCVP 3I56P 1YIJP 1KQSO 1QVFO 1M90Q 3CMEP 2OTJP 3CXCO 1VQ4P 3CCMP
chains in the Genus database with same CATH superfamily
1X0TA 3A0BH 5APWA 3H1ID 3KXDA 3R2PA 1BE3D 1QLED 2Z5IA 3G1IA 3NTEA 1ZLLA 3T97B 2H43A 2EG5A 1IFDA 4HB1A 2VLPA 3CWBJ 2PNGA 2IBZG 2NZ2A 1VF5D 1AYIA 3TGUE 2M8LA 4TT3H 2EFJA 1IFPA 2WPVB 3MZWB 1BXIA 3SFEC 4GT1A 2N50A 3HUSA 1YJWP 2QNWA 4R0MA 2GZGA 5B66H 1FJKA 3PP5A 4KJMA 3M1MA 3AE5C 2ZVNB 4D6TE 1IFJA 1FZGA 2BEZF 2L4BA 3L72E 1SQVJ 3CMEP 2PEIA 3DS3A 1FZCB 1GXHA 1KILD 1SQQE 2ZFCA 5CCHC 4NEOA 3G6EP 4LLHA 1NTZE 3WMM0 2HPCA 2OGUA 3GHGB 2X2BA 4WB4A 1NWQA 3D71A 2HFED 1AF8A 1PP9D 3PLNA 3DS5A 2QJYB 1QVFO 5EFWB 4QMAA 2C9NY 2K92A 2FKWB 3H1JJ 4XFZA 5E79H 1EMVA 3L70J 3A7OA 1SP4A 1SQQD 1K9MQ 3CX5I 1BGYD 3G9RA 3P8MC 1L4AD 2W6JH 1CEIA 1JY3N 1GL2C 5HGLA 1WMKA 2CWOA 5APUA 1FS0E 1SQPG 2MR7A 2QIWA 3Q20A 1YHQP 3PHLA 1D7MA 1M74A 3HRNA 2E5YA 4K35A 2N6ZA 3FXEA 1K05A 1T3JA 5AVUB 1RE4C 2KGAA 2ZJSE 2R32A 3E7KA 4PV1C 5M1BA 4H44D 1YJNP 3M06A 2JDIH 2OYHB 2LOLA 2M3EA 3V2PA 1EZVI 2XV5A 2A06E 1ZMEC 1G2CB 3GG2A 1KILB 1XTGB 3GHGC 1PPJE 4H0LC 3FWLA 2NPSD 2Q7CA 1D1DA 2IYOA 2HPCB 4U0FA 1DX7A 2W83C 3W67A 5KJ7C 4NPFX 5C39A 1FOSF 1YTZI 2KNCA 3GW6A 3L71J 1SVFA 2K37A 3M9HA 4JPZB 1N7SB 1VQOP 1PEUA 1KQFB 1SQXG 1GD2E 3MIWA 1ZR4A 2KG9A 1DNYA 2N1TC 5KAFH 2NRGA 1NTMJ 2PEKA 3MGNA 1K73Q 1FZFA 3L35A 5KTBA 1EIAA 2R5BA 2C0WA 4EDFA 2AFEA 1LT9C 2WT7B 1AUMA 2WSEJ 4XE5B 1BDDA 5I4TG 3CXHI 4WYMA 1JM0A 1NKNA 3KQGA 4IPYA 2FYUD 4M3LA 3WBHA 1QL2A 1RQUA 2HR3A 3M0DA 4LGDE 3OA7A 2OARA 4L73A 3CCMP 2FAEA 4CPGA 3NXSA 3G0VA 2FACA 1KILC 4IFMA 3P8CE 2JYLA 2VSQA 2Q3IA 1S5LX 1KN7A 2WT7A 2XNDH 1IC2A 2FQ0A 2B87B 3TGUJ 1NU1D 2OTJP 1IZNB 4I7ZB 3VP9A 1NH4A 3H1LG 3RG6C 4H2YC 5KLVG 1DIPA 4L74A 3B71A 3GHGA 1RY3A 5TJHA 3H25A 4COPA 3ABVC 2L91A 2PRRA 1JY2N 3KZIH 3Q3DA 2O01H 3GF7A 2IZ1A 3H32B 4U0EA 4JF7A 3HUSC 1PEQA 2GDWA 2LR2A 2GUVA 1IFNA 2O1KA 4PH0A 2P9XA 3H1IE 3L73D 2A45I 1RF0C 1NTMK 3CE7A 3P32A 1AVYA 2ZVOB 1RE3C 1X8YA 1LWUB 3B4QA 4C7RA 1L0HA 3O6QB 3RL0C 1KLPA 1A02J 3BCCD 2KOGA 2Y9YA 1S1CX 1SFCA 1BCCJ 2PAJA 2JWAA 2GYKA 2AEFA 2Q6QA 2AXTE 1YTZT 4IL6X 1KB9D 5KLIB 1URQC 4Y99C 5H2FE 1PV3A 2KSJA 4AYCA 5CCGD 3HYBA 5KAIH 1SQBG 2EHSA 1KYOD 2LL8A 1L0LJ 2PEOA 3IFMA 2RMZA 2L6EA 1SQVG 1NTKD 1VQLP 1NU1G 1NYHA 3JC22 2HODA 1OW6A 1BGYJ 5CCHA 1FDMA 3L36A 2DGYA 2KWLA 3VMZA 2AXCA 3L75D 2N1TB 1P84E 1GU5A 2FVFA 1PP9J 1QL1A 5K5GB 1VQ9P 1NJIQ 2P7JA 4JBZA 1SQPD 2A06D 4RESB 3RG2A 1RF1A 1M1JA 2GUSA 1KFMA 1HJBA 2Z4EA 1HTLC 1W2EA 1HY8A 2HYNA 2QJPC 1PEOA 1H89A 1G1JA 1E6JP 1YITP 3V4QA 1GTWA 2H88C 2BUOA 2E75B 1LTJA 1PGQA 2WMMA 2LF4A 4PD4I 2RN0A 1DEEG 1OVVA 4I7ZC 1L2PA 5CMZA 2WSEH 1SS1A 1USDA 2KS1A 1LT9A 2Q3EA 3RK3C 5B66E 1BGYE 3B8EB 2ZYDA 2CK3H 2IBZE 2WSCJ 5HGMA 2A06G 1UNKA 1MZ9A 4YXDC 3NFQA 1VKUA 4ZMDA 4WY4B 1YYCA 3NMDA 2JO1A 3LRYA 2M8RA 1OFCX 1X9VA 2FQ2A 3H32A 2XT1A 5KLVE 3HUSB 4WY4D 3M9BA 2WVRA 4GOEA 1OVUA 4RJTA 3S4RA 2KYVA 4DJGA 1JY3P 4PD4E 2JAZA 1X3OA 2DNWA 4XROA 5KP7B 4OGQB 2YKPA 3W68A 1FBMA 1XTCC 1H0TB 5KKZB 1JTHA 3NTNA 1BE3G 5KJ7D 3AE9C 1Y47A 1LTSC 1N8RQ 1SQBK 2QJPB 1KYOI 2NO8A 5GTHE 2IBZD 3FWNA 1ZXGA 2SPZA 5AW8B 2HLOA 3G3ZA 2WSCH 2E75C 2K0DX 3L37A 3S9OA 1J2JB 3M91A 5KLIC 1IK7A 3MUDC 5AW6B 2E74C 4L76A 1QRJA 4IFDK 1FR2A 3HTKA 4DOJA 3Q5RA 1VF5C 2DW3A 1RH5B 2O01N 1JCCA 4D6TJ 1VHNA 2FYNC 2Q9IA 2XZRA 1OWAA 4NPDA 3P05A 4ZNCA 5AVQB 5AVWB 1USEA 2P58A 2V7QJ 4H13D 4GODA 1F80D 2JBGA 2ZXXA 2YO3A 1NO4A 2N6YA 3L70E 1QX8A 3CWBG 1GL2A 3NY7B 1L0IA 1VDFA 2PEQA 1SFCD 2N5HA 1OZHA 4RO0A 3A3YB 3L75E 4OGQC 5APVA 3GMAA 1N86A 4PD4D 1EXIA 1SQXK 3KDPB 3F89A 1Q81Q 3GJNA 1JCDA 4PXHB 1P84I 1M8OB 3E1RA 3SWYA 3AEFC 3B5NA 1Z56A 1L0NE 1KQLA 5F2OA 3HD7C 1NHLA 2GZEA 2KGCA 1KB9E 4I6MC 4UB6E 2IPPA 2PY8A 1RF1B 1OXZA 3H1KJ 5APYA 2GM4A 4WVZA 1T2KD 3CX5H 1SQVK 2KW2A 3PH0A 4WY4C 2EIAA 2QA4P 1JMBA 2Y0CA 5TISE 3WUTA 4A7PA 2ROQA 3CCVP 2NPSC 1ZP0C 4BPFA 2MJZA 1CSBA 5AW7B 2OQQA 3TNUB 3V6IA 3CPWO 2MVUA 2KIKA 7CEIA 3VOPA 2W27A 2KODA 1AVOA 5APQA 3L71E 3U1CA 4I2LC 2AFDA 5AW0B 5EJDA 1LT1A 2C0XA 3WUVA 3EWKA 5L8RJ 1LGHB 3Q2YA 1VPCA 1SQVD 1J1EB 4BXLA 1IMQA 3L74D 1JO5A 1ZMBA 4HJGH 1EZVG 4UB8E 4F37A 3B5NB 3II6A 1VQ8P 1FZCA 3RBXA 1NTZG 5BS2A 4EIJA 1R8EA 1VQPP 3VP8A 1URQD 5CCHD 4MRTC 4UB8H 1T8ZA 1VF5B 3H1JD 1Y8AA 3MTUE 3DTJA 4BPGA 2Y0EA 1KQGB 3GLMA 2FYUK 4PH1A 2O1JA 5KP6B 3CCQP 2P10A 3AE6C 2QJKB 2VRSA 1LTIC 3BCCJ 1S2EA 1S3JA 3H1KE 3RK2B 4LC1A 4UB6H 2E75D 4N78D 3BRVB 3H1IG 1L4AC 3QWOC 3AECC 1NTKE 3RGUA 4XFXA 1EDIA 1NU1K 4C7NA 2MR8A 1EDJA 1GMJA 3L73E 1X79B 2J5UA 2KUBA 2V4HA 3PTZA 3L4FA 1N73B 2BQ1E 1SFCC 2AEJA 1M6EX 5HGNA 3H1JG 5BU8B 3H1HE 1H0TA 1WT6A 1NAFA 2Q1KA 2XZ0D 2ZT9B 4ZKUA 5AVSB 4H44C 3Q5PA 2KOQA 2YMKA 4IZ6A 1CI6B 2NPSA 1RF1C 2JR8A 3GKLC 1H88A 3CD6P 2KGEA 3TSIA 1DEBA 1JUNA 1VQKP 4OGQD 2W6BA 4QNBA 1NTKG 2G8YA 2R3SA 4H2XC 1JOCA 3CCEP 3G29A 2MVVA 4H13B 2Z44A 4R4MA 2FYUJ 4HYTB 4PJ0E 4PV1B 1NAYA 1PGPA 2KGDA 5KLVK 1KC8Q 2EHTA 3G1GA 1GZLA 1L4AB 1BDCA 4H0LD 2E42A 1U57A 1LTJB 5AW9B 3CX5D 2P67A 2GZIA 2YKOA 3D6ZA 1NTKK 1OW8A 2LMLA 2ZAEB 3KHUA 4W7YA 3AEAC 3SSUA 1JY2O 2K9YA 1M1JB 2Y9ZA 3G4SP 3TYYA 3BATA 2OYIA 4IL6H 2WPTA 2XNXA 2ZT9C 3L75J 3A0HE 3CL3D 4H44B 4M0IA 4GR6A 1ZOYC 1MFTA 1HGZA 1SQPK 1GL2B 2AXTH 5KLVD 2WWWA 2D2CD 3AEEC 2HG5D 3EFFK 5KP8B 4AUWA 4KT0J 5AVYB 3HZQA 3H1KD 3G21A 2QJKC 2HODB 3PJSK 1EZVD 3AEGC 2K5XA 1RO0A 5JPAA 2OTLP 2QM7A 1BCCD 5AVTB 4H13C 3DS4A 3MGEA 5CJ4A 3C8VA 3H1HJ 2YNYA 5AW2B 4N6JA 2L0QA 2KLVA 3AE7C 3C1LA 1YI2P 3GF3A 1M57D 3HD7D 2M8NA 2PP6A 1NVOA 3G28A 1N73C 2M3BA 1SFCB 1MFZA 4HKGA 3P8CD 4HH2A 3AE4C 3CC2P 1L0NG 2QM8A 3I56P 2BEQD 1EDKA 3HE4B 1JTHB 3F5HA 3L73G 5CBNA 4C7NB 3FGAD 3MD0A 1DD3A 2I1KA 3H1LJ 1NTZK 2XXMA 2BCCG 4U3FE 3E2DA 1FZAA 2K3RA 2FFDB 3V5BA 1FE6A 1BSHA 2Y0DA 1E79H 3LIDA 4ASVA 1IMPA 3TK1A 1Q7YQ 2E5TA 1N7SC 1AQTA 1KYOE 5BVZA 2P2UA 1KORA 1Q86Q 1T2KC 2UWJE 4MN4C 1BCCE 4TLFA 2M5RA 4XA4A 4N78E 3E1IA 1KYOH 3C9IA 1MUUA 1GK6A 1T6AA 3LW5J 4AQRD 4W7ZA 2K88A 3EFGA 1GU4A 3ZDMA 2KOSA 1NTZD 1CI6A 1VQ7P 5AW5B 2H89C 1LNQA 1FC2C 2JB0A 4QKOA 1LTJC 2FFDA 3D6YA 2O3JA 2B89A 3R4YA 3DS1A 2KK7A 1PFIA 1JEKA 2LIWA 3V2RA 2PFXA 2M5AB 3H6PA 1ZNVA 2J58A 2K1AA 1M1JC 4OVNF 4D6TD 2WQYC 4O9BA 4YPCA 5CCGC 1N73A 1NQ4A 1NTMD 4YTPC 1S9KD 3L74E 1MZ8A 3CWBD 3CX5E 1HUCA 1BE3J 2JEEA 2FFDC 3CXHH 4BRYA 4U0BA 3JSVC 2BCCD 4U3FJ 1KV4A 3UIAA 1UIXA 4JYBA 1LWUA 3H1HG 3BASA 1K30A 2Z5HA 1FZEA 4R4LA 1WRGA 2H8PD 2W90A 2LTEA 5DCKA 2B88A 5GTIH 2YXQB 3Q1MA 3VN0A 1UJZA 1URQA 2KZJA 3OAKA 4XRQA 2PENA 1BSNA 3G26A 1HQBA 1FOSE 1OIPA 1PPJG 3IAOA 4RKUJ 1LWUC 2OYHC 2R44A 2N1TD 1HBWA 2LXCB 2QEXP 1L0LK 3BVHA 3V2NA 1SQQK 4Y28J 3KYQA 2KZIA 1YJ9P 3MUDA 2N5IA 1S9KE 2CQ8A 1DV5A 3L75G 1SQPJ 2WITA 5KAIE 3M0AA 3VMXA 5AVXB 3BCCE 1PGJA 2WPSA 5DJTB 4BWNA 3OJAB 2BASA 5DJUB 1RNIA 1DD4A 1PGOA 2QG4A 2KP8A 2BCCJ 1AV1A 1IJDB 5AW3B 3I5CA 2N9BA 1TU3F 3V2QA 5E79E 2KI7B 1EZVE 1Q90D 1L0LD 3AEDC 2ERHA 2FHSC 3KPEA 4PD4H 1SQQJ 1L0LE 4UHPB 2FQ1A 4GOFA 1EOQA 4U0CA 3L70D 3ITKA 3LIEA 1KB9H 3CCSP 3CXHE 1ACPA 1M7LA 1VL2A 1GW4A 2IYPA 1RE4A 1ZN5A 3GZMA 3TNUA 5TISH 4BRYB 5GTHH 2WSFH 2FYZA 2XDJA 3A0BE 2A45H 2N98A 1SQXJ 2YKQA 1JJ2O 2XU6A 3TF5A 2JP3A 1E5WA 1Q82Q 1LTBC 2IFNA 2AEMA 1IUQA 1OVRA 1ZV8A 1CZQA 3L73J 1HH0A 2WPQA 3H0DA 1ZW0A 5APXA 2V7QH 1KQSO 1P84D 2W6AA 2YO2A 1OMIA 1RF0A 1BCCG 4JYCA 3D70A 3U43A 1PEMA 1MV8A 3B4SA 1SQBD 2ONTA 4WBAA 3AEBC 2YXRB 3A2AA 5HVCA 4WY4A 5F2KA 4GKGA 1SQBJ 2AF8A 1NTME 1OX3A 3RBZA 1HJ0A 1E0HA 2KSEA 2CPBA 3I55P 1IK9A 5APSA 1NU1J 1Y9BA 1YQ4C 2D2CB 5AW1B 4BPHA 1A8OA 2I1JA 4IFFA 4WWIA 1PP9E 3N4XA 1LT9B 4H2WC 2KS1B 4K3AA 4U0AA 2JO0A 5AVRB 5CHXA 5CBOA 1JY3O 3T97A 4GIFA 3CWBE 2ZXEB 1EQ7A 4B86A 3WU2H 2K94A 5AW4B 3H1HD 3VMAA 4IL6E 4OWFA 2LXBA 2AVAA 2MD9A 3A0HH 2J59M 3RL0B 1JNMA 4EI2A 1VQMP 1KILA 1QEXA 3MP7B 3RK3D 3EJEA 3LMOA 4C46A 5B5EE 3CXCO 1EDLA 2OYIC 3M0DC 4NPEA 1FJPA 2KLUA 3CCRP 2OYHA 1VQNP 3CCUP 2KORA 2L5GB 2IFMA 2I8DA 3TGUD 2FBWC 1RE3A 3AE3C 3IF4A 5B5EH 1VQ6P 2E76D 4DZOA 1KTMA 1AFOA 2FXMA 2FYNB 3BRTB 1FAVA 2FY8A 5APTA 2QE7H 3S1KA 3SWKA 2K9JB 1PIXA 3L71D 5AVVB 3DPHA 3AE2C 1NU1E 4GDOA 1IO4A 1K8AQ 1N7SA 1BE3E 1GPJA 1LTTC 3EJBA 4CA3A 2IDBA 1P84H 5CZDB 1KZUB 3CI9A 1R5SA 2LKIA 1RQVA 2CG5B 2KNCB 3KZIE 1DH3A 3CMAP 2Z45A 4PJ0H 2VLOA 1LP1B 3BCCG 4YXWH 2PEJA 3U1AA 1FU1A 2JYGA 1S5LE 3EJDA 1N7LA 2RKLA 3VTPC 1J1EC 1KFNA 5F2NA 4DT0A 2OTKE 3HE5B 2BCCE 4U3FG 1G2CA 1LJ2A 2XV6A 3HE4A 2IZ0A 1LP1A 2JQ4A 1BGYG 1S5LH 1URQB 4Y99B 3A5TA 1FDIA 2MKVA 4IOIH 3MHVA 1HVVA 1AQ5A 1KB9I 2KB7P 4EOTA 1K04A 1ZRTE 2L22A 2WSFJ 2VLQA 3RK3E 1S4XA 1AA0A 4ASWA 1W2BO 2CGQA 1FZBA 2ZT9D 2JJLA 2K2QA 4U0DA 4OH8B 3AE1C 2K9JA 1FDOA 1LTGC 2N9YB 2D2CC 2N1TA 3EQ2A 5BS1A 1QVGO 1JY2P 3OW2O 3CCLP 4GR2A 4DG9A 2R5DA 1GW3A 2FADA 2VLNA 3VRLC 3TDKA 2PGDA 3L74G 1G1IA 3L72D 5BU5A 3P7KA 3U59A 5KJ7A 5KKZC 4PWVB 3SFDC 3HD7A 1NTZJ 2FYUG 3B5NC 2KOPA 4EYYQ 1SQVE 1T3UA 1UIIA 2GDYA 2E76C 3H1KG 1NTKJ 2OYIB 4JQ0D 1M56D 2K0XA 1SQBE 1GK4A 1W5CE 3O6QA 1M6NA 4KHXA 2FVEA 1A43A 1J1DB 3RK3B 1N2DC 1SQQG 2JU2A 2XKMA 2POHA 1Z6MA 2OYOA 2YIUC 3DS0A 2CPSA 3SWFA 1M1KQ 2E1MA 3RK2C 4D6TG 4XFYA 3DS2A 3WU2E 3H1LD 1M90Q 3L74J 1R5LA 4PV1D 3CC7P 2IX7C 3CCJP 2LIUA 5EW5E 1SLQA 3IR9A 2R3CA 1ZRTD 4XFJA 2FYUE 1GXGA 4N3YB 5H2FH 2O01J 3L72J 2GZJA 3L71G 1KILE 1VQ4P 2GA1A 2GZFA 3Q5SA 1L0NJ 1NTMG 1S72P 4COCA 2B87A 2RH0A 3JCUE 2PEMA 3RL0g 2YMYA 3N7NA 3WUUA 3USSA 1KMIZ 1H8AA 3CLQA 4I1LA 2IBZI 1OR5A 2E74B 1QGKB 2E76B 3QH9A 2A45G 3H1LE 5CCGA 1YIJP 1CW5A 3HD7B 3H1JE 1PPJD 2ITAA 2JGPA 2MY5A 3H1IJ 3VMYA 2CNRA 3PRJA 2XZ1C 3VYIA 2Z46A 2ZYGA 1KD1Q 1YBKA 2M8PA 1U7MA 2KR5A 1JMMA 2L9FA 3H4EA 2Q5UA 4L75A 1HWTC 4Z1MH 5AVZB 2QRXA 1SQPE 1EXJA 3FX0A 3H47A 1ZR2A 1SQXD 2WTYA 1NOHA 2KXPB 4ZKPA 2JWDA 1FZCC 2FXPA 1RO2A 3B5ND 3B5IA 2MF4A 3M9QA 3O8ZA 1VQ5P 1L0LG 2KG6A 1PZQA 2E43A 4DCKA 5GTIE 1MKMA 1SQXE 3FXDA 1Q2NA 1HF9A 3L70G 2BHVA 2QVAA 2C9LY 5KLVJ 2H7HA 2WPRA 2P1JA 3HE5A 2FXOA 2WZ7A 3L72G 1T8KA 1NKZB 1L0NK 3LW5H 2FVAA 2ZYAA 2JU1A 1IFMA 1JB0J 1J1DC 1L4AA 4U7JA 3JCUH 1A02F 5HV8A 3IN6A 2B9BA 2YIUB 2LPKA 1YQ3C 3V4WA 5HGOA 1OW7A 3CXHD 5CJ0A 1IFIA 1GL2D 1N7SD 3TGUG 3HTKB 2M0BA 1LTAC 2W8ZA 2NPSB 2K93A 1PL5A 2QSIA 1GDTA 3GZLA 2KG8A 1EC5A 2K0YA 4W80A 3AE8C 1NGMB 1X22A 1L0ND 5KAFE 2JKVA 2E74D 2LKMA 3CC4P 3RL0D 1BAJA 3G71P 1RHZB 2M5AA 2QJYC 1AJYA 1U7JA 4H0LB 2GDXA 1HGVA 4HKZH 2KOOA 2G3AA 3K5BA 2WSSH 4U3FD 3RK2D 1PP9G
chains in the Genus database with same CATH topology
3Q20A 2LF4A 1K73Q 1YHQP 3CC7P 3CCJP 1JJ2O 1EIAA 1VQ5P 1Q86Q 3CPWO 1W2BO 1M74A 3CCRP 2BQ1E 1AUMA 1Q82Q 1IUQA 3G1IA 3NTEA 4U0DA 4M0IA 5I4TG 3P05A 4GR6A 3CCUP 1M6EX 5HGNA 4WYMA 2EG5A 4XRQA 2PENA 3G26A 2KODA 3H0DA 2BHVA 1VQ6P 4IPYA 3WBHA 5BS1A 2OARA 1QVGO 2QEXP 5HGMA 2M8LA 3HZQA 3OW2O 1KQSO 2EFJA 1VQ4P 3CCMP 3G21A 3G0VA 1YJ9P 1YJNP 3CCLP 3HYBA 4GR2A 4COCA 1YJWP 1S72P 2PEMA 1PEMA 1VQNP 3DPHA 1VQ7P 2PEQA 1K8AQ 1ZMBA 3VRLC 2ONTA 1RO0A 2JYLA 3LRYA 5JPAA 2PEOA 2OTLP 1VQ8P 2L6EA 5BS2A 3CD6P 3M1MA 1VQLP 2XT1A 3DS4A 3MGEA 5F2KA 1VQKP 1VQPP 3DS1A 4QNBA 5HGOA 1YIJP 3CMEP 1RNIA 2OTJP 2PEIA 2DGYA 3I55P 1Q81Q 3DS3A 3RG6C 3CCEP 3G29A 3CMAP 2Z45A 4XROA 1D1DA 2Z44A 3DTJA 2PEJA 4U0FA 1YI2P 3G6EP 2M8NA 1A8OA 4COPA 2Z46A 4PH1A 2JYGA 1KD1Q 5F2OA 2M8PA 3G28A 1NJIQ 1VQ9P 3CCQP 1KC8Q 1M6NA 1N8RQ 3G1GA 4U0AA 2JO0A 3H4EA 3DS5A 3CC2P 5F2NA 3I56P 1QVFO 2PY8A 1EOQA 1A43A 4U0CA 3H47A 2XV6A 4U0EA 4XFZA 4U0BA 3CCSP 3CC4P 1BAJA 3G71P 2XXMA 1PEQA 1VQOP 3E2DA 1PEOA 1PEUA 1K9MQ 3DS0A 4PH0A 1QRJA 2P9XA 1E6JP 1YITP 1M1KQ 2E1MA 4XFXA 2EIAA 1K30A 2BUOA 1VQMP 4XFYA 3DS2A 2QA4P 3G4SP 1RO2A 1Q7YQ 3B5IA 2PEKA 2CWOA 5HGLA 3CCVP 1M90Q 3CXCO 5DCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K73 Q;  3I55 P;  1Q81 Q;  1YHQ P;  3CC7 P;  3CCJ P;  1JJ2 O;  1VQ5 P;  1Q86 Q;  3CPW O;  1YJ9 P;  1YJN P;  3CMA P;  1W2B O;  3CCE P;  3CCL P;  1S72 P;  1YJW P;  3CCR P;  3CCS P;  3CC4 P;  1Q82 Q;  1VQ7 P;  1K8A Q;  1YI2 P;  3G6E P;  3CCU P;  3G71 P;  1VQN P;  1VQO P;  1K9M Q;  2OTL P;  1KD1 Q;  1M1K Q;  1YIT P;  1VQ8 P;  1VQ9 P;  1NJI Q;  1VQ6 P;  3CD6 P;  3CCQ P;  1VQL P;  1VQM P;  1KC8 Q;  1N8R Q;  1VQK P;  2QA4 P;  1VQP P;  3G4S P;  1QVG O;  2QEX P;  1Q7Y Q;  3CC2 P;  3OW2 O;  3CCV P;  3I56 P;  1YIJ P;  1KQS O;  1QVF O;  1M90 Q;  3CME P;  2OTJ P;  3CXC O;  1VQ4 P;  3CCM P; 
#chains in the Genus database with same CATH topology
 1X0T A;  3A0B H;  5APW A;  3H1I D;  3KXD A;  3R2P A;  1BE3 D;  1QLE D;  2Z5I A;  3G1I A;  3NTE A;  1ZLL A;  3T97 B;  2H43 A;  2EG5 A;  1IFD A;  4HB1 A;  2VLP A;  3CWB J;  2PNG A;  2IBZ G;  2NZ2 A;  1VF5 D;  1AYI A;  3TGU E;  2M8L A;  4TT3 H;  2EFJ A;  1IFP A;  2WPV B;  3MZW B;  1BXI A;  3SFE C;  4GT1 A;  2N50 A;  3HUS A;  1YJW P;  2QNW A;  4R0M A;  2GZG A;  5B66 H;  1FJK A;  3PP5 A;  4KJM A;  3M1M A;  3AE5 C;  2ZVN B;  4D6T E;  1IFJ A;  1FZG A;  2BEZ F;  2L4B A;  3L72 E;  1SQV J;  3CME P;  2PEI A;  3DS3 A;  1FZC B;  1GXH A;  1KIL D;  1SQQ E;  2ZFC A;  5CCH C;  4NEO A;  3G6E P;  4LLH A;  1NTZ E;  3WMM 0;  2HPC A;  2OGU A;  3GHG B;  2X2B A;  4WB4 A;  1NWQ A;  3D71 A;  2HFE D;  1AF8 A;  1PP9 D;  3PLN A;  3DS5 A;  2QJY B;  1QVF O;  5EFW B;  4QMA A;  2C9N Y;  2K92 A;  2FKW B;  3H1J J;  4XFZ A;  5E79 H;  1EMV A;  3L70 J;  3A7O A;  1SP4 A;  1SQQ D;  1K9M Q;  3CX5 I;  1BGY D;  3G9R A;  3P8M C;  1L4A D;  2W6J H;  1CEI A;  1JY3 N;  1GL2 C;  5HGL A;  1WMK A;  2CWO A;  5APU A;  1FS0 E;  1SQP G;  2MR7 A;  2QIW A;  3Q20 A;  1YHQ P;  3PHL A;  1D7M A;  1M74 A;  3HRN A;  2E5Y A;  4K35 A;  2N6Z A;  3FXE A;  1K05 A;  1T3J A;  5AVU B;  1RE4 C;  2KGA A;  2ZJS E;  2R32 A;  3E7K A;  4PV1 C;  5M1B A;  4H44 D;  1YJN P;  3M06 A;  2JDI H;  2OYH B;  2LOL A;  2M3E A;  3V2P A;  1EZV I;  2XV5 A;  2A06 E;  1ZME C;  1G2C B;  3GG2 A;  1KIL B;  1XTG B;  3GHG C;  1PPJ E;  4H0L C;  3FWL A;  2NPS D;  2Q7C A;  1D1D A;  2IYO A;  2HPC B;  4U0F A;  1DX7 A;  2W83 C;  3W67 A;  5KJ7 C;  4NPF X;  5C39 A;  1FOS F;  1YTZ I;  2KNC A;  3GW6 A;  3L71 J;  1SVF A;  2K37 A;  3M9H A;  4JPZ B;  1N7S B;  1VQO P;  1PEU A;  1KQF B;  1SQX G;  1GD2 E;  3MIW A;  1ZR4 A;  2KG9 A;  1DNY A;  2N1T C;  5KAF H;  2NRG A;  1NTM J;  2PEK A;  3MGN A;  1K73 Q;  1FZF A;  3L35 A;  5KTB A;  1EIA A;  2R5B A;  2C0W A;  4EDF A;  2AFE A;  1LT9 C;  2WT7 B;  1AUM A;  2WSE J;  4XE5 B;  1BDD A;  5I4T G;  3CXH I;  4WYM A;  1JM0 A;  1NKN A;  3KQG A;  4IPY A;  2FYU D;  4M3L A;  3WBH A;  1QL2 A;  1RQU A;  2HR3 A;  3M0D A;  4LGD E;  3OA7 A;  2OAR A;  4L73 A;  3CCM P;  2FAE A;  4CPG A;  3NXS A;  3G0V A;  2FAC A;  1KIL C;  4IFM A;  3P8C E;  2JYL A;  2VSQ A;  2Q3I A;  1S5L X;  1KN7 A;  2WT7 A;  2XND H;  1IC2 A;  2FQ0 A;  2B87 B;  3TGU J;  1NU1 D;  2OTJ P;  1IZN B;  4I7Z B;  3VP9 A;  1NH4 A;  3H1L G;  3RG6 C;  4H2Y C;  5KLV G;  1DIP A;  4L74 A;  3B71 A;  3GHG A;  1RY3 A;  5TJH A;  3H25 A;  4COP A;  3ABV C;  2L91 A;  2PRR A;  1JY2 N;  3KZI H;  3Q3D A;  2O01 H;  3GF7 A;  2IZ1 A;  3H32 B;  4U0E A;  4JF7 A;  3HUS C;  1PEQ A;  2GDW A;  2LR2 A;  2GUV A;  1IFN A;  2O1K A;  4PH0 A;  2P9X A;  3H1I E;  3L73 D;  2A45 I;  1RF0 C;  1NTM K;  3CE7 A;  3P32 A;  1AVY A;  2ZVO B;  1RE3 C;  1X8Y A;  1LWU B;  3B4Q A;  4C7R A;  1L0H A;  3O6Q B;  3RL0 C;  1KLP A;  1A02 J;  3BCC D;  2KOG A;  2Y9Y A;  1S1C X;  1SFC A;  1BCC J;  2PAJ A;  2JWA A;  2GYK A;  2AEF A;  2Q6Q A;  2AXT E;  1YTZ T;  4IL6 X;  1KB9 D;  5KLI B;  1URQ C;  4Y99 C;  5H2F E;  1PV3 A;  2KSJ A;  4AYC A;  5CCG D;  3HYB A;  5KAI H;  1SQB G;  2EHS A;  1KYO D;  2LL8 A;  1L0L J;  2PEO A;  3IFM A;  2RMZ A;  2L6E A;  1SQV G;  1NTK D;  1VQL P;  1NU1 G;  1NYH A;  3JC2 2;  2HOD A;  1OW6 A;  1BGY J;  5CCH A;  1FDM A;  3L36 A;  2DGY A;  2KWL A;  3VMZ A;  2AXC A;  3L75 D;  2N1T B;  1P84 E;  1GU5 A;  2FVF A;  1PP9 J;  1QL1 A;  5K5G B;  1VQ9 P;  1NJI Q;  2P7J A;  4JBZ A;  1SQP D;  2A06 D;  4RES B;  3RG2 A;  1RF1 A;  1M1J A;  2GUS A;  1KFM A;  1HJB A;  2Z4E A;  1HTL C;  1W2E A;  1HY8 A;  2HYN A;  2QJP C;  1PEO A;  1H89 A;  1G1J A;  1E6J P;  1YIT P;  3V4Q A;  1GTW A;  2H88 C;  2BUO A;  2E75 B;  1LTJ A;  1PGQ A;  2WMM A;  2LF4 A;  4PD4 I;  2RN0 A;  1DEE G;  1OVV A;  4I7Z C;  1L2P A;  5CMZ A;  2WSE H;  1SS1 A;  1USD A;  2KS1 A;  1LT9 A;  2Q3E A;  3RK3 C;  5B66 E;  1BGY E;  3B8E B;  2ZYD A;  2CK3 H;  2IBZ E;  2WSC J;  5HGM A;  2A06 G;  1UNK A;  1MZ9 A;  4YXD C;  3NFQ A;  1VKU A;  4ZMD A;  4WY4 B;  1YYC A;  3NMD A;  2JO1 A;  3LRY A;  2M8R A;  1OFC X;  1X9V A;  2FQ2 A;  3H32 A;  2XT1 A;  5KLV E;  3HUS B;  4WY4 D;  3M9B A;  2WVR A;  4GOE A;  1OVU A;  4RJT A;  3S4R A;  2KYV A;  4DJG A;  1JY3 P;  4PD4 E;  2JAZ A;  1X3O A;  2DNW A;  4XRO A;  5KP7 B;  4OGQ B;  2YKP A;  3W68 A;  1FBM A;  1XTC C;  1H0T B;  5KKZ B;  1JTH A;  3NTN A;  1BE3 G;  5KJ7 D;  3AE9 C;  1Y47 A;  1LTS C;  1N8R Q;  1SQB K;  2QJP B;  1KYO I;  2NO8 A;  5GTH E;  2IBZ D;  3FWN A;  1ZXG A;  2SPZ A;  5AW8 B;  2HLO A;  3G3Z A;  2WSC H;  2E75 C;  2K0D X;  3L37 A;  3S9O A;  1J2J B;  3M91 A;  5KLI C;  1IK7 A;  3MUD C;  5AW6 B;  2E74 C;  4L76 A;  1QRJ A;  4IFD K;  1FR2 A;  3HTK A;  4DOJ A;  3Q5R A;  1VF5 C;  2DW3 A;  1RH5 B;  2O01 N;  1JCC A;  4D6T J;  1VHN A;  2FYN C;  2Q9I A;  2XZR A;  1OWA A;  4NPD A;  3P05 A;  4ZNC A;  5AVQ B;  5AVW B;  1USE A;  2P58 A;  2V7Q J;  4H13 D;  4GOD A;  1F80 D;  2JBG A;  2ZXX A;  2YO3 A;  1NO4 A;  2N6Y A;  3L70 E;  1QX8 A;  3CWB G;  1GL2 A;  3NY7 B;  1L0I A;  1VDF A;  2PEQ A;  1SFC D;  2N5H A;  1OZH A;  4RO0 A;  3A3Y B;  3L75 E;  4OGQ C;  5APV A;  3GMA A;  1N86 A;  4PD4 D;  1EXI A;  1SQX K;  3KDP B;  3F89 A;  1Q81 Q;  3GJN A;  1JCD A;  4PXH B;  1P84 I;  1M8O B;  3E1R A;  3SWY A;  3AEF C;  3B5N A;  1Z56 A;  1L0N E;  1KQL A;  5F2O A;  3HD7 C;  1NHL A;  2GZE A;  2KGC A;  1KB9 E;  4I6M C;  4UB6 E;  2IPP A;  2PY8 A;  1RF1 B;  1OXZ A;  3H1K J;  5APY A;  2GM4 A;  4WVZ A;  1T2K D;  3CX5 H;  1SQV K;  2KW2 A;  3PH0 A;  4WY4 C;  2EIA A;  2QA4 P;  1JMB A;  2Y0C A;  5TIS E;  3WUT A;  4A7P A;  2ROQ A;  3CCV P;  2NPS C;  1ZP0 C;  4BPF A;  2MJZ A;  1CSB A;  5AW7 B;  2OQQ A;  3TNU B;  3V6I A;  3CPW O;  2MVU A;  2KIK A;  7CEI A;  3VOP A;  2W27 A;  2KOD A;  1AVO A;  5APQ A;  3L71 E;  3U1C A;  4I2L C;  2AFD A;  5AW0 B;  5EJD A;  1LT1 A;  2C0X A;  3WUV A;  3EWK A;  5L8R J;  1LGH B;  3Q2Y A;  1VPC A;  1SQV D;  1J1E B;  4BXL A;  1IMQ A;  3L74 D;  1JO5 A;  1ZMB A;  4HJG H;  1EZV G;  4UB8 E;  4F37 A;  3B5N B;  3II6 A;  1VQ8 P;  1FZC A;  3RBX A;  1NTZ G;  5BS2 A;  4EIJ A;  1R8E A;  1VQP P;  3VP8 A;  1URQ D;  5CCH D;  4MRT C;  4UB8 H;  1T8Z A;  1VF5 B;  3H1J D;  1Y8A A;  3MTU E;  3DTJ A;  4BPG A;  2Y0E A;  1KQG B;  3GLM A;  2FYU K;  4PH1 A;  2O1J A;  5KP6 B;  3CCQ P;  2P10 A;  3AE6 C;  2QJK B;  2VRS A;  1LTI C;  3BCC J;  1S2E A;  1S3J A;  3H1K E;  3RK2 B;  4LC1 A;  4UB6 H;  2E75 D;  4N78 D;  3BRV B;  3H1I G;  1L4A C;  3QWO C;  3AEC C;  1NTK E;  3RGU A;  4XFX A;  1EDI A;  1NU1 K;  4C7N A;  2MR8 A;  1EDJ A;  1GMJ A;  3L73 E;  1X79 B;  2J5U A;  2KUB A;  2V4H A;  3PTZ A;  3L4F A;  1N73 B;  2BQ1 E;  1SFC C;  2AEJ A;  1M6E X;  5HGN A;  3H1J G;  5BU8 B;  3H1H E;  1H0T A;  1WT6 A;  1NAF A;  2Q1K A;  2XZ0 D;  2ZT9 B;  4ZKU A;  5AVS B;  4H44 C;  3Q5P A;  2KOQ A;  2YMK A;  4IZ6 A;  1CI6 B;  2NPS A;  1RF1 C;  2JR8 A;  3GKL C;  1H88 A;  3CD6 P;  2KGE A;  3TSI A;  1DEB A;  1JUN A;  1VQK P;  4OGQ D;  2W6B A;  4QNB A;  1NTK G;  2G8Y A;  2R3S A;  4H2X C;  1JOC A;  3CCE P;  3G29 A;  2MVV A;  4H13 B;  2Z44 A;  4R4M A;  2FYU J;  4HYT B;  4PJ0 E;  4PV1 B;  1NAY A;  1PGP A;  2KGD A;  5KLV K;  1KC8 Q;  2EHT A;  3G1G A;  1GZL A;  1L4A B;  1BDC A;  4H0L D;  2E42 A;  1U57 A;  1LTJ B;  5AW9 B;  3CX5 D;  2P67 A;  2GZI A;  2YKO A;  3D6Z A;  1NTK K;  1OW8 A;  2LML A;  2ZAE B;  3KHU A;  4W7Y A;  3AEA C;  3SSU A;  1JY2 O;  2K9Y A;  1M1J B;  2Y9Z A;  3G4S P;  3TYY A;  3BAT A;  2OYI A;  4IL6 H;  2WPT A;  2XNX A;  2ZT9 C;  3L75 J;  3A0H E;  3CL3 D;  4H44 B;  4M0I A;  4GR6 A;  1ZOY C;  1MFT A;  1HGZ A;  1SQP K;  1GL2 B;  2AXT H;  5KLV D;  2WWW A;  2D2C D;  3AEE C;  2HG5 D;  3EFF K;  5KP8 B;  4AUW A;  4KT0 J;  5AVY B;  3HZQ A;  3H1K D;  3G21 A;  2QJK C;  2HOD B;  3PJS K;  1EZV D;  3AEG C;  2K5X A;  1RO0 A;  5JPA A;  2OTL P;  2QM7 A;  1BCC D;  5AVT B;  4H13 C;  3DS4 A;  3MGE A;  5CJ4 A;  3C8V A;  3H1H J;  2YNY A;  5AW2 B;  4N6J A;  2L0Q A;  2KLV A;  3AE7 C;  3C1L A;  1YI2 P;  3GF3 A;  1M57 D;  3HD7 D;  2M8N A;  2PP6 A;  1NVO A;  3G28 A;  1N73 C;  2M3B A;  1SFC B;  1MFZ A;  4HKG A;  3P8C D;  4HH2 A;  3AE4 C;  3CC2 P;  1L0N G;  2QM8 A;  3I56 P;  2BEQ D;  1EDK A;  3HE4 B;  1JTH B;  3F5H A;  3L73 G;  5CBN A;  4C7N B;  3FGA D;  3MD0 A;  1DD3 A;  2I1K A;  3H1L J;  1NTZ K;  2XXM A;  2BCC G;  4U3F E;  3E2D A;  1FZA A;  2K3R A;  2FFD B;  3V5B A;  1FE6 A;  1BSH A;  2Y0D A;  1E79 H;  3LID A;  4ASV A;  1IMP A;  3TK1 A;  1Q7Y Q;  2E5T A;  1N7S C;  1AQT A;  1KYO E;  5BVZ A;  2P2U A;  1KOR A;  1Q86 Q;  1T2K C;  2UWJ E;  4MN4 C;  1BCC E;  4TLF A;  2M5R A;  4XA4 A;  4N78 E;  3E1I A;  1KYO H;  3C9I A;  1MUU A;  1GK6 A;  1T6A A;  3LW5 J;  4AQR D;  4W7Z A;  2K88 A;  3EFG A;  1GU4 A;  3ZDM A;  2KOS A;  1NTZ D;  1CI6 A;  1VQ7 P;  5AW5 B;  2H89 C;  1LNQ A;  1FC2 C;  2JB0 A;  4QKO A;  1LTJ C;  2FFD A;  3D6Y A;  2O3J A;  2B89 A;  3R4Y A;  3DS1 A;  2KK7 A;  1PFI A;  1JEK A;  2LIW A;  3V2R A;  2PFX A;  2M5A B;  3H6P A;  1ZNV A;  2J58 A;  2K1A A;  1M1J C;  4OVN F;  4D6T D;  2WQY C;  4O9B A;  4YPC A;  5CCG C;  1N73 A;  1NQ4 A;  1NTM D;  4YTP C;  1S9K D;  3L74 E;  1MZ8 A;  3CWB D;  3CX5 E;  1HUC A;  1BE3 J;  2JEE A;  2FFD C;  3CXH H;  4BRY A;  4U0B A;  3JSV C;  2BCC D;  4U3F J;  1KV4 A;  3UIA A;  1UIX A;  4JYB A;  1LWU A;  3H1H G;  3BAS A;  1K30 A;  2Z5H A;  1FZE A;  4R4L A;  1WRG A;  2H8P D;  2W90 A;  2LTE A;  5DCK A;  2B88 A;  5GTI H;  2YXQ B;  3Q1M A;  3VN0 A;  1UJZ A;  1URQ A;  2KZJ A;  3OAK A;  4XRQ A;  2PEN A;  1BSN A;  3G26 A;  1HQB A;  1FOS E;  1OIP A;  1PPJ G;  3IAO A;  4RKU J;  1LWU C;  2OYH C;  2R44 A;  2N1T D;  1HBW A;  2LXC B;  2QEX P;  1L0L K;  3BVH A;  3V2N A;  1SQQ K;  4Y28 J;  3KYQ A;  2KZI A;  1YJ9 P;  3MUD A;  2N5I A;  1S9K E;  2CQ8 A;  1DV5 A;  3L75 G;  1SQP J;  2WIT A;  5KAI E;  3M0A A;  3VMX A;  5AVX B;  3BCC E;  1PGJ A;  2WPS A;  5DJT B;  4BWN A;  3OJA B;  2BAS A;  5DJU B;  1RNI A;  1DD4 A;  1PGO A;  2QG4 A;  2KP8 A;  2BCC J;  1AV1 A;  1IJD B;  5AW3 B;  3I5C A;  2N9B A;  1TU3 F;  3V2Q A;  5E79 E;  2KI7 B;  1EZV E;  1Q90 D;  1L0L D;  3AED C;  2ERH A;  2FHS C;  3KPE A;  4PD4 H;  1SQQ J;  1L0L E;  4UHP B;  2FQ1 A;  4GOF A;  1EOQ A;  4U0C A;  3L70 D;  3ITK A;  3LIE A;  1KB9 H;  3CCS P;  3CXH E;  1ACP A;  1M7L A;  1VL2 A;  1GW4 A;  2IYP A;  1RE4 A;  1ZN5 A;  3GZM A;  3TNU A;  5TIS H;  4BRY B;  5GTH H;  2WSF H;  2FYZ A;  2XDJ A;  3A0B E;  2A45 H;  2N98 A;  1SQX J;  2YKQ A;  1JJ2 O;  2XU6 A;  3TF5 A;  2JP3 A;  1E5W A;  1Q82 Q;  1LTB C;  2IFN A;  2AEM A;  1IUQ A;  1OVR A;  1ZV8 A;  1CZQ A;  3L73 J;  1HH0 A;  2WPQ A;  3H0D A;  1ZW0 A;  5APX A;  2V7Q H;  1KQS O;  1P84 D;  2W6A A;  2YO2 A;  1OMI A;  1RF0 A;  1BCC G;  4JYC A;  3D70 A;  3U43 A;  1PEM A;  1MV8 A;  3B4S A;  1SQB D;  2ONT A;  4WBA A;  3AEB C;  2YXR B;  3A2A A;  5HVC A;  4WY4 A;  5F2K A;  4GKG A;  1SQB J;  2AF8 A;  1NTM E;  1OX3 A;  3RBZ A;  1HJ0 A;  1E0H A;  2KSE A;  2CPB A;  3I55 P;  1IK9 A;  5APS A;  1NU1 J;  1Y9B A;  1YQ4 C;  2D2C B;  5AW1 B;  4BPH A;  1A8O A;  2I1J A;  4IFF A;  4WWI A;  1PP9 E;  3N4X A;  1LT9 B;  4H2W C;  2KS1 B;  4K3A A;  4U0A A;  2JO0 A;  5AVR B;  5CHX A;  5CBO A;  1JY3 O;  3T97 A;  4GIF A;  3CWB E;  2ZXE B;  1EQ7 A;  4B86 A;  3WU2 H;  2K94 A;  5AW4 B;  3H1H D;  3VMA A;  4IL6 E;  4OWF A;  2LXB A;  2AVA A;  2MD9 A;  3A0H H;  2J59 M;  3RL0 B;  1JNM A;  4EI2 A;  1VQM P;  1KIL A;  1QEX A;  3MP7 B;  3RK3 D;  3EJE A;  3LMO A;  4C46 A;  5B5E E;  3CXC O;  1EDL A;  2OYI C;  3M0D C;  4NPE A;  1FJP A;  2KLU A;  3CCR P;  2OYH A;  1VQN P;  3CCU P;  2KOR A;  2L5G B;  2IFM A;  2I8D A;  3TGU D;  2FBW C;  1RE3 A;  3AE3 C;  3IF4 A;  5B5E H;  1VQ6 P;  2E76 D;  4DZO A;  1KTM A;  1AFO A;  2FXM A;  2FYN B;  3BRT B;  1FAV A;  2FY8 A;  5APT A;  2QE7 H;  3S1K A;  3SWK A;  2K9J B;  1PIX A;  3L71 D;  5AVV B;  3DPH A;  3AE2 C;  1NU1 E;  4GDO A;  1IO4 A;  1K8A Q;  1N7S A;  1BE3 E;  1GPJ A;  1LTT C;  3EJB A;  4CA3 A;  2IDB A;  1P84 H;  5CZD B;  1KZU B;  3CI9 A;  1R5S A;  2LKI A;  1RQV A;  2CG5 B;  2KNC B;  3KZI E;  1DH3 A;  3CMA P;  2Z45 A;  4PJ0 H;  2VLO A;  1LP1 B;  3BCC G;  4YXW H;  2PEJ A;  3U1A A;  1FU1 A;  2JYG A;  1S5L E;  3EJD A;  1N7L A;  2RKL A;  3VTP C;  1J1E C;  1KFN A;  5F2N A;  4DT0 A;  2OTK E;  3HE5 B;  2BCC E;  4U3F G;  1G2C A;  1LJ2 A;  2XV6 A;  3HE4 A;  2IZ0 A;  1LP1 A;  2JQ4 A;  1BGY G;  1S5L H;  1URQ B;  4Y99 B;  3A5T A;  1FDI A;  2MKV A;  4IOI H;  3MHV A;  1HVV A;  1AQ5 A;  1KB9 I;  2KB7 P;  4EOT A;  1K04 A;  1ZRT E;  2L22 A;  2WSF J;  2VLQ A;  3RK3 E;  1S4X A;  1AA0 A;  4ASW A;  1W2B O;  2CGQ A;  1FZB A;  2ZT9 D;  2JJL A;  2K2Q A;  4U0D A;  4OH8 B;  3AE1 C;  2K9J A;  1FDO A;  1LTG C;  2N9Y B;  2D2C C;  2N1T A;  3EQ2 A;  5BS1 A;  1QVG O;  1JY2 P;  3OW2 O;  3CCL P;  4GR2 A;  4DG9 A;  2R5D A;  1GW3 A;  2FAD A;  2VLN A;  3VRL C;  3TDK A;  2PGD A;  3L74 G;  1G1I A;  3L72 D;  5BU5 A;  3P7K A;  3U59 A;  5KJ7 A;  5KKZ C;  4PWV B;  3SFD C;  3HD7 A;  1NTZ J;  2FYU G;  3B5N C;  2KOP A;  4EYY Q;  1SQV E;  1T3U A;  1UII A;  2GDY A;  2E76 C;  3H1K G;  1NTK J;  2OYI B;  4JQ0 D;  1M56 D;  2K0X A;  1SQB E;  1GK4 A;  1W5C E;  3O6Q A;  1M6N A;  4KHX A;  2FVE A;  1A43 A;  1J1D B;  3RK3 B;  1N2D C;  1SQQ G;  2JU2 A;  2XKM A;  2POH A;  1Z6M A;  2OYO A;  2YIU C;  3DS0 A;  2CPS A;  3SWF A;  1M1K Q;  2E1M A;  3RK2 C;  4D6T G;  4XFY A;  3DS2 A;  3WU2 E;  3H1L D;  1M90 Q;  3L74 J;  1R5L A;  4PV1 D;  3CC7 P;  2IX7 C;  3CCJ P;  2LIU A;  5EW5 E;  1SLQ A;  3IR9 A;  2R3C A;  1ZRT D;  4XFJ A;  2FYU E;  1GXG A;  4N3Y B;  5H2F H;  2O01 J;  3L72 J;  2GZJ A;  3L71 G;  1KIL E;  1VQ4 P;  2GA1 A;  2GZF A;  3Q5S A;  1L0N J;  1NTM G;  1S72 P;  4COC A;  2B87 A;  2RH0 A;  3JCU E;  2PEM A;  3RL0 g;  2YMY A;  3N7N A;  3WUU A;  3USS A;  1KMI Z;  1H8A A;  3CLQ A;  4I1L A;  2IBZ I;  1OR5 A;  2E74 B;  1QGK B;  2E76 B;  3QH9 A;  2A45 G;  3H1L E;  5CCG A;  1YIJ P;  1CW5 A;  3HD7 B;  3H1J E;  1PPJ D;  2ITA A;  2JGP A;  2MY5 A;  3H1I J;  3VMY A;  2CNR A;  3PRJ A;  2XZ1 C;  3VYI A;  2Z46 A;  2ZYG A;  1KD1 Q;  1YBK A;  2M8P A;  1U7M A;  2KR5 A;  1JMM A;  2L9F A;  3H4E A;  2Q5U A;  4L75 A;  1HWT C;  4Z1M H;  5AVZ B;  2QRX A;  1SQP E;  1EXJ A;  3FX0 A;  3H47 A;  1ZR2 A;  1SQX D;  2WTY A;  1NOH A;  2KXP B;  4ZKP A;  2JWD A;  1FZC C;  2FXP A;  1RO2 A;  3B5N D;  3B5I A;  2MF4 A;  3M9Q A;  3O8Z A;  1VQ5 P;  1L0L G;  2KG6 A;  1PZQ A;  2E43 A;  4DCK A;  5GTI E;  1MKM A;  1SQX E;  3FXD A;  1Q2N A;  1HF9 A;  3L70 G;  2BHV A;  2QVA A;  2C9L Y;  5KLV J;  2H7H A;  2WPR A;  2P1J A;  3HE5 A;  2FXO A;  2WZ7 A;  3L72 G;  1T8K A;  1NKZ B;  1L0N K;  3LW5 H;  2FVA A;  2ZYA A;  2JU1 A;  1IFM A;  1JB0 J;  1J1D C;  1L4A A;  4U7J A;  3JCU H;  1A02 F;  5HV8 A;  3IN6 A;  2B9B A;  2YIU B;  2LPK A;  1YQ3 C;  3V4W A;  5HGO A;  1OW7 A;  3CXH D;  5CJ0 A;  1IFI A;  1GL2 D;  1N7S D;  3TGU G;  3HTK B;  2M0B A;  1LTA C;  2W8Z A;  2NPS B;  2K93 A;  1PL5 A;  2QSI A;  1GDT A;  3GZL A;  2KG8 A;  1EC5 A;  2K0Y A;  4W80 A;  3AE8 C;  1NGM B;  1X22 A;  1L0N D;  5KAF E;  2JKV A;  2E74 D;  2LKM A;  3CC4 P;  3RL0 D;  1BAJ A;  3G71 P;  1RHZ B;  2M5A A;  2QJY C;  1AJY A;  1U7J A;  4H0L B;  2GDX A;  1HGV A;  4HKZ H;  2KOO A;  2G3A A;  3K5B A;  2WSS H;  4U3F D;  3RK2 D;  1PP9 G; 
#chains in the Genus database with same CATH homology
 3Q20 A;  2LF4 A;  1K73 Q;  1YHQ P;  3CC7 P;  3CCJ P;  1JJ2 O;  1EIA A;  1VQ5 P;  1Q86 Q;  3CPW O;  1W2B O;  1M74 A;  3CCR P;  2BQ1 E;  1AUM A;  1Q82 Q;  1IUQ A;  3G1I A;  3NTE A;  4U0D A;  4M0I A;  5I4T G;  3P05 A;  4GR6 A;  3CCU P;  1M6E X;  5HGN A;  4WYM A;  2EG5 A;  4XRQ A;  2PEN A;  3G26 A;  2KOD A;  3H0D A;  2BHV A;  1VQ6 P;  4IPY A;  3WBH A;  5BS1 A;  2OAR A;  1QVG O;  2QEX P;  5HGM A;  2M8L A;  3HZQ A;  3OW2 O;  1KQS O;  2EFJ A;  1VQ4 P;  3CCM P;  3G21 A;  3G0V A;  1YJ9 P;  1YJN P;  3CCL P;  3HYB A;  4GR2 A;  4COC A;  1YJW P;  1S72 P;  2PEM A;  1PEM A;  1VQN P;  3DPH A;  1VQ7 P;  2PEQ A;  1K8A Q;  1ZMB A;  3VRL C;  2ONT A;  1RO0 A;  2JYL A;  3LRY A;  5JPA A;  2PEO A;  2OTL P;  1VQ8 P;  2L6E A;  5BS2 A;  3CD6 P;  3M1M A;  1VQL P;  2XT1 A;  3DS4 A;  3MGE A;  5F2K A;  1VQK P;  1VQP P;  3DS1 A;  4QNB A;  5HGO A;  1YIJ P;  3CME P;  1RNI A;  2OTJ P;  2PEI A;  2DGY A;  3I55 P;  1Q81 Q;  3DS3 A;  3RG6 C;  3CCE P;  3G29 A;  3CMA P;  2Z45 A;  4XRO A;  1D1D A;  2Z44 A;  3DTJ A;  2PEJ A;  4U0F A;  1YI2 P;  3G6E P;  2M8N A;  1A8O A;  4COP A;  2Z46 A;  4PH1 A;  2JYG A;  1KD1 Q;  5F2O A;  2M8P A;  3G28 A;  1NJI Q;  1VQ9 P;  3CCQ P;  1KC8 Q;  1M6N A;  1N8R Q;  3G1G A;  4U0A A;  2JO0 A;  3H4E A;  3DS5 A;  3CC2 P;  5F2N A;  3I56 P;  1QVF O;  2PY8 A;  1EOQ A;  1A43 A;  4U0C A;  3H47 A;  2XV6 A;  4U0E A;  4XFZ A;  4U0B A;  3CCS P;  3CC4 P;  1BAJ A;  3G71 P;  2XXM A;  1PEQ A;  1VQO P;  3E2D A;  1PEO A;  1PEU A;  1K9M Q;  3DS0 A;  4PH0 A;  1QRJ A;  2P9X A;  1E6J P;  1YIT P;  1M1K Q;  2E1M A;  4XFX A;  2EIA A;  1K30 A;  2BUO A;  1VQM P;  4XFY A;  3DS2 A;  2QA4 P;  3G4S P;  1RO2 A;  1Q7Y Q;  3B5I A;  2PEK A;  2CWO A;  5HGL A;  3CCV P;  1M90 Q;  3CXC O;  5DCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...