3CCJP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 42
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ccjP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ccjP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ccjP02
1VQ9P 1YIJP 1YJWP 1VQPP 1M90Q 1N8RQ 3CCEP 1Q86Q 1KD1Q 2QEXP 1QVFO 1VQOP 3I55P 3CPWO 3CCVP 3CCRP 1VQ5P 3G6EP 3G71P 1Q82Q 1VQ8P 2OTJP 3CC4P 1VQ7P 3CC2P 1M1KQ 3CCUP 1YI2P 3CCSP 1K73Q 1S72P 1JJ2O 3CMEP 1K9MQ 1VQ6P 3CXCO 1Q7YQ 1QVGO 1VQNP 1YJNP 3CCQP 1K8AQ 1VQMP 1YJ9P 3CMAP 3CD6P 3CCJP 1Q81Q 1VQLP 1NJIQ 3I56P 3CCMP 1KQSO 1VQKP 3G4SP 1KC8Q 3CC7P 1W2BO 3OW2O 1YITP 3CCLP 1VQ4P 2QA4P 1YHQP 2OTLP
chains in the Genus database with same CATH superfamily
1EDIA 1Y8AA 1VQPP 2H88C 1M90Q 1RNIA 2EIAA 1L4AD 1JB0J 2BHVA 1SQBJ 4ASVA 3VP9A 3Q2YA 1IUQA 2XKMA 2BEZF 3HZQA 1G2CB 4H0LC 3EFFK 1YQ4C 3H1LJ 1D7MA 1NTMG 1SVFA 2A45I 3CXHH 3KZIE 3M9BA 2FKWB 1GPJA 2CPBA 2XV5A 3HE5A 1K05A 4U0BA 2HPCA 2J59M 4H0LD 2E74B 1WMKA 2HR3A 3CMEP 1J1DC 3II6A 1Z56A 2KR5A 4U0FA 1KQSO 1ZV8A 4XE5B 2ONTA 1IFMA 5KP7B 3SWKA 3RL0C 1KILE 2RN0A 1A8OA 2N98A 2FFDB 3KDPB 1VQOP 1LTJB 3T97B 1DNYA 1VKUA 1BE3D 4DZOA 1QL2A 3AEBC 1SQXD 3CCQP 4U7JA 3USSA 2A45H 4PV1D 1S5LH 3H1HJ 1IO4A 1IMQA 4MN4C 3L74E 2ZYAA 3SFDC 2ZAEB 1PP9G 3L75E 1QRJA 2N1TB 1J2JB 4H0LB 5AW5B 1W5CE 5APVA 3ITKA 1URQB 2N5IA 1LJ2A 1YIJP 2IBZD 1PPJE 2N9YB 2AXCA 5DJTB 1VQ7P 2M5AA 4GOFA 4EIJA 3P8CD 2PENA 4H2XC 2I8DA 1R5SA 1OVUA 1NGMB 2E42A 1VPCA 3CCJP 2LPKA 3I56P 3C9IA 2QJYC 3L36A 1U57A 3H47A 1ZW0A 3CE7A 3CWBJ 4EI2A 2QJYB 2Y0EA 2Q5UA 1OWAA 2XDJA 2FYUJ 4PD4D 2WPVB 3RK2B 4BPFA 1SQVK 4Y99C 5B5EE 2IBZI 2O01J 4W7ZA 2GA1A 4I6MC 2KOPA 3AE4C 3G9RA 3DPHA 2H8PD 1GDTA 2W6BA 3IF4A 1DX7A 2PEJA 1X8YA 4COPA 1S4XA 1SLQA 3CWBE 1VF5C 3L71E 2YMYA 2MF4A 1R5LA 5AW4B 5CBNA 2FYUD 3GHGA 2IBZE 3LMOA 1E79H 1BSNA 4YTPC 2MVUA 4PV1B 4DG9A 5APTA 1ZMBA 2JBGA 2L0QA 3A5TA 4EOTA 1CW5A 1KORA 2JQ4A 3PTZA 2KSEA 2JWAA 3RBXA 2WZ7A 1KC8Q 5KLVE 1LGHB 1LTIC 2KUBA 2QA4P 1M1JB 1KQFB 1BE3E 1OZHA 3L70J 1P84D 2ZT9C 1BSHA 3G3ZA 3P32A 2FQ1A 2O1KA 2N5HA 1NTMD 2B88A 1OR5A 4F37A 4DT0A 1UJZA 3AE7C 4ZNCA 2LIWA 1YITP 1JCCA 3L73J 4GKGA 2GZJA 1BGYD 2PEMA 5TJHA 5BS2A 1H0TB 4I2LC 3HYBA 5AVVB 1SFCB 4N6JA 2FYZA 1EXJA 1JEKA 3MP7B 3G0VA 1PFIA 3CMAP 3CCMP 2FFDC 2KOOA 1BE3G 5KJ7C 1Q2NA 2MR7A 3L75D 2OTLP 2E75D 4B86A 3M1MA 1NU1J 5CMZA 3CI9A 1L0LG 1RE3A 2E76C 1YI2P 1BGYE 2E74C 5BU5A 1URQC 1X79B 4C7NA 1RE4C 1S9KE 3L4FA 3S9OA 3GMAA 1KILB 2E1MA 3TDKA 3KHUA 5H2FE 1SQVE 3LW5H 2W6AA 1FDOA 5APYA 2LOLA 2IDBA 2O01H 3WUUA 1FOSE 2R3CA 1NTZG 1EQ7A 3JCUH 2P2UA 2R5DA 2KOQA 1N7SB 2HYNA 2WVRA 1LTAC 4WY4B 1GL2C 2FXPA 1M6EX 2M8NA 3NY7B 1S9KD 2M3EA 1PL5A 3EQ2A 2Y0DA 4Z1MH 3U1AA 2ZXEB 5KLIB 2KNCA 3MHVA 2EHTA 1ZXGA 1VQNP 3HE4A 1AQ5A 2JB0A 3KQGA 2BCCD 1QX8A 4OH8B 5CBOA 3H1LG 2GYKA 2GZGA 2Z5HA 1AF8A 3B4QA 1CZQA 1L4AC 1BAJA 2WPTA 2A45G 3RL0B 3G26A 4PD4I 1HGZA 1L0HA 5CCHA 1W2BO 1SQQJ 1HWTC 1CI6A 3FXEA 3GHGC 4JBZA 2PEKA 1VL2A 3Q20A 3FX0A 5EFWB 1JJ2O 1J1EB 2ITAA 2K94A 2IFNA 1IK7A 4XROA 1KYOD 2WT7B 3A3YB 5APWA 2AF8A 2PRRA 1FJPA 1P84E 4W7YA 3R2PA 4Y99B 5AVRB 3GG2A 2Q7CA 4Y28J 2GZIA 3GLMA 1GU5A 3G21A 5AVYB 2XZ1C 2WSFH 1OW8A 2QG4A 3B5IA 4WVZA 1L4AA 4WBAA 1SQPJ 2P1JA 3QWOC 5KTBA 2JAZA 2KLVA 4GR2A 1PPJG 1X9VA 1NTZK 2DNWA 2FYUE 2BCCJ 5BVZA 2ROQA 5HVCA 3R4YA 1RQVA 2MJZA 4IPYA 3WBHA 2FXOA 3SWFA 3HRNA 5APXA 2PEOA 3HE4B 1MKMA 4L76A 1GTWA 1GXHA 2H89C 2OARA 1PV3A 2FBWC 1SS1A 4HKZH 2NPSD 5APSA 2CGQA 3RL0D 2WPQA 4XFYA 1NAFA 1YYCA 3U59A 5CJ0A 3VMYA 3NFQA 1N86A 1RO0A 1PEUA 2KGCA 2OYIB 1ZLLA 2C9NY 3G71P 1M1KQ 2YO3A 2N1TD 3FXDA 2Z4EA 3KPEA 1RE3C 3HE5B 1LT9B 1AQTA 3MD0A 2BCCE 3EJDA 1FU1A 1FZGA 2FVFA 3L71G 2P9XA 2WT7A 3LIDA 2QNWA 1Q86Q 1SQQG 3TK1A 3I55P 3HUSB 1KN7A 2L5GB 1DIPA 1YQ3C 1N7SA 2UWJE 1RY3A 4K35A 2WSCH 1NHLA 3A0BE 3ZDMA 2VLQA 4H44B 5B66H 2YIUB 3NXSA 3P05A 1AVOA 3H1HE 1VQ5P 1GZLA 1NU1K 2OYIC 1L0LD 1XTCC 2KLUA 2YKQA 3TGUG 2QSIA 4TLFA 1LT9A 1KQLA 3H1IE 1EZVI 4LC1A 1S72P 2ZYDA 1KB9E 4H2WC 3HTKA 1GK6A 1DD4A 3GJNA 3H32A 1JY2N 3VTPC 4H13D 4UB6E 3CC4P 1OXZA 4JYBA 3LIEA 1FZBA 1PPJD 2L6EA 2J5UA 1EDJA 3H4EA 3H1KD 1NU1E 2Y9YA 4XA4A 2IX7C 2MD9A 1SQPK 3EWKA 4LLHA 3NTEA 2M5AB 2AXTH 4PJ0H 2KS1B 1LWUC 4H44D 5KAIE 5APUA 4HYTB 3M0AA 1YJ9P 4EYYQ 2BQ1E 1ZMEC 1OW6A 4QNBA 2YNYA 1NTME 2JDIH 2KZIA 5AVTB 2LL8A 2JGPA 4OGQB 2KOGA 4UHPB 2AFEA 3SWYA 3H1LD 3RK3D 3CX5H 2DW3A 2GUVA 4TT3H 1MFZA 4IFFA 4RKUJ 3EFGA 2KSJA 1NU1D 2JP3A 1GXGA 2CNRA 1N8RQ 1M74A 1JY2P 1KTMA 1SQVJ 2KGDA 2LIUA 2ZYGA 1L2PA 1SFCD 2PGDA 3GHGB 1Q7YQ 2LKMA 2ZT9B 1KILD 2IBZG 4ZKUA 3MUDC 2N6ZA 1OFCX 3CC7P 3PH0A 1DEEG 5EW5E 2OYIA 1ZR4A 1NTZD 1S2EA 2E75B 4EDFA 3B5NC 2J58A 1FJKA 5AW7B 5AW1B 1HVVA 3TSIA 1KMIZ 3RK3B 3VMAA 1X22A 5AVXB 3G4SP 2KZJA 1HBWA 1LT1A 2AEMA 2YO2A 3L74G 1GL2A 2N6YA 1LTJC 2XV6A 1NTZJ 4WYMA 3T97A 3Q5PA 3V6IA 5TISE 2RKLA 3Q5SA 2P7JA 2PFXA 4M0IA 2CWOA 3TNUA 4N3YB 3CX5E 3AEFC 4XFXA 2BASA 3AE1C 1PEOA 1URQD 4YXWH 1WRGA 1NTZE 1NKZB 3HUSC 1W2EA 2NZ2A 5DCKA 4U0CA 4DOJA 3MIWA 1VQMP 3OJAB 2HPCB 3H1KJ 2Z44A 1NTMJ 2R3SA 1E0HA 4GR6A 3SFEC 1BCCG 2JEEA 1M1JC 2JO1A 1VQ4P 1L0ND 1SQVG 2WSEH 1SQPD 1YJWP 1FZAA 2Y0CA 1RF0C 1YBKA 3DS2A 1OW7A 3CCUP 3RK2D 1K73Q 3UIAA 2QM8A 1NVOA 3V4WA 2E76B 4O9BA 5BU8B 1OMIA 3L74D 1NJIQ 1KILA 4NPEA 1EZVG 1RHZB 1KLPA 5KLVJ 2QJKC 3L71D 1RQUA 3CD6P 4UB6H 2G3AA 3A2AA 3CCEP 1KYOI 3N4XA 3L70E 5KKZB 2O01N 1ZOYC 3BCCD 3QH9A 2CQ8A 1JY3P 2Q3IA 3C1LA 3H1JG 4U3FD 2L9FA 3I5CA 1MZ9A 2K9JA 2ZJSE 4PXHB 1URQA 3L72J 4H2YC 1M57D 1VQ6P 3AE5C 2P58A 3IAOA 5AW9B 2MVVA 2LXBA 1PIXA 3P8CE 1IJDB 4R4MA 3PJSK 2XT1A 4JQ0D 1HJ0A 3D70A 5F2KA 1SQBG 3AEDC 1VQ8P 1S1CX 1LNQA 2K9YA 2SPZA 3HD7A 1NH4A 1R8EA 3A0HH 3H1JJ 3CWBD 2M5RA 1EMVA 1NYHA 4CPGA 4C46A 4AYCA 3DS1A 3BCCJ 3L37A 1JUNA 2Q6QA 1IMPA 1PGPA 2DGYA 3H1HG 2OYHB 3MUDA 4XFZA 3L74J 2JYLA 3NTNA 1G1IA 4U0DA 1K9MQ 2KI7B 1A02J 1AFOA 1SQQK 2LF4A 3W67A 1T8KA 1ACPA 4BWNA 2VRSA 1UIIA 4AQRD 3U43A 3DS5A 2HODB 3GKLC 3AEGC 3CCRP 1OVVA 1JOCA 2GDYA 4HKGA 4OVNF 2K0YA 4YXDC 4U0AA 3H1HD 1NTMK 3RGUA 1K8AQ 3TF5A 2FQ0A 2IPPA 2KS1A 2IZ1A 1SP4A 1CEIA 1M7LA 1Y9BA 1OVRA 3S1KA 2OYHA 2CG5B 4PH0A 1T6AA 2RMZA 5HGLA 2VLPA 1D1DA 4I1LA 4PD4E 2PNGA 3AECC 3D6ZA 1GMJA 2QM7A 4H13C 3S4RA 1FDMA 1L0LK 1IFJA 2GM4A 1YHQP 1RF1A 2CK3H 2JJLA 2POHA 1USDA 4H13B 1KFNA 1H89A 4HH2A 1E6JP 2K1AA 2QIWA 3P7KA 2XU6A 4NPDA 5EJDA 2M8LA 3H1ID 2KWLA 1N2DC 4GODA 3CXHI 4KHXA 5CCHD 2GZFA 1FZCB 1JMBA 2MR8A 4JF7A 2XXMA 2JYGA 1GU4A 1DEBA 2KXPB 2E43A 1ZP0C 3O8ZA 1T2KD 1PGJA 1PZQA 2W27A 1JO5A 3B5ND 2KNCB 1SQVD 1RF0A 4WY4D 2B9BA 1AUMA 1G1JA 2FY8A 1ZRTE 1G2CA 1ZNVA 1SFCA 3IFMA 5KAFH 2LKIA 4IZ6A 3RG6C 2WTYA 1NKNA 1L0NG 3VYIA 3HUSA 2QRXA 3AE8C 5AW6B 5KLVD 1Y47A 2W8ZA 1USEA 4K3AA 2Z45A 1BGYG 5AW2B 2JO0A 1LTSC 5KAIH 3E1IA 2Q3EA 2E75C 3LW5J 5APQA 3VOPA 2PEQA 2WQYC 4QMAA 3AE9C 2M8PA 2FACA 2LMLA 2AXTE 5AW0B 3BCCG 2D2CD 5CJ4A 4QKOA 4RO0A 5GTHE 2NPSA 3P8MC 3KXDA 5CCGC 1T8ZA 5HGMA 2OYHC 1JMMA 1JY3N 3L73G 1KB9H 3IN6A 1YTZI 2KOSA 3RK2C 1JNMA 1IZNB 1KYOH 3BATA 2D2CC 1S3JA 3L71J 4WY4A 1RF1B 1J1DB 4A7PA 2R44A 3Q5RA 2WSSH 2E5YA 1BGYJ 2GDWA 4D6TD 4OGQC 3C8VA 3CCLP 3F5HA 2K92A 4GIFA 4BPHA 3BASA 3EJBA 2NRGA 4PJ0E 3CXHD 2FYUK 2K2QA 1LTGC 3EJEA 3A0BH 1NOHA 2EHSA 1CI6B 3G29A 1TU3F 1NQ4A 1VDFA 2NPSB 2ERHA 2LTEA 2W83C 1L0LJ 2KG6A 1HTLC 2HFED 3H0DA 1IFNA 2QJKB 2XNXA 3M0DC 1J1EC 1CSBA 1FS0E 1SQXJ 1BE3J 3NMDA 5CZDB 3L72E 1PGOA 1QGKB 2KGAA 5CCHC 1QL1A 2I1JA 1MUUA 3B4SA 4D6TG 3DTJA 5AVZB 2BCCG 2QVAA 2R32A 3BVHA 3L70G 2K0DX 2D2CB 3G6EP 1LTJA 4BRYB 3RK3C 3CCSP 1NWQA 4W80A 1RE4A 2FYUG 3DS0A 4KT0J 3H32B 1N73A 3TGUE 3CWBG 4L75A 1OIPA 1H88A 2PAJA 1FE6A 1RO2A 1KD1Q 2PEIA 1HUCA 1JM0A 3KYQA 1FZFA 5KJ7A 1Z6MA 2K0XA 4ASWA 1NAYA 1KV4A 1VHNA 2Q9IA 3VP8A 3VRLC 4D6TJ 4IL6X 1AJYA 1NU1G 3D6YA 2V4HA 3PLNA 3PRJA 1SQBD 2MY5A 3E7KA 3G1IA 2EG5A 1IK9A 3U1CA 3A7OA 2JKVA 5E79E 2OGUA 2W6JH 4IL6E 1XTGB 1N7SD 1HJBA 1EXIA 5K5GB 2M0BA 3PHLA 5B5EH 2LR2A 5M1BA 1M8OB 2GZEA 5F2NA 7CEIA 5E79H 3L73D 2VLNA 1HY8A 1N7SC 5KLVG 1EZVD 2N9BA 1M1JA 3O6QA 1OX3A 2R5BA 3HD7C 1LWUB 1K04A 4RJTA 3A0HE 1DH3A 2NPSC 1HQBA 5CCGA 5HGOA 2QJPB 3GW6A 3L75J 3H1JE 5KJ7D 2KK7A 3V2PA 3WUTA 3CLQA 1ZRTD 2M8RA 3M06A 1Q81Q 1VQLP 2C9LY 4JPZB 1T3JA 2ZXXA 3TNUB 1Q82Q 4DCKA 1VQ9P 1M56D 3GF3A 3H1KE 2YMKA 2FADA 4R0MA 1P84H 1S5LE 1LP1A 3JC22 2A06G 1IFIA 3HTKB 5CCGD 1IFDA 2P67A 3OA7A 5AVUB 3FWNA 1A02F 3TGUJ 3SSUA 1PP9J 1MFTA 2QJPC 4LGDE 3MGNA 1QEXA 2OTKE 1S5LX 2VSQA 1FAVA 1L0NJ 3M9HA 3H1IG 3WU2E 3E2DA 3V5BA 2MKVA 3CC2P 1EDKA 4IOIH 4IFDK 2KGEA 1RH5B 3V2RA 3CL3D 5AVQB 3TYYA 1E5WA 3JCUE 3Q3DA 2M3BA 1NTKG 2WWWA 1DD3A 4WB4A 1PEQA 1LP1B 1L0IA 2JU2A 1IFPA 2N1TC 3K5BA 1SQBE 1L0NE 2WPSA 3L35A 4N78D 2OYOA 2XZRA 3B8EB 3CXCO 1K30A 1FOSF 2Z5IA 1VF5D 4H44C 1GL2D 2KP8A 3O6QB 1BCCE 3HD7D 4PWVB 1LWUA 2QEXP 3H1IJ 3B5NB 1NTKJ 3CX5I 3AEEC 5L8RJ 3BRTB 4PV1C 4C7RA 2AFDA 3WMM0 1SQQE 5C39A 2P10A 3FGAD 1FBMA 4NPFX 3WU2H 2L22A 1AVYA 1QLED 3H6PA 2JWDA 1EC5A 5AW8B 1SQXK 2FQ2A 4I7ZB 1NTKE 2FVAA 5H2FH 2Q1KA 1BCCJ 1Q90D 2E76D 2WSEJ 3G1GA 2XNDH 3GF7A 3L73E 3H1JD 1HGVA 3LRYA 2JR8A 2G8YA 3N7NA 3B71A 5AVWB 5GTIE 4XFJA 2BUOA 4R4LA 4COCA 3RBZA 2FYNB 1GW3A 2C0WA 5KAFE 4DJGA 2HG5D 4L74A 2IYOA 2YXQB 3TGUD 1NO4A 2B87B 2FYNC 1PP9D 1NTKD 1FZEA 4ZMDA 2FXMA 1N73C 4NEOA 2ZVNB 2A06D 5DJUB 2KODA 3BRVB 1LTTC 4RESB 2K9JB 2K93A 1BDDA 4C7NB 2VLOA 1RF1C 4WY4C 3OAKA 4ZKPA 5CHXA 2X2BA 1GK4A 2L91A 4YPCA 4I7ZC 1N7LA 2PP6A 3H1LE 2V7QJ 4GDOA 2O3JA 1FDIA 2RH0A 1EIAA 5AVSB 2V7QH 2HLOA 4U3FG 3HD7B 2K88A 4GOEA 2WPRA 2WSFJ 1YJNP 2H7HA 3MGEA 4PD4H 3V2NA 4IL6H 2GDXA 2WSCJ 1AA0A 1H8AA 2A06E 3VMXA 1LT9C 3BCCE 2C0XA 1H0TA 1UIXA 1KB9I 1PP9E 3L75G 2YIUC 1JCDA 4PH1A 1SFCC 3M9QA 4U0EA 5JPAA 3L72D 2E5TA 2JU1A 2HODA 1U7JA 3GZLA 4OGQD 1FC2C 1SQPG 4N78E 2KB7P 1NTKK 1EZVE 1HF9A 3PP5A 4UB8H 1SQXE 3M91A 3VN0A 2FHSC 1KFMA 3D71A 1UNKA 4U3FE 1M6NA 1MV8A 1JTHA 5I4TG 4IFMA 1ZR2A 2AEJA 4CA3A 2Y9ZA 2KYVA 4OWFA 2NO8A 5KKZC 3B5NA 1SQQD 1PGQA 2O1JA 2CPSA 2OTJP 2ZVOB 5B66E 3FWLA 3L72G 2WITA 3DS4A 1VQKP 2XZ0D 4U3FJ 4WWIA 1U7MA 1DV5A 4UB8E 5KLVK 1L0LE 1F80D 3GZMA 4D6TE 1PEMA 1P84I 1QVFO 1FZCC 1L0NK 1SQBK 3AEAC 2AEFA 2QE7H 1JTHB 5KLIC 1QVGO 2BEQD 1SQPE 2IYPA 2N50A 1LTBC 2GUSA 1HH0A 1FR2A 3VMZA 4BRYA 3RG2A 2KORA 2FVEA 2KW2A 1JY2O 3KZIH 3MTUE 2FFDA 2B87A 1WT6A 1FZCA 3WUVA 1GD2E 4KJMA 1KB9D 3Q1MA 2K37A 3F89A 2YKOA 1T2KC 4AUWA 4XRQA 1KYOE 4JYCA 4HB1A 3L70D 5KP8B 2WMMA 3AE3C 2YXRB 2KG9A 1T3UA 3CX5D 2YKPA 1EDLA 2K3RA 1IC2A 5GTHH 3AE2C 2Z46A 1N73B 5TISH 5HV8A 3JSVC 3OW2O 3W68A 1AV1A 4MRTC 3RK3E 3CPWO 2K5XA 4GT1A 2KIKA 1AYIA 2E74D 1X0TA 2FAEA 3CXHE 2AVAA 2KG8A 1YTZT 2PY8A 1X3OA 5BS1A 3V2QA 2W90A 4L73A 2EFJA 2IFMA 2H43A 4M3LA 3RL0g 5HGNA 1KQGB 1BXIA 1A43A 1L4AB 1GW4A 5AW3B 5GTIH 3MZWB 5KP6B 2LXCB 1MZ8A 3G28A 1KZUB 3IR9A 4HJGH 4BXLA 3V4QA 1BDCA 2OQQA 2N1TA 4BPGA 3M0DA 3AE6C 3E1RA 1KILC 3CCVP 2IZ0A 2B89A 1JY3O 5F2OA 3H1KG 3DS3A 2ZFCA 2L4BA 1VF5B 1GL2B 2ZT9D 3ABVC 3H25A 1BCCD 1EOQA 2I1KA 1ZN5A 1SQXG
chains in the Genus database with same CATH topology
3G1IA 3LRYA 1YIJP 1YJWP 2EG5A 1VQPP 1M90Q 1N8RQ 1RNIA 2DGYA 2BUOA 2EIAA 3P05A 3E2DA 2BHVA 1M74A 4COCA 1VQ5P 4XFZA 1VQ7P 1IUQA 3CC2P 3DS2A 2JYLA 3CCUP 3G29A 4U0DA 1K73Q 2PENA 3HZQA 1K9MQ 1Q7YQ 1VQNP 3CCJP 1NJIQ 3I56P 4IPYA 2LF4A 2Z46A 3WBHA 1M6NA 1AUMA 3CC7P 2KODA 5I4TG 3OW2O 1YITP 2PEOA 3H0DA 3H47A 3CD6P 1S72P 5F2NA 3DS5A 1PEQA 2PEMA 3CCEP 4U0BA 5BS2A 3RG6C 2OARA 3CPWO 3CCRP 2OTJP 3HYBA 3CC4P 1BAJA 2L6EA 3H4EA 3CMEP 4U0AA 3CXCO 3G0VA 1K30A 3G26A 1K8AQ 3CMAP 4XFYA 4U0FA 3DS4A 2PY8A 2Z45A 2JO0A 3CCMP 1KQSO 1VQKP 3G4SP 5BS1A 2ONTA 1W2BO 2EFJA 2PEQA 1EIAA 3DPHA 2M8PA 1RO0A 3DTJA 2OTLP 3NTEA 5HGNA 5HGOA 1PEUA 1A43A 2PEJA 1A8OA 4COPA 3M1MA 1PEMA 2QEXP 1QVFO 1VQOP 2PEKA 3Q20A 3G6EP 2XV6A 4WYMA 3G71P 1M1KQ 1YI2P 4PH0A 3CCSP 4M0IA 3G28A 5HGLA 1JJ2O 1VQ6P 2CWOA 1QVGO 4XROA 1YJNP 3CCQP 1D1DA 3DS0A 1YJ9P 1Q81Q 2BQ1E 3MGEA 5HGMA 1VQLP 4QNBA 2E1MA 4XFXA 2XT1A 1YHQP 1Q82Q 1VQ9P 1PEOA 2P9XA 1RO2A 1ZMBA 2PEIA 5F2KA 1Q86Q 1KD1Q 3I55P 3CCVP 1E6JP 1VQ8P 1QRJA 3G21A 5F2OA 3DS3A 3VRLC 4PH1A 2M8LA 5DCKA 4U0CA 4U0EA 3B5IA 5JPAA 1VQMP 2Z44A 3G1GA 1EOQA 3DS1A 1M6EX 4GR6A 1KC8Q 2XXMA 4XRQA 2JYGA 3CCLP 2M8NA 1VQ4P 2QA4P 4GR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ9 P;  1YIJ P;  1YJW P;  1VQP P;  1M90 Q;  1N8R Q;  3CCE P;  1Q86 Q;  1KD1 Q;  2QEX P;  1QVF O;  1VQO P;  3I55 P;  3CPW O;  3CCV P;  3CCR P;  1VQ5 P;  3G6E P;  3G71 P;  1Q82 Q;  1VQ8 P;  2OTJ P;  3CC4 P;  1VQ7 P;  3CC2 P;  1M1K Q;  3CCU P;  1YI2 P;  3CCS P;  1K73 Q;  1S72 P;  1JJ2 O;  3CME P;  1K9M Q;  1VQ6 P;  3CXC O;  1Q7Y Q;  1QVG O;  1VQN P;  1YJN P;  3CCQ P;  1K8A Q;  1VQM P;  1YJ9 P;  3CMA P;  3CD6 P;  3CCJ P;  1Q81 Q;  1VQL P;  1NJI Q;  3I56 P;  3CCM P;  1KQS O;  1VQK P;  3G4S P;  1KC8 Q;  3CC7 P;  1W2B O;  3OW2 O;  1YIT P;  3CCL P;  1VQ4 P;  2QA4 P;  1YHQ P;  2OTL P; 
#chains in the Genus database with same CATH topology
 1EDI A;  1Y8A A;  1VQP P;  2H88 C;  1M90 Q;  1RNI A;  2EIA A;  1L4A D;  1JB0 J;  2BHV A;  1SQB J;  4ASV A;  3VP9 A;  3Q2Y A;  1IUQ A;  2XKM A;  2BEZ F;  3HZQ A;  1G2C B;  4H0L C;  3EFF K;  1YQ4 C;  3H1L J;  1D7M A;  1NTM G;  1SVF A;  2A45 I;  3CXH H;  3KZI E;  3M9B A;  2FKW B;  1GPJ A;  2CPB A;  2XV5 A;  3HE5 A;  1K05 A;  4U0B A;  2HPC A;  2J59 M;  4H0L D;  2E74 B;  1WMK A;  2HR3 A;  3CME P;  1J1D C;  3II6 A;  1Z56 A;  2KR5 A;  4U0F A;  1KQS O;  1ZV8 A;  4XE5 B;  2ONT A;  1IFM A;  5KP7 B;  3SWK A;  3RL0 C;  1KIL E;  2RN0 A;  1A8O A;  2N98 A;  2FFD B;  3KDP B;  1VQO P;  1LTJ B;  3T97 B;  1DNY A;  1VKU A;  1BE3 D;  4DZO A;  1QL2 A;  3AEB C;  1SQX D;  3CCQ P;  4U7J A;  3USS A;  2A45 H;  4PV1 D;  1S5L H;  3H1H J;  1IO4 A;  1IMQ A;  4MN4 C;  3L74 E;  2ZYA A;  3SFD C;  2ZAE B;  1PP9 G;  3L75 E;  1QRJ A;  2N1T B;  1J2J B;  4H0L B;  5AW5 B;  1W5C E;  5APV A;  3ITK A;  1URQ B;  2N5I A;  1LJ2 A;  1YIJ P;  2IBZ D;  1PPJ E;  2N9Y B;  2AXC A;  5DJT B;  1VQ7 P;  2M5A A;  4GOF A;  4EIJ A;  3P8C D;  2PEN A;  4H2X C;  2I8D A;  1R5S A;  1OVU A;  1NGM B;  2E42 A;  1VPC A;  3CCJ P;  2LPK A;  3I56 P;  3C9I A;  2QJY C;  3L36 A;  1U57 A;  3H47 A;  1ZW0 A;  3CE7 A;  3CWB J;  4EI2 A;  2QJY B;  2Y0E A;  2Q5U A;  1OWA A;  2XDJ A;  2FYU J;  4PD4 D;  2WPV B;  3RK2 B;  4BPF A;  1SQV K;  4Y99 C;  5B5E E;  2IBZ I;  2O01 J;  4W7Z A;  2GA1 A;  4I6M C;  2KOP A;  3AE4 C;  3G9R A;  3DPH A;  2H8P D;  1GDT A;  2W6B A;  3IF4 A;  1DX7 A;  2PEJ A;  1X8Y A;  4COP A;  1S4X A;  1SLQ A;  3CWB E;  1VF5 C;  3L71 E;  2YMY A;  2MF4 A;  1R5L A;  5AW4 B;  5CBN A;  2FYU D;  3GHG A;  2IBZ E;  3LMO A;  1E79 H;  1BSN A;  4YTP C;  2MVU A;  4PV1 B;  4DG9 A;  5APT A;  1ZMB A;  2JBG A;  2L0Q A;  3A5T A;  4EOT A;  1CW5 A;  1KOR A;  2JQ4 A;  3PTZ A;  2KSE A;  2JWA A;  3RBX A;  2WZ7 A;  1KC8 Q;  5KLV E;  1LGH B;  1LTI C;  2KUB A;  2QA4 P;  1M1J B;  1KQF B;  1BE3 E;  1OZH A;  3L70 J;  1P84 D;  2ZT9 C;  1BSH A;  3G3Z A;  3P32 A;  2FQ1 A;  2O1K A;  2N5H A;  1NTM D;  2B88 A;  1OR5 A;  4F37 A;  4DT0 A;  1UJZ A;  3AE7 C;  4ZNC A;  2LIW A;  1YIT P;  1JCC A;  3L73 J;  4GKG A;  2GZJ A;  1BGY D;  2PEM A;  5TJH A;  5BS2 A;  1H0T B;  4I2L C;  3HYB A;  5AVV B;  1SFC B;  4N6J A;  2FYZ A;  1EXJ A;  1JEK A;  3MP7 B;  3G0V A;  1PFI A;  3CMA P;  3CCM P;  2FFD C;  2KOO A;  1BE3 G;  5KJ7 C;  1Q2N A;  2MR7 A;  3L75 D;  2OTL P;  2E75 D;  4B86 A;  3M1M A;  1NU1 J;  5CMZ A;  3CI9 A;  1L0L G;  1RE3 A;  2E76 C;  1YI2 P;  1BGY E;  2E74 C;  5BU5 A;  1URQ C;  1X79 B;  4C7N A;  1RE4 C;  1S9K E;  3L4F A;  3S9O A;  3GMA A;  1KIL B;  2E1M A;  3TDK A;  3KHU A;  5H2F E;  1SQV E;  3LW5 H;  2W6A A;  1FDO A;  5APY A;  2LOL A;  2IDB A;  2O01 H;  3WUU A;  1FOS E;  2R3C A;  1NTZ G;  1EQ7 A;  3JCU H;  2P2U A;  2R5D A;  2KOQ A;  1N7S B;  2HYN A;  2WVR A;  1LTA C;  4WY4 B;  1GL2 C;  2FXP A;  1M6E X;  2M8N A;  3NY7 B;  1S9K D;  2M3E A;  1PL5 A;  3EQ2 A;  2Y0D A;  4Z1M H;  3U1A A;  2ZXE B;  5KLI B;  2KNC A;  3MHV A;  2EHT A;  1ZXG A;  1VQN P;  3HE4 A;  1AQ5 A;  2JB0 A;  3KQG A;  2BCC D;  1QX8 A;  4OH8 B;  5CBO A;  3H1L G;  2GYK A;  2GZG A;  2Z5H A;  1AF8 A;  3B4Q A;  1CZQ A;  1L4A C;  1BAJ A;  2WPT A;  2A45 G;  3RL0 B;  3G26 A;  4PD4 I;  1HGZ A;  1L0H A;  5CCH A;  1W2B O;  1SQQ J;  1HWT C;  1CI6 A;  3FXE A;  3GHG C;  4JBZ A;  2PEK A;  1VL2 A;  3Q20 A;  3FX0 A;  5EFW B;  1JJ2 O;  1J1E B;  2ITA A;  2K94 A;  2IFN A;  1IK7 A;  4XRO A;  1KYO D;  2WT7 B;  3A3Y B;  5APW A;  2AF8 A;  2PRR A;  1FJP A;  1P84 E;  4W7Y A;  3R2P A;  4Y99 B;  5AVR B;  3GG2 A;  2Q7C A;  4Y28 J;  2GZI A;  3GLM A;  1GU5 A;  3G21 A;  5AVY B;  2XZ1 C;  2WSF H;  1OW8 A;  2QG4 A;  3B5I A;  4WVZ A;  1L4A A;  4WBA A;  1SQP J;  2P1J A;  3QWO C;  5KTB A;  2JAZ A;  2KLV A;  4GR2 A;  1PPJ G;  1X9V A;  1NTZ K;  2DNW A;  2FYU E;  2BCC J;  5BVZ A;  2ROQ A;  5HVC A;  3R4Y A;  1RQV A;  2MJZ A;  4IPY A;  3WBH A;  2FXO A;  3SWF A;  3HRN A;  5APX A;  2PEO A;  3HE4 B;  1MKM A;  4L76 A;  1GTW A;  1GXH A;  2H89 C;  2OAR A;  1PV3 A;  2FBW C;  1SS1 A;  4HKZ H;  2NPS D;  5APS A;  2CGQ A;  3RL0 D;  2WPQ A;  4XFY A;  1NAF A;  1YYC A;  3U59 A;  5CJ0 A;  3VMY A;  3NFQ A;  1N86 A;  1RO0 A;  1PEU A;  2KGC A;  2OYI B;  1ZLL A;  2C9N Y;  3G71 P;  1M1K Q;  2YO3 A;  2N1T D;  3FXD A;  2Z4E A;  3KPE A;  1RE3 C;  3HE5 B;  1LT9 B;  1AQT A;  3MD0 A;  2BCC E;  3EJD A;  1FU1 A;  1FZG A;  2FVF A;  3L71 G;  2P9X A;  2WT7 A;  3LID A;  2QNW A;  1Q86 Q;  1SQQ G;  3TK1 A;  3I55 P;  3HUS B;  1KN7 A;  2L5G B;  1DIP A;  1YQ3 C;  1N7S A;  2UWJ E;  1RY3 A;  4K35 A;  2WSC H;  1NHL A;  3A0B E;  3ZDM A;  2VLQ A;  4H44 B;  5B66 H;  2YIU B;  3NXS A;  3P05 A;  1AVO A;  3H1H E;  1VQ5 P;  1GZL A;  1NU1 K;  2OYI C;  1L0L D;  1XTC C;  2KLU A;  2YKQ A;  3TGU G;  2QSI A;  4TLF A;  1LT9 A;  1KQL A;  3H1I E;  1EZV I;  4LC1 A;  1S72 P;  2ZYD A;  1KB9 E;  4H2W C;  3HTK A;  1GK6 A;  1DD4 A;  3GJN A;  3H32 A;  1JY2 N;  3VTP C;  4H13 D;  4UB6 E;  3CC4 P;  1OXZ A;  4JYB A;  3LIE A;  1FZB A;  1PPJ D;  2L6E A;  2J5U A;  1EDJ A;  3H4E A;  3H1K D;  1NU1 E;  2Y9Y A;  4XA4 A;  2IX7 C;  2MD9 A;  1SQP K;  3EWK A;  4LLH A;  3NTE A;  2M5A B;  2AXT H;  4PJ0 H;  2KS1 B;  1LWU C;  4H44 D;  5KAI E;  5APU A;  4HYT B;  3M0A A;  1YJ9 P;  4EYY Q;  2BQ1 E;  1ZME C;  1OW6 A;  4QNB A;  2YNY A;  1NTM E;  2JDI H;  2KZI A;  5AVT B;  2LL8 A;  2JGP A;  4OGQ B;  2KOG A;  4UHP B;  2AFE A;  3SWY A;  3H1L D;  3RK3 D;  3CX5 H;  2DW3 A;  2GUV A;  4TT3 H;  1MFZ A;  4IFF A;  4RKU J;  3EFG A;  2KSJ A;  1NU1 D;  2JP3 A;  1GXG A;  2CNR A;  1N8R Q;  1M74 A;  1JY2 P;  1KTM A;  1SQV J;  2KGD A;  2LIU A;  2ZYG A;  1L2P A;  1SFC D;  2PGD A;  3GHG B;  1Q7Y Q;  2LKM A;  2ZT9 B;  1KIL D;  2IBZ G;  4ZKU A;  3MUD C;  2N6Z A;  1OFC X;  3CC7 P;  3PH0 A;  1DEE G;  5EW5 E;  2OYI A;  1ZR4 A;  1NTZ D;  1S2E A;  2E75 B;  4EDF A;  3B5N C;  2J58 A;  1FJK A;  5AW7 B;  5AW1 B;  1HVV A;  3TSI A;  1KMI Z;  3RK3 B;  3VMA A;  1X22 A;  5AVX B;  3G4S P;  2KZJ A;  1HBW A;  1LT1 A;  2AEM A;  2YO2 A;  3L74 G;  1GL2 A;  2N6Y A;  1LTJ C;  2XV6 A;  1NTZ J;  4WYM A;  3T97 A;  3Q5P A;  3V6I A;  5TIS E;  2RKL A;  3Q5S A;  2P7J A;  2PFX A;  4M0I A;  2CWO A;  3TNU A;  4N3Y B;  3CX5 E;  3AEF C;  4XFX A;  2BAS A;  3AE1 C;  1PEO A;  1URQ D;  4YXW H;  1WRG A;  1NTZ E;  1NKZ B;  3HUS C;  1W2E A;  2NZ2 A;  5DCK A;  4U0C A;  4DOJ A;  3MIW A;  1VQM P;  3OJA B;  2HPC B;  3H1K J;  2Z44 A;  1NTM J;  2R3S A;  1E0H A;  4GR6 A;  3SFE C;  1BCC G;  2JEE A;  1M1J C;  2JO1 A;  1VQ4 P;  1L0N D;  1SQV G;  2WSE H;  1SQP D;  1YJW P;  1FZA A;  2Y0C A;  1RF0 C;  1YBK A;  3DS2 A;  1OW7 A;  3CCU P;  3RK2 D;  1K73 Q;  3UIA A;  2QM8 A;  1NVO A;  3V4W A;  2E76 B;  4O9B A;  5BU8 B;  1OMI A;  3L74 D;  1NJI Q;  1KIL A;  4NPE A;  1EZV G;  1RHZ B;  1KLP A;  5KLV J;  2QJK C;  3L71 D;  1RQU A;  3CD6 P;  4UB6 H;  2G3A A;  3A2A A;  3CCE P;  1KYO I;  3N4X A;  3L70 E;  5KKZ B;  2O01 N;  1ZOY C;  3BCC D;  3QH9 A;  2CQ8 A;  1JY3 P;  2Q3I A;  3C1L A;  3H1J G;  4U3F D;  2L9F A;  3I5C A;  1MZ9 A;  2K9J A;  2ZJS E;  4PXH B;  1URQ A;  3L72 J;  4H2Y C;  1M57 D;  1VQ6 P;  3AE5 C;  2P58 A;  3IAO A;  5AW9 B;  2MVV A;  2LXB A;  1PIX A;  3P8C E;  1IJD B;  4R4M A;  3PJS K;  2XT1 A;  4JQ0 D;  1HJ0 A;  3D70 A;  5F2K A;  1SQB G;  3AED C;  1VQ8 P;  1S1C X;  1LNQ A;  2K9Y A;  2SPZ A;  3HD7 A;  1NH4 A;  1R8E A;  3A0H H;  3H1J J;  3CWB D;  2M5R A;  1EMV A;  1NYH A;  4CPG A;  4C46 A;  4AYC A;  3DS1 A;  3BCC J;  3L37 A;  1JUN A;  2Q6Q A;  1IMP A;  1PGP A;  2DGY A;  3H1H G;  2OYH B;  3MUD A;  4XFZ A;  3L74 J;  2JYL A;  3NTN A;  1G1I A;  4U0D A;  1K9M Q;  2KI7 B;  1A02 J;  1AFO A;  1SQQ K;  2LF4 A;  3W67 A;  1T8K A;  1ACP A;  4BWN A;  2VRS A;  1UII A;  4AQR D;  3U43 A;  3DS5 A;  2HOD B;  3GKL C;  3AEG C;  3CCR P;  1OVV A;  1JOC A;  2GDY A;  4HKG A;  4OVN F;  2K0Y A;  4YXD C;  4U0A A;  3H1H D;  1NTM K;  3RGU A;  1K8A Q;  3TF5 A;  2FQ0 A;  2IPP A;  2KS1 A;  2IZ1 A;  1SP4 A;  1CEI A;  1M7L A;  1Y9B A;  1OVR A;  3S1K A;  2OYH A;  2CG5 B;  4PH0 A;  1T6A A;  2RMZ A;  5HGL A;  2VLP A;  1D1D A;  4I1L A;  4PD4 E;  2PNG A;  3AEC C;  3D6Z A;  1GMJ A;  2QM7 A;  4H13 C;  3S4R A;  1FDM A;  1L0L K;  1IFJ A;  2GM4 A;  1YHQ P;  1RF1 A;  2CK3 H;  2JJL A;  2POH A;  1USD A;  4H13 B;  1KFN A;  1H89 A;  4HH2 A;  1E6J P;  2K1A A;  2QIW A;  3P7K A;  2XU6 A;  4NPD A;  5EJD A;  2M8L A;  3H1I D;  2KWL A;  1N2D C;  4GOD A;  3CXH I;  4KHX A;  5CCH D;  2GZF A;  1FZC B;  1JMB A;  2MR8 A;  4JF7 A;  2XXM A;  2JYG A;  1GU4 A;  1DEB A;  2KXP B;  2E43 A;  1ZP0 C;  3O8Z A;  1T2K D;  1PGJ A;  1PZQ A;  2W27 A;  1JO5 A;  3B5N D;  2KNC B;  1SQV D;  1RF0 A;  4WY4 D;  2B9B A;  1AUM A;  1G1J A;  2FY8 A;  1ZRT E;  1G2C A;  1ZNV A;  1SFC A;  3IFM A;  5KAF H;  2LKI A;  4IZ6 A;  3RG6 C;  2WTY A;  1NKN A;  1L0N G;  3VYI A;  3HUS A;  2QRX A;  3AE8 C;  5AW6 B;  5KLV D;  1Y47 A;  2W8Z A;  1USE A;  4K3A A;  2Z45 A;  1BGY G;  5AW2 B;  2JO0 A;  1LTS C;  5KAI H;  3E1I A;  2Q3E A;  2E75 C;  3LW5 J;  5APQ A;  3VOP A;  2PEQ A;  2WQY C;  4QMA A;  3AE9 C;  2M8P A;  2FAC A;  2LML A;  2AXT E;  5AW0 B;  3BCC G;  2D2C D;  5CJ4 A;  4QKO A;  4RO0 A;  5GTH E;  2NPS A;  3P8M C;  3KXD A;  5CCG C;  1T8Z A;  5HGM A;  2OYH C;  1JMM A;  1JY3 N;  3L73 G;  1KB9 H;  3IN6 A;  1YTZ I;  2KOS A;  3RK2 C;  1JNM A;  1IZN B;  1KYO H;  3BAT A;  2D2C C;  1S3J A;  3L71 J;  4WY4 A;  1RF1 B;  1J1D B;  4A7P A;  2R44 A;  3Q5R A;  2WSS H;  2E5Y A;  1BGY J;  2GDW A;  4D6T D;  4OGQ C;  3C8V A;  3CCL P;  3F5H A;  2K92 A;  4GIF A;  4BPH A;  3BAS A;  3EJB A;  2NRG A;  4PJ0 E;  3CXH D;  2FYU K;  2K2Q A;  1LTG C;  3EJE A;  3A0B H;  1NOH A;  2EHS A;  1CI6 B;  3G29 A;  1TU3 F;  1NQ4 A;  1VDF A;  2NPS B;  2ERH A;  2LTE A;  2W83 C;  1L0L J;  2KG6 A;  1HTL C;  2HFE D;  3H0D A;  1IFN A;  2QJK B;  2XNX A;  3M0D C;  1J1E C;  1CSB A;  1FS0 E;  1SQX J;  1BE3 J;  3NMD A;  5CZD B;  3L72 E;  1PGO A;  1QGK B;  2KGA A;  5CCH C;  1QL1 A;  2I1J A;  1MUU A;  3B4S A;  4D6T G;  3DTJ A;  5AVZ B;  2BCC G;  2QVA A;  2R32 A;  3BVH A;  3L70 G;  2K0D X;  2D2C B;  3G6E P;  1LTJ A;  4BRY B;  3RK3 C;  3CCS P;  1NWQ A;  4W80 A;  1RE4 A;  2FYU G;  3DS0 A;  4KT0 J;  3H32 B;  1N73 A;  3TGU E;  3CWB G;  4L75 A;  1OIP A;  1H88 A;  2PAJ A;  1FE6 A;  1RO2 A;  1KD1 Q;  2PEI A;  1HUC A;  1JM0 A;  3KYQ A;  1FZF A;  5KJ7 A;  1Z6M A;  2K0X A;  4ASW A;  1NAY A;  1KV4 A;  1VHN A;  2Q9I A;  3VP8 A;  3VRL C;  4D6T J;  4IL6 X;  1AJY A;  1NU1 G;  3D6Y A;  2V4H A;  3PLN A;  3PRJ A;  1SQB D;  2MY5 A;  3E7K A;  3G1I A;  2EG5 A;  1IK9 A;  3U1C A;  3A7O A;  2JKV A;  5E79 E;  2OGU A;  2W6J H;  4IL6 E;  1XTG B;  1N7S D;  1HJB A;  1EXI A;  5K5G B;  2M0B A;  3PHL A;  5B5E H;  2LR2 A;  5M1B A;  1M8O B;  2GZE A;  5F2N A;  7CEI A;  5E79 H;  3L73 D;  2VLN A;  1HY8 A;  1N7S C;  5KLV G;  1EZV D;  2N9B A;  1M1J A;  3O6Q A;  1OX3 A;  2R5B A;  3HD7 C;  1LWU B;  1K04 A;  4RJT A;  3A0H E;  1DH3 A;  2NPS C;  1HQB A;  5CCG A;  5HGO A;  2QJP B;  3GW6 A;  3L75 J;  3H1J E;  5KJ7 D;  2KK7 A;  3V2P A;  3WUT A;  3CLQ A;  1ZRT D;  2M8R A;  3M06 A;  1Q81 Q;  1VQL P;  2C9L Y;  4JPZ B;  1T3J A;  2ZXX A;  3TNU B;  1Q82 Q;  4DCK A;  1VQ9 P;  1M56 D;  3GF3 A;  3H1K E;  2YMK A;  2FAD A;  4R0M A;  1P84 H;  1S5L E;  1LP1 A;  3JC2 2;  2A06 G;  1IFI A;  3HTK B;  5CCG D;  1IFD A;  2P67 A;  3OA7 A;  5AVU B;  3FWN A;  1A02 F;  3TGU J;  3SSU A;  1PP9 J;  1MFT A;  2QJP C;  4LGD E;  3MGN A;  1QEX A;  2OTK E;  1S5L X;  2VSQ A;  1FAV A;  1L0N J;  3M9H A;  3H1I G;  3WU2 E;  3E2D A;  3V5B A;  2MKV A;  3CC2 P;  1EDK A;  4IOI H;  4IFD K;  2KGE A;  1RH5 B;  3V2R A;  3CL3 D;  5AVQ B;  3TYY A;  1E5W A;  3JCU E;  3Q3D A;  2M3B A;  1NTK G;  2WWW A;  1DD3 A;  4WB4 A;  1PEQ A;  1LP1 B;  1L0I A;  2JU2 A;  1IFP A;  2N1T C;  3K5B A;  1SQB E;  1L0N E;  2WPS A;  3L35 A;  4N78 D;  2OYO A;  2XZR A;  3B8E B;  3CXC O;  1K30 A;  1FOS F;  2Z5I A;  1VF5 D;  4H44 C;  1GL2 D;  2KP8 A;  3O6Q B;  1BCC E;  3HD7 D;  4PWV B;  1LWU A;  2QEX P;  3H1I J;  3B5N B;  1NTK J;  3CX5 I;  3AEE C;  5L8R J;  3BRT B;  4PV1 C;  4C7R A;  2AFD A;  3WMM 0;  1SQQ E;  5C39 A;  2P10 A;  3FGA D;  1FBM A;  4NPF X;  3WU2 H;  2L22 A;  1AVY A;  1QLE D;  3H6P A;  2JWD A;  1EC5 A;  5AW8 B;  1SQX K;  2FQ2 A;  4I7Z B;  1NTK E;  2FVA A;  5H2F H;  2Q1K A;  1BCC J;  1Q90 D;  2E76 D;  2WSE J;  3G1G A;  2XND H;  3GF7 A;  3L73 E;  3H1J D;  1HGV A;  3LRY A;  2JR8 A;  2G8Y A;  3N7N A;  3B71 A;  5AVW B;  5GTI E;  4XFJ A;  2BUO A;  4R4L A;  4COC A;  3RBZ A;  2FYN B;  1GW3 A;  2C0W A;  5KAF E;  4DJG A;  2HG5 D;  4L74 A;  2IYO A;  2YXQ B;  3TGU D;  1NO4 A;  2B87 B;  2FYN C;  1PP9 D;  1NTK D;  1FZE A;  4ZMD A;  2FXM A;  1N73 C;  4NEO A;  2ZVN B;  2A06 D;  5DJU B;  2KOD A;  3BRV B;  1LTT C;  4RES B;  2K9J B;  2K93 A;  1BDD A;  4C7N B;  2VLO A;  1RF1 C;  4WY4 C;  3OAK A;  4ZKP A;  5CHX A;  2X2B A;  1GK4 A;  2L91 A;  4YPC A;  4I7Z C;  1N7L A;  2PP6 A;  3H1L E;  2V7Q J;  4GDO A;  2O3J A;  1FDI A;  2RH0 A;  1EIA A;  5AVS B;  2V7Q H;  2HLO A;  4U3F G;  3HD7 B;  2K88 A;  4GOE A;  2WPR A;  2WSF J;  1YJN P;  2H7H A;  3MGE A;  4PD4 H;  3V2N A;  4IL6 H;  2GDX A;  2WSC J;  1AA0 A;  1H8A A;  2A06 E;  3VMX A;  1LT9 C;  3BCC E;  2C0X A;  1H0T A;  1UIX A;  1KB9 I;  1PP9 E;  3L75 G;  2YIU C;  1JCD A;  4PH1 A;  1SFC C;  3M9Q A;  4U0E A;  5JPA A;  3L72 D;  2E5T A;  2JU1 A;  2HOD A;  1U7J A;  3GZL A;  4OGQ D;  1FC2 C;  1SQP G;  4N78 E;  2KB7 P;  1NTK K;  1EZV E;  1HF9 A;  3PP5 A;  4UB8 H;  1SQX E;  3M91 A;  3VN0 A;  2FHS C;  1KFM A;  3D71 A;  1UNK A;  4U3F E;  1M6N A;  1MV8 A;  1JTH A;  5I4T G;  4IFM A;  1ZR2 A;  2AEJ A;  4CA3 A;  2Y9Z A;  2KYV A;  4OWF A;  2NO8 A;  5KKZ C;  3B5N A;  1SQQ D;  1PGQ A;  2O1J A;  2CPS A;  2OTJ P;  2ZVO B;  5B66 E;  3FWL A;  3L72 G;  2WIT A;  3DS4 A;  1VQK P;  2XZ0 D;  4U3F J;  4WWI A;  1U7M A;  1DV5 A;  4UB8 E;  5KLV K;  1L0L E;  1F80 D;  3GZM A;  4D6T E;  1PEM A;  1P84 I;  1QVF O;  1FZC C;  1L0N K;  1SQB K;  3AEA C;  2AEF A;  2QE7 H;  1JTH B;  5KLI C;  1QVG O;  2BEQ D;  1SQP E;  2IYP A;  2N50 A;  1LTB C;  2GUS A;  1HH0 A;  1FR2 A;  3VMZ A;  4BRY A;  3RG2 A;  2KOR A;  2FVE A;  2KW2 A;  1JY2 O;  3KZI H;  3MTU E;  2FFD A;  2B87 A;  1WT6 A;  1FZC A;  3WUV A;  1GD2 E;  4KJM A;  1KB9 D;  3Q1M A;  2K37 A;  3F89 A;  2YKO A;  1T2K C;  4AUW A;  4XRQ A;  1KYO E;  4JYC A;  4HB1 A;  3L70 D;  5KP8 B;  2WMM A;  3AE3 C;  2YXR B;  2KG9 A;  1T3U A;  3CX5 D;  2YKP A;  1EDL A;  2K3R A;  1IC2 A;  5GTH H;  3AE2 C;  2Z46 A;  1N73 B;  5TIS H;  5HV8 A;  3JSV C;  3OW2 O;  3W68 A;  1AV1 A;  4MRT C;  3RK3 E;  3CPW O;  2K5X A;  4GT1 A;  2KIK A;  1AYI A;  2E74 D;  1X0T A;  2FAE A;  3CXH E;  2AVA A;  2KG8 A;  1YTZ T;  2PY8 A;  1X3O A;  5BS1 A;  3V2Q A;  2W90 A;  4L73 A;  2EFJ A;  2IFM A;  2H43 A;  4M3L A;  3RL0 g;  5HGN A;  1KQG B;  1BXI A;  1A43 A;  1L4A B;  1GW4 A;  5AW3 B;  5GTI H;  3MZW B;  5KP6 B;  2LXC B;  1MZ8 A;  3G28 A;  1KZU B;  3IR9 A;  4HJG H;  4BXL A;  3V4Q A;  1BDC A;  2OQQ A;  2N1T A;  4BPG A;  3M0D A;  3AE6 C;  3E1R A;  1KIL C;  3CCV P;  2IZ0 A;  2B89 A;  1JY3 O;  5F2O A;  3H1K G;  3DS3 A;  2ZFC A;  2L4B A;  1VF5 B;  1GL2 B;  2ZT9 D;  3ABV C;  3H25 A;  1BCC D;  1EOQ A;  2I1K A;  1ZN5 A;  1SQX G; 
#chains in the Genus database with same CATH homology
 3G1I A;  3LRY A;  1YIJ P;  1YJW P;  2EG5 A;  1VQP P;  1M90 Q;  1N8R Q;  1RNI A;  2DGY A;  2BUO A;  2EIA A;  3P05 A;  3E2D A;  2BHV A;  1M74 A;  4COC A;  1VQ5 P;  4XFZ A;  1VQ7 P;  1IUQ A;  3CC2 P;  3DS2 A;  2JYL A;  3CCU P;  3G29 A;  4U0D A;  1K73 Q;  2PEN A;  3HZQ A;  1K9M Q;  1Q7Y Q;  1VQN P;  3CCJ P;  1NJI Q;  3I56 P;  4IPY A;  2LF4 A;  2Z46 A;  3WBH A;  1M6N A;  1AUM A;  3CC7 P;  2KOD A;  5I4T G;  3OW2 O;  1YIT P;  2PEO A;  3H0D A;  3H47 A;  3CD6 P;  1S72 P;  5F2N A;  3DS5 A;  1PEQ A;  2PEM A;  3CCE P;  4U0B A;  5BS2 A;  3RG6 C;  2OAR A;  3CPW O;  3CCR P;  2OTJ P;  3HYB A;  3CC4 P;  1BAJ A;  2L6E A;  3H4E A;  3CME P;  4U0A A;  3CXC O;  3G0V A;  1K30 A;  3G26 A;  1K8A Q;  3CMA P;  4XFY A;  4U0F A;  3DS4 A;  2PY8 A;  2Z45 A;  2JO0 A;  3CCM P;  1KQS O;  1VQK P;  3G4S P;  5BS1 A;  2ONT A;  1W2B O;  2EFJ A;  2PEQ A;  1EIA A;  3DPH A;  2M8P A;  1RO0 A;  3DTJ A;  2OTL P;  3NTE A;  5HGN A;  5HGO A;  1PEU A;  1A43 A;  2PEJ A;  1A8O A;  4COP A;  3M1M A;  1PEM A;  2QEX P;  1QVF O;  1VQO P;  2PEK A;  3Q20 A;  3G6E P;  2XV6 A;  4WYM A;  3G71 P;  1M1K Q;  1YI2 P;  4PH0 A;  3CCS P;  4M0I A;  3G28 A;  5HGL A;  1JJ2 O;  1VQ6 P;  2CWO A;  1QVG O;  4XRO A;  1YJN P;  3CCQ P;  1D1D A;  3DS0 A;  1YJ9 P;  1Q81 Q;  2BQ1 E;  3MGE A;  5HGM A;  1VQL P;  4QNB A;  2E1M A;  4XFX A;  2XT1 A;  1YHQ P;  1Q82 Q;  1VQ9 P;  1PEO A;  2P9X A;  1RO2 A;  1ZMB A;  2PEI A;  5F2K A;  1Q86 Q;  1KD1 Q;  3I55 P;  3CCV P;  1E6J P;  1VQ8 P;  1QRJ A;  3G21 A;  5F2O A;  3DS3 A;  3VRL C;  4PH1 A;  2M8L A;  5DCK A;  4U0C A;  4U0E A;  3B5I A;  5JPA A;  1VQM P;  2Z44 A;  3G1G A;  1EOQ A;  3DS1 A;  1M6E X;  4GR6 A;  1KC8 Q;  2XXM A;  4XRQ A;  2JYG A;  3CCL P;  2M8N A;  1VQ4 P;  2QA4 P;  4GR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...