3CCJP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 42
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ccjP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ccjP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ccjP02
3CCLP 1YJ9P 1Q7YQ 3CCSP 1YIJP 1VQ8P 1VQOP 3CCJP 1QVFO 1N8RQ 3CCVP 3I55P 3CPWO 1VQ7P 1Q81Q 3CXCO 3CMEP 1K73Q 1VQKP 1M90Q 1YITP 1QVGO 1K8AQ 1M1KQ 3CC7P 2QEXP 3CCMP 3I56P 1S72P 1VQ6P 2QA4P 2OTJP 1JJ2O 1KD1Q 3CC4P 1KQSO 3G6EP 1W2BO 3CCQP 1VQ9P 2OTLP 1Q82Q 3CMAP 3G71P 1YJNP 1KC8Q 1VQPP 1YI2P 1K9MQ 1VQLP 3CC2P 3G4SP 1VQ5P 1VQNP 1VQMP 1VQ4P 3CCUP 3OW2O 3CCRP 1YJWP 1NJIQ 1YHQP 3CCEP 1Q86Q 3CD6P
chains in the Genus database with same CATH superfamily
1U7JA 3VOPA 2M8PA 1GXGA 2RH0A 1SQQE 2N98A 2H89C 1AA0A 1RY3A 1M1KQ 1IK7A 2W27A 2KGCA 1LTJB 1LTTC 1N86A 1HGVA 2H88C 2WITA 2M3BA 4U0CA 1NAFA 3G3ZA 3H1LJ 1NYHA 2CK3H 2FQ0A 2CGQA 1SQBK 1QL2A 3PLNA 2QSIA 1SQQK 1GU5A 4H13C 5C39A 2NPSC 2P9XA 5E79E 3PH0A 1IFMA 5M1BA 2CPSA 1GL2B 2FFDC 4U3FD 1EZVD 1ZV8A 2L4BA 2OGUA 4EOTA 1KYOH 2XNXA 1MFTA 1EDIA 1LWUB 1GU4A 1JJ2O 3H1HD 3B5ND 1SQXJ 3HE4B 2KWLA 3HUSA 3JC22 1RF1C 4GOFA 3M9HA 3SFDC 3EJEA 2HODA 3L74E 3CCVP 4PV1D 3B5IA 2E1MA 2V4HA 3M0DC 4ZKUA 2R5DA 5EJDA 1ZN5A 3TGUD 5H2FE 3OW2O 3GW6A 4UB8E 2OYHC 3L72G 5KP7B 3KZIE 4M0IA 1M56D 1ZOYC 1N73B 2WPQA 3WUUA 3V2NA 2MR8A 2PFXA 4U7JA 1HY8A 2FVEA 4JYCA 2QJPB 1RE3C 4BPHA 2PRRA 1N7SB 2QIWA 3KYQA 3G0VA 3B8EB 2XNDH 5KAFH 4OGQC 2KIKA 3L72E 4WWIA 1A8OA 1L0IA 2XXMA 5B66H 1OFCX 2OARA 5BS1A 4H0LD 1YBKA 3CE7A 4GR2A 1WMKA 2BQ1E 2N9YB 3BRTB 1Z6MA 2PEMA 1N2DC 3V2RA 2VLNA 3O6QA 4JYBA 3DS3A 3HD7D 2QJKB 2CQ8A 4D6TD 1J1EC 2IPPA 3QWOC 2YIUC 3A0HH 1URQC 3AE9C 1J1DC 3Q1MA 2XKMA 2L6EA 3GG2A 5CCHA 4JBZA 2QEXP 4U3FG 3TDKA 1EZVG 1GW4A 1X79B 2P7JA 3EQ2A 1ZXGA 4OWFA 4U3FJ 2A06D 4H44D 2LIWA 3B4QA 2KW2A 1MZ9A 1S3JA 1SVFA 4C7NB 4BPFA 1PIXA 1CSBA 1S4XA 1PPJE 3GF3A 4LLHA 3GKLC 2KSEA 4LC1A 2K3RA 4UB6E 2JYLA 1KV4A 2ERHA 3TGUG 3H1HE 4WVZA 2PEOA 1NTZE 1SLQA 1Z56A 2WSCH 1YQ3C 1GK6A 3PTZA 1FS0E 1RF0A 4GR6A 1HWTC 1D1DA 1R5LA 2BCCJ 2Q1KA 2B87B 2HG5D 4Y28J 3TGUE 2KOSA 3OAKA 5KJ7C 1USDA 5KKZB 2M8NA 3A0BE 2GYKA 2Z44A 2IDBA 2N1TC 3RL0B 1GL2D 2Q5UA 5CCGA 2WMMA 4XFJA 1ZMBA 3M0AA 2WT7B 5KP8B 1Q7YQ 4R4LA 5AW1B 2WSEJ 3AEGC 1BCCJ 2RKLA 3CXCO 3E7KA 4D6TG 2Q9IA 2LL8A 3AEEC 1YYCA 2OYIB 1HJ0A 1PEQA 5H2FH 4W7YA 1U7MA 5CHXA 2K37A 3H1IJ 1E79H 1L0LD 3FX0A 5AVRB 4EI2A 2KORA 1KYOD 1AVYA 3KZIH 4GIFA 3CXHH 2PENA 5DJTB 3E2DA 5APTA 1QGKB 3E1IA 2A06G 2IBZI 3TNUA 2N5IA 2M5AB 1EOQA 1K30A 4D6TE 1KQFB 2WPRA 1N7LA 1KILB 5BU5A 2GM4A 3P32A 1BGYJ 1RHZB 1TU3F 2ZXEB 1LTIC 3SWFA 3P05A 1YJWP 3DTJA 3F89A 2V7QJ 2WQYC 1M1JB 2R5BA 2GUVA 4CPGA 2WT7A 4A7PA 1FZCC 2A06E 3BVHA 4AUWA 1N7SD 1M74A 3G6EP 5CJ0A 4ZMDA 2M8LA 2KG6A 1SQVD 2J5UA 1VQ4P 3LW5H 2MF4A 3L70J 2OYOA 1L4AC 1FOSF 1NKNA 4RO0A 2IFNA 1T8KA 1SQPD 1CW5A 1IFNA 1NU1J 3KHUA 1CI6B 2MJZA 2J58A 3L71D 2DNWA 3GJNA 2JQ4A 2P10A 2HR3A 2O3JA 2E5YA 1FDOA 1DV5A 1AQ5A 5KJ7D 2KZIA 2AXTE 3H47A 2K9YA 1NTKD 1H89A 2XZ1C 1LGHB 2N1TD 2JU1A 1T2KD 2VLPA 5HGMA 7CEIA 2YKOA 4HB1A 1MKMA 1AV1A 3OJAB 3PP5A 2K9JB 5AW4B 4R4MA 4IOIH 4C7RA 2YO3A 5KAIH 5TISH 1GMJA 1L0HA 1L0LG 1T3JA 3HE5B 2BUOA 4HJGH 4HKZH 4COPA 2MD9A 4LGDE 1L0LJ 2QM7A 4YXDC 2GDXA 1VQPP 4GOEA 4COCA 2B88A 2KODA 1LT9B 4DZOA 1VQ7P 3H1JE 3A0BH 3NTNA 3PJSK 3RBXA 1OIPA 1RH5B 5AVQB 1IK9A 2FYUJ 1M6EX 2LXCB 4U0FA 4QMAA 1AUMA 1J2JB 2K94A 4L74A 1PP9G 2FXPA 1U57A 1SQVG 2LTEA 2EFJA 3RK2D 3VMAA 2POHA 1S5LH 1FZEA 2PEIA 3CMEP 1PP9J 2L0QA 2LKIA 3RL0D 3M91A 1L0LK 2JAZA 1KFMA 3JSVC 3AE3C 4IL6E 1SQPG 5TJHA 1M7LA 3R2PA 1YHQP 1VHNA 1SQPJ 2XU6A 3N4XA 4GODA 1ZLLA 4YPCA 1NTME 3L71G 1IZNB 2VLOA 3MGEA 1SFCB 1LT9A 1SQVE 2WSFH 1F80D 3LIDA 4RKUJ 2K2QA 5APQA 3FXDA 5APUA 1PEUA 3L74D 3D71A 3L71J 4I6MC 2A45H 2W6BA 2YXQB 2Z5IA 4WY4B 3MHVA 1L0NE 1VF5C 2QJYB 3B5NC 1NTKG 2VSQA 3U43A 1PFIA 1EDLA 3RBZA 1NTKJ 3AEDC 3PHLA 1KILD 3CC7P 1SQVK 5DJUB 1LP1A 4PV1C 3Q3DA 1ZR4A 1W2BO 3IF4A 5B66E 2R3CA 1ZNVA 3CXHD 2JDIH 5AW9B 2CG5B 1H8AA 4I7ZB 1BE3J 2RMZA 1SQPK 4JF7A 4EDFA 3V5BA 3MD0A 2EG5A 5F2OA 1FZFA 3A0HE 2GDWA 1SQQJ 1LT1A 4Y99C 5JPAA 1NO4A 1YTZI 1Y47A 5DCKA 1JY3P 2D2CD 2ZAEB 3H25A 1GK4A 1UIIA 1MUUA 1PL5A 3D6YA 3V6IA 3FWLA 2LMLA 4OVNF 2ZVNB 2N5HA 1HF9A 3D6ZA 1K05A 2O1JA 3RK3B 1NTKK 1GZLA 1KB9I 1JY3N 2O1KA 1VKUA 4XRQA 3P8MC 5AW8B 2KYVA 3G9RA 2E74B 2YMYA 3HUSB 3C1LA 4TLFA 1G1JA 5B5EE 2HODB 4H0LC 3G4SP 1GPJA 1NVOA 3CLQA 2IYPA 2K0XA 3HD7C 3V2PA 3L75E 2KS1A 1PGQA 3EWKA 1K8AQ 2WVRA 2JB0A 3MUDC 1PEMA 2NPSA 2KUBA 2WZ7A 3MGNA 2CPBA 1PPJD 2N50A 2JP3A 3L74G 3GLMA 4H44C 3L74J 4I2LC 1BXIA 5APWA 2FFDA 2VLQA 2JWAA 2IZ0A 3RL0g 3CL3D 1KD1Q 1LTGC 1E5WA 4NEOA 1VF5D 1FBMA 2JBGA 3JCUE 3ITKA 3WMM0 1NTZD 1HH0A 3N7NA 1RF1A 2PEKA 1BDCA 1KORA 2E75B 1SS1A 2JKVA 3FGAD 3SWYA 1LTJC 4PD4H 3O6QB 4IL6H 3VP8A 2IBZE 3M0DA 2YXRB 4KJMA 1KILE 2I1JA 1D7MA 2KP8A 3CWBD 5APVA 3CXHE 1NKZB 2OYHA 4PD4I 3L72J 3P7KA 2KGAA 1OR5A 3V4WA 1NHLA 1OW6A 2FAEA 1P84I 2ZYGA 1A43A 1RE3A 1GL2C 2YKPA 1SFCD 1RO0A 3CD6P 3CCLP 1JY2O 1H0TA 1EIAA 1YIJP 3GMAA 3LW5J 2PGDA 3MZWB 2FBWC 1LWUC 4WY4D 1PZQA 3KDPB 2P58A 1VQ9P 1X22A 2O01N 2Z45A 3VTPC 1M6NA 4NPDA 2L9FA 1PGJA 2C0WA 3RG6C 3BCCD 4DG9A 1KTMA 1EXIA 3I55P 1PPJG 2OTKE 1VQKP 1URQA 2ROQA 2KB7P 1T6AA 5AW7B 1W5CE 2AEMA 3H1HG 2KI7B 5AVXB 1N73C 3GHGC 3DS1A 1IFPA 3IFMA 1Q81Q 1NTZG 3IR9A 3H1HJ 3QH9A 2XT1A 5B5EH 2NZ2A 4NPEA 1HTLC 2QJPC 1NTZJ 3ABVC 4IFMA 1N7SC 3RK3D 2KNCA 3SFEC 4IFDK 5GTHH 2W83C 4KHXA 4L73A 1H88A 1X8YA 2AVAA 3T97A 5KAIE 3TGUJ 5TISE 1LJ2A 4CA3A 1VPCA 3CWBG 5GTIH 2Y0CA 1X0TA 4F37A 5KP6B 2M3EA 1AFOA 2XZRA 2GZEA 3CCUP 3TYYA 2QJKC 5APXA 3TNUB 2NRGA 3A3YB 1OW7A 1ZW0A 1FAVA 1IFJA 3M9BA 1VQ6P 1X9VA 1RE4C 1NTZK 2KOGA 3JCUH 5AW3B 5KJ7A 3CWBE 1T2KC 1BAJA 1AQTA 2KLUA 2QE7H 2FVFA 2KXPB 3VMZA 2N1TA 5AVSB 2KG8A 1NAYA 2AF8A 1AF8A 1FE6A 1KMIZ 3PRJA 3BCCG 1S5LE 3WUVA 4BRYA 4D6TJ 2A45G 2E76B 2WSFJ 3H1JD 1JY2P 5AVUB 2K5XA 1IUQA 1DEEG 3M9QA 3AEBC 1DD3A 2G3AA 1NQ4A 3VMYA 2MKVA 2ZFCA 3M1MA 1LNQA 1BSNA 3BCCE 3AE6C 2ZXXA 5CCHD 1LTAC 4YTPC 4BXLA 1DX7A 1M8OB 1L2PA 1JNMA 3KPEA 2ITAA 2Y0DA 2L5GB 3H1KD 2GZFA 4PD4D 1ACPA 2DW3A 1IFIA 2N9BA 3W68A 3C9IA 1KLPA 2WPVB 2OTJP 3RK2C 4RJTA 1OWAA 1FZCA 5F2NA 1NTMD 3RL0C 2JO1A 5L8RJ 2O01H 1FJPA 2Q3IA 2HPCA 1LTBC 1QRJA 2KOPA 3GZMA 5I4TG 3L35A 5AVTB 2L22A 1QVFO 1L0ND 3VMXA 2FKWB 3KXDA 1L4AA 3RK3E 1FJKA 2OYIC 3CC4P 3G29A 1KB9E 3G71P 4H2WC 4U0AA 3SSUA 1OVUA 2FYZA 1M57D 1OX3A 2QRXA 1KN7A 4QNBA 1T8ZA 3P8CD 2FYNB 4N78E 1IJDB 1PEOA 1OW8A 2BHVA 5HGNA 3EFGA 1KILC 2Y9ZA 1DNYA 2ZT9B 3G21A 3DS2A 4MN4C 1JMBA 1M1JC 1ZR2A 3NY7B 3CX5H 2FQ1A 3H1JG 5CCGD 4K35A 1QVGO 4ASWA 3H1JJ 1YQ4C 2AEFA 2N6YA 3G1IA 2D2CC 2GUSA 4PXHB 4MRTC 3CX5I 2HLOA 4PWVB 1EZVI 1FZBA 3Q5RA 5BU8B 2K92A 1KZUB 3H1KG 2Q3EA 3L75D 2LR2A 1FOSE 3L73D 3S1KA 3AECC 4EYYQ 3B4SA 3HZQA 1NH4A 5KLVE 3WUTA 1NTMG 1GD2E 1JM0A 1LP1B 2LPKA 3NFQA 1UIXA 1K73Q 1NTMJ 2I8DA 3KQGA 5CJ4A 1SQVJ 3ZDMA 1G1IA 1XTCC 1YJNP 1L0NG 3NXSA 3H1KE 4PD4E 1L0NJ 3C8VA 3H1LD 1WT6A 2AFEA 3MP7B 2E76D 2FYUE 1Y8AA 1S72P 1EDJA 1S2EA 1NWQA 5KLIC 4M3LA 2Z5HA 2JU2A 3DS5A 3II6A 3B5NA 3RG2A 2IBZD 1USEA 1ZMEC 3FWNA 4W7ZA 1NTMK 1JCCA 1RNIA 3GF7A 3WU2E 3H4EA 3CCQP 2ZJSE 3TK1A 5CZDB 3U1CA 3P8CE 1L0NK 1SQXD 4C46A 2KS1B 2YO2A 4PH0A 3A7OA 3A5TA 2EHTA 4L76A 4XFYA 1RQVA 5EFWB 2JYGA 1KB9H 2WPTA 4H13B 4U0BA 2P2UA 2NPSB 4AQRD 1KQSO 1JMMA 1SP4A 2V7QH 2YMKA 2MVVA 3CMAP 1XTGB 1ZP0C 5AVVB 1WRGA 2MR7A 2FFDB 3L75G 3L73G 2K1AA 1SFCC 2FXOA 3L75J 1NOHA 2GDYA 3I56P 4WY4C 1RF1B 3CC2P 1OVVA 2AXCA 2QJYC 4DT0A 3AE4C 1SQBE 2WSCJ 2Y9YA 2JO0A 2H43A 2IFMA 1IO4A 1EMVA 5GTHE 2N6ZA 3L73E 2FQ2A 3S4RA 3HD7A 1Q2NA 3L37A 2PEQA 2ZT9D 3H1LG 3TF5A 1GXHA 2KG9A 1RQUA 3U1AA 2K93A 1S5LX 2JWDA 2IX7C 3MUDA 5GTIE 1T3UA 4I7ZC 5F2KA 2WWWA 2JGPA 3Q5PA 2FVAA 1FR2A 5APSA 2OYHB 4QKOA 1FZGA 4ZNCA 2QNWA 3DPHA 4ASVA 3DS0A 1JUNA 2IBZG 3H1LE 3E1RA 3CX5D 2BEQD 2SPZA 1H0TB 5AW2B 1CZQA 3RK3C 3AE8C 1Q86Q 4OGQB 3H32A 2K0DX 4N6JA 2RN0A 4XFZA 1SQXG 1HQBA 2E74C 4W80A 4HKGA 3HUSC 2K0YA 3CCMP 3RGUA 1AYIA 1BSHA 1LTJA 3H6PA 3V4QA 1AVOA 1S9KD 1FDMA 4AYCA 1P84H 3CCEP 1J1EB 1KYOI 4I1LA 2YIUB 1URQB 1J1DB 1IFDA 2PAJA 1EXJA 2IYOA 1YITP 1SQXE 2BEZF 4PJ0E 1KC8Q 1K9MQ 2G8YA 1A02F 2WSSH 3B71A 3VP9A 2Q6QA 3CI9A 1CEIA 3VRLC 4DJGA 1GW3A 3CCSP 1X3OA 2O01J 2BASA 1GL2A 2BCCD 3GHGB 2KOQA 3WU2H 1GDTA 1SQXK 2HYNA 1ZRTD 1G2CB 2Q7CA 1LWUA 3NTEA 2KNCB 2B9BA 2IZ1A 2E5TA 4XROA 3HE4A 2AEJA 1NJIQ 2VRSA 1LTSC 3T97B 1Q90D 5CBOA 2E75C 4RESB 3DS4A 2R44A 1GTWA 2R3SA 1BCCD 1A02J 3OA7A 5HV8A 2KGDA 4ZKPA 1OMIA 1VQMP 2QM8A 1UJZA 1UNKA 2M0BA 5CCHC 4H13D 1KQLA 1JO5A 2DGYA 3H1ID 2NPSD 3LRYA 2PEJA 1VQ8P 3Q2YA 4XA4A 1E6JP 1FDIA 1N73A 3L36A 3GHGA 3D70A 4IPYA 2B89A 1W2EA 2N1TB 1G2CA 4U0DA 5AVYB 2GZJA 1N7SA 1KB9D 2CNRA 1BGYD 2E74D 3HTKB 3LMOA 1KQGB 4BRYB 3CX5E 3TSIA 4Z1MH 1Y9BA 1VL2A 4KT0J 3AE2C 4U3FE 1IMPA 1EZVE 2FACA 2KGEA 4N78D 3S9OA 2M8RA 3CWBJ 1MZ8A 3BATA 4IL6X 3UIAA 3L70D 2QVAA 1HBWA 1N8RQ 3MTUE 1HGZA 2Y0EA 4JPZB 5K5GB 5E79H 1RF0C 2QA4P 1S9KE 2UWJE 3EJDA 4IZ6A 2BCCG 1RE4A 3GZLA 4WYMA 1NU1D 2W6JH 1YJ9P 4UHPB 4YXWH 4K3AA 5AW0B 4C7NA 1FZCB 3RK2B 2QG4A 2LKMA 5CCGC 3G1GA 3HTKA 1R8EA 3IAOA 1OVRA 5HGOA 2HPCB 3BCCJ 4OGQD 2BCCE 2X2BA 3EJBA 2FY8A 1BCCG 2E75D 1L4AB 1ZRTE 1FU1A 1VQOP 3CCJP 2FHSC 4PJ0H 3I5CA 1JY2N 3WBHA 3A2AA 2E43A 5KLVD 2H8PD 3H1IG 1Q82Q 3FXEA 2PP6A 5EW5E 5CBNA 3BASA 4UB8H 2KLVA 1URQD 1IC2A 1EQ7A 4U0EA 2GZIA 2YKQA 1BCCE 2J59M 2B87A 3CPWO 3MIWA 2Z46A 2AFDA 1BGYG 5KKZC 4GT1A 4XFXA 2LXBA 2KSJA 1OZHA 1P84D 3H1IE 3CXHI 2FYUD 4GDOA 1JEKA 2C9LY 1EDKA 4OH8B 4PH1A 3G28A 3LIEA 4GKGA 3SWKA 3Q5SA 1DEBA 3L70G 5HVCA 1OXZA 1PP9D 1BGYE 1K04A 2H7HA 2E76C 2OYIA 2D2CB 1VQNP 3F5HA 2JJLA 3AE5C 3K5BA 3HRNA 1NU1G 3AE1C 5AW6B 2C0XA 2M5AA 3L70E 1VQLP 5CMZA 3M06A 1JB0J 1KILA 3IN6A 4L75A 1JTHB 3R4YA 2C9NY 2P1JA 2NO8A 4R0MA 1M1JA 3O8ZA 2W6AA 1NU1E 2LOLA 3W67A 2CWOA 1YTZT 1JOCA 4UB6H 2W90A 4IFFA 3V2QA 1JY3O 5KLVG 2GA1A 2W8ZA 1RO2A 1BE3D 5KLVJ 1PV3A 2KOOA 5BS2A 1SQBD 1DH3A 1NU1K 4O9BA 2OTLP 5BVZA 1SQQD 2XZ0D 1PGOA 5KLIB 5AW5B 3L4FA 4H2YC 1VF5B 1VDFA 2KZJA 2M5RA 3B5NB 3H1KJ 1CI6A 2P67A 2Z4EA 2WTYA 3H0DA 3AEAC 3NMDA 1BDDA 2FYNC 5APYA 2OQQA 2FYUG 1JTHA 1L0LE 1AJYA 1KYOE 1R5SA 4PV1B 1FZAA 2ZT9C 5HGLA 3VN0A 2MY5A 3G26A 2WPSA 3BRVB 5KLVK 1JCDA 2YNYA 2K9JA 1P84E 5AVWB 1M90Q 1IMQA 2HFED 4Y99B 1DD4A 2KR5A 1KFNA 3HE5A 4WB4A 2LF4A 4XE5B 2KK7A 4DCKA 3HYBA 1L4AD 2WSEH 2XV6A 3CCRP 1EC5A 1HVVA 1LT9C 1PP9E 1S1CX 4H2XC 2ONTA 2R32A 3EFFK 4NPFX 2I1KA 2FYUK 3U59A 1YI2P 4TT3H 4H0LB 1MV8A 1SQPE 5AVZB 1DIPA 2ZYDA 1HUCA 1QEXA 3HD7B 4BPGA 5KAFE 2XV5A 4B86A 3L71E 2A45I 2E42A 4HYTB 3VYIA 1BE3G 4WBAA 2MVUA 4N3YB 2FADA 1SQBG 1PGPA 2K88A 1MFZA 3AE7C 1NTKE 1SQQG 2JR8A 1SQBJ 2FXMA 4H44B 2EHSA 5KTBA 1HJBA 2L91A 4BWNA 4HH2A 4DOJA 1NGMB 2ZYAA 2JEEA 3AEFC 3L73J 2PNGA 4JQ0D 1SFCA 2PY8A 2XDJA 1FC2C 2LIUA 3L72D 3USSA 1QLED 2ZVOB 2EIAA 1VQ5P 1BE3E 4EIJA 4WY4A 3H32B 3Q20A 1QL1A 1E0HA 2AXTH 2GZGA 1QX8A
chains in the Genus database with same CATH topology
1YJ9P 2M8PA 4M0IA 2EG5A 5F2OA 3DPHA 3DS4A 3DS1A 1VQ7P 1Q81Q 1RNIA 2PEOA 1M90Q 1QVGO 1M1KQ 2XT1A 5JPAA 3DS0A 3M1MA 3H4EA 3G1GA 1M74A 3G6EP 3CCQP 5DCKA 1M6EX 2LF4A 2M8LA 4U0CA 5HGOA 3HYBA 3G1IA 1VQLP 4U0FA 1VQMP 4GR6A 1VQ4P 3G0VA 1AUMA 1D1DA 2XV6A 3CCRP 1Q86Q 4PH0A 2DGYA 3LRYA 2PEJA 4XFYA 1VQ8P 1VQOP 3CCJP 4XFZA 2EFJA 2ONTA 1A8OA 4XRQA 2JYGA 1E6JP 2XXMA 2PEIA 4U0BA 3CMEP 3CCMP 2OARA 3WBHA 5BS1A 2OTJP 2CWOA 1KQSO 2M8NA 2P9XA 1Q82Q 3CMAP 2Z44A 4GR2A 5F2NA 2BQ1E 4IPYA 1YI2P 2PEMA 3G4SP 3CCUP 3DS3A 4U0DA 1ZMBA 1A43A 3HZQA 4U0EA 1YHQP 3CCEP 1QRJA 1RO2A 1RO0A 3CD6P 5I4TG 3CCLP 1Q7YQ 1EIAA 1YIJP 1QVFO 2L6EA 3MGEA 3CPWO 3H47A 2Z46A 3CXCO 1K73Q 5BS2A 1YITP 1K8AQ 2QEXP 3I56P 1PEUA 1VQ6P 1JJ2O 3CC4P 3G29A 1PEQA 1PEMA 4XFXA 2OTLP 1VQ9P 5HGMA 3G71P 2Z45A 1YJNP 1KC8Q 1M6NA 1K9MQ 3CC2P 4U0AA 1BAJA 3RG6C 4QNBA 2JO0A 2PENA 3H0DA 3VRLC 3E2DA 3CCSP 4PH1A 3G28A 1N8RQ 3CCVP 3I55P 3B5IA 2E1MA 1VQKP 3CC7P 1EOQA 1PEOA 2PEQA 1S72P 2BUOA 1K30A 2QA4P 4COPA 2BHVA 1KD1Q 5HGNA 2PY8A 1W2BO 3NTEA 1VQPP 3G21A 4COCA 2EIAA 4WYMA 1VQ5P 1VQNP 3DS2A 4XROA 5HGLA 3OW2O 5F2KA 1IUQA 3Q20A 3P05A 1YJWP 3DTJA 3G26A 1NJIQ 2JYLA 2KODA 2PEKA 3DS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL P;  1YJ9 P;  1Q7Y Q;  3CCS P;  1YIJ P;  1VQ8 P;  1VQO P;  3CCJ P;  1QVF O;  1N8R Q;  3CCV P;  3I55 P;  3CPW O;  1VQ7 P;  1Q81 Q;  3CXC O;  3CME P;  1K73 Q;  1VQK P;  1M90 Q;  1YIT P;  1QVG O;  1K8A Q;  1M1K Q;  3CC7 P;  2QEX P;  3CCM P;  3I56 P;  1S72 P;  1VQ6 P;  2QA4 P;  2OTJ P;  1JJ2 O;  1KD1 Q;  3CC4 P;  1KQS O;  3G6E P;  1W2B O;  3CCQ P;  1VQ9 P;  2OTL P;  1Q82 Q;  3CMA P;  3G71 P;  1YJN P;  1KC8 Q;  1VQP P;  1YI2 P;  1K9M Q;  1VQL P;  3CC2 P;  3G4S P;  1VQ5 P;  1VQN P;  1VQM P;  1VQ4 P;  3CCU P;  3OW2 O;  3CCR P;  1YJW P;  1NJI Q;  1YHQ P;  3CCE P;  1Q86 Q;  3CD6 P; 
#chains in the Genus database with same CATH topology
 1U7J A;  3VOP A;  2M8P A;  1GXG A;  2RH0 A;  1SQQ E;  2N98 A;  2H89 C;  1AA0 A;  1RY3 A;  1M1K Q;  1IK7 A;  2W27 A;  2KGC A;  1LTJ B;  1LTT C;  1N86 A;  1HGV A;  2H88 C;  2WIT A;  2M3B A;  4U0C A;  1NAF A;  3G3Z A;  3H1L J;  1NYH A;  2CK3 H;  2FQ0 A;  2CGQ A;  1SQB K;  1QL2 A;  3PLN A;  2QSI A;  1SQQ K;  1GU5 A;  4H13 C;  5C39 A;  2NPS C;  2P9X A;  5E79 E;  3PH0 A;  1IFM A;  5M1B A;  2CPS A;  1GL2 B;  2FFD C;  4U3F D;  1EZV D;  1ZV8 A;  2L4B A;  2OGU A;  4EOT A;  1KYO H;  2XNX A;  1MFT A;  1EDI A;  1LWU B;  1GU4 A;  1JJ2 O;  3H1H D;  3B5N D;  1SQX J;  3HE4 B;  2KWL A;  3HUS A;  3JC2 2;  1RF1 C;  4GOF A;  3M9H A;  3SFD C;  3EJE A;  2HOD A;  3L74 E;  3CCV P;  4PV1 D;  3B5I A;  2E1M A;  2V4H A;  3M0D C;  4ZKU A;  2R5D A;  5EJD A;  1ZN5 A;  3TGU D;  5H2F E;  3OW2 O;  3GW6 A;  4UB8 E;  2OYH C;  3L72 G;  5KP7 B;  3KZI E;  4M0I A;  1M56 D;  1ZOY C;  1N73 B;  2WPQ A;  3WUU A;  3V2N A;  2MR8 A;  2PFX A;  4U7J A;  1HY8 A;  2FVE A;  4JYC A;  2QJP B;  1RE3 C;  4BPH A;  2PRR A;  1N7S B;  2QIW A;  3KYQ A;  3G0V A;  3B8E B;  2XND H;  5KAF H;  4OGQ C;  2KIK A;  3L72 E;  4WWI A;  1A8O A;  1L0I A;  2XXM A;  5B66 H;  1OFC X;  2OAR A;  5BS1 A;  4H0L D;  1YBK A;  3CE7 A;  4GR2 A;  1WMK A;  2BQ1 E;  2N9Y B;  3BRT B;  1Z6M A;  2PEM A;  1N2D C;  3V2R A;  2VLN A;  3O6Q A;  4JYB A;  3DS3 A;  3HD7 D;  2QJK B;  2CQ8 A;  4D6T D;  1J1E C;  2IPP A;  3QWO C;  2YIU C;  3A0H H;  1URQ C;  3AE9 C;  1J1D C;  3Q1M A;  2XKM A;  2L6E A;  3GG2 A;  5CCH A;  4JBZ A;  2QEX P;  4U3F G;  3TDK A;  1EZV G;  1GW4 A;  1X79 B;  2P7J A;  3EQ2 A;  1ZXG A;  4OWF A;  4U3F J;  2A06 D;  4H44 D;  2LIW A;  3B4Q A;  2KW2 A;  1MZ9 A;  1S3J A;  1SVF A;  4C7N B;  4BPF A;  1PIX A;  1CSB A;  1S4X A;  1PPJ E;  3GF3 A;  4LLH A;  3GKL C;  2KSE A;  4LC1 A;  2K3R A;  4UB6 E;  2JYL A;  1KV4 A;  2ERH A;  3TGU G;  3H1H E;  4WVZ A;  2PEO A;  1NTZ E;  1SLQ A;  1Z56 A;  2WSC H;  1YQ3 C;  1GK6 A;  3PTZ A;  1FS0 E;  1RF0 A;  4GR6 A;  1HWT C;  1D1D A;  1R5L A;  2BCC J;  2Q1K A;  2B87 B;  2HG5 D;  4Y28 J;  3TGU E;  2KOS A;  3OAK A;  5KJ7 C;  1USD A;  5KKZ B;  2M8N A;  3A0B E;  2GYK A;  2Z44 A;  2IDB A;  2N1T C;  3RL0 B;  1GL2 D;  2Q5U A;  5CCG A;  2WMM A;  4XFJ A;  1ZMB A;  3M0A A;  2WT7 B;  5KP8 B;  1Q7Y Q;  4R4L A;  5AW1 B;  2WSE J;  3AEG C;  1BCC J;  2RKL A;  3CXC O;  3E7K A;  4D6T G;  2Q9I A;  2LL8 A;  3AEE C;  1YYC A;  2OYI B;  1HJ0 A;  1PEQ A;  5H2F H;  4W7Y A;  1U7M A;  5CHX A;  2K37 A;  3H1I J;  1E79 H;  1L0L D;  3FX0 A;  5AVR B;  4EI2 A;  2KOR A;  1KYO D;  1AVY A;  3KZI H;  4GIF A;  3CXH H;  2PEN A;  5DJT B;  3E2D A;  5APT A;  1QGK B;  3E1I A;  2A06 G;  2IBZ I;  3TNU A;  2N5I A;  2M5A B;  1EOQ A;  1K30 A;  4D6T E;  1KQF B;  2WPR A;  1N7L A;  1KIL B;  5BU5 A;  2GM4 A;  3P32 A;  1BGY J;  1RHZ B;  1TU3 F;  2ZXE B;  1LTI C;  3SWF A;  3P05 A;  1YJW P;  3DTJ A;  3F89 A;  2V7Q J;  2WQY C;  1M1J B;  2R5B A;  2GUV A;  4CPG A;  2WT7 A;  4A7P A;  1FZC C;  2A06 E;  3BVH A;  4AUW A;  1N7S D;  1M74 A;  3G6E P;  5CJ0 A;  4ZMD A;  2M8L A;  2KG6 A;  1SQV D;  2J5U A;  1VQ4 P;  3LW5 H;  2MF4 A;  3L70 J;  2OYO A;  1L4A C;  1FOS F;  1NKN A;  4RO0 A;  2IFN A;  1T8K A;  1SQP D;  1CW5 A;  1IFN A;  1NU1 J;  3KHU A;  1CI6 B;  2MJZ A;  2J58 A;  3L71 D;  2DNW A;  3GJN A;  2JQ4 A;  2P10 A;  2HR3 A;  2O3J A;  2E5Y A;  1FDO A;  1DV5 A;  1AQ5 A;  5KJ7 D;  2KZI A;  2AXT E;  3H47 A;  2K9Y A;  1NTK D;  1H89 A;  2XZ1 C;  1LGH B;  2N1T D;  2JU1 A;  1T2K D;  2VLP A;  5HGM A;  7CEI A;  2YKO A;  4HB1 A;  1MKM A;  1AV1 A;  3OJA B;  3PP5 A;  2K9J B;  5AW4 B;  4R4M A;  4IOI H;  4C7R A;  2YO3 A;  5KAI H;  5TIS H;  1GMJ A;  1L0H A;  1L0L G;  1T3J A;  3HE5 B;  2BUO A;  4HJG H;  4HKZ H;  4COP A;  2MD9 A;  4LGD E;  1L0L J;  2QM7 A;  4YXD C;  2GDX A;  1VQP P;  4GOE A;  4COC A;  2B88 A;  2KOD A;  1LT9 B;  4DZO A;  1VQ7 P;  3H1J E;  3A0B H;  3NTN A;  3PJS K;  3RBX A;  1OIP A;  1RH5 B;  5AVQ B;  1IK9 A;  2FYU J;  1M6E X;  2LXC B;  4U0F A;  4QMA A;  1AUM A;  1J2J B;  2K94 A;  4L74 A;  1PP9 G;  2FXP A;  1U57 A;  1SQV G;  2LTE A;  2EFJ A;  3RK2 D;  3VMA A;  2POH A;  1S5L H;  1FZE A;  2PEI A;  3CME P;  1PP9 J;  2L0Q A;  2LKI A;  3RL0 D;  3M91 A;  1L0L K;  2JAZ A;  1KFM A;  3JSV C;  3AE3 C;  4IL6 E;  1SQP G;  5TJH A;  1M7L A;  3R2P A;  1YHQ P;  1VHN A;  1SQP J;  2XU6 A;  3N4X A;  4GOD A;  1ZLL A;  4YPC A;  1NTM E;  3L71 G;  1IZN B;  2VLO A;  3MGE A;  1SFC B;  1LT9 A;  1SQV E;  2WSF H;  1F80 D;  3LID A;  4RKU J;  2K2Q A;  5APQ A;  3FXD A;  5APU A;  1PEU A;  3L74 D;  3D71 A;  3L71 J;  4I6M C;  2A45 H;  2W6B A;  2YXQ B;  2Z5I A;  4WY4 B;  3MHV A;  1L0N E;  1VF5 C;  2QJY B;  3B5N C;  1NTK G;  2VSQ A;  3U43 A;  1PFI A;  1EDL A;  3RBZ A;  1NTK J;  3AED C;  3PHL A;  1KIL D;  3CC7 P;  1SQV K;  5DJU B;  1LP1 A;  4PV1 C;  3Q3D A;  1ZR4 A;  1W2B O;  3IF4 A;  5B66 E;  2R3C A;  1ZNV A;  3CXH D;  2JDI H;  5AW9 B;  2CG5 B;  1H8A A;  4I7Z B;  1BE3 J;  2RMZ A;  1SQP K;  4JF7 A;  4EDF A;  3V5B A;  3MD0 A;  2EG5 A;  5F2O A;  1FZF A;  3A0H E;  2GDW A;  1SQQ J;  1LT1 A;  4Y99 C;  5JPA A;  1NO4 A;  1YTZ I;  1Y47 A;  5DCK A;  1JY3 P;  2D2C D;  2ZAE B;  3H25 A;  1GK4 A;  1UII A;  1MUU A;  1PL5 A;  3D6Y A;  3V6I A;  3FWL A;  2LML A;  4OVN F;  2ZVN B;  2N5H A;  1HF9 A;  3D6Z A;  1K05 A;  2O1J A;  3RK3 B;  1NTK K;  1GZL A;  1KB9 I;  1JY3 N;  2O1K A;  1VKU A;  4XRQ A;  3P8M C;  5AW8 B;  2KYV A;  3G9R A;  2E74 B;  2YMY A;  3HUS B;  3C1L A;  4TLF A;  1G1J A;  5B5E E;  2HOD B;  4H0L C;  3G4S P;  1GPJ A;  1NVO A;  3CLQ A;  2IYP A;  2K0X A;  3HD7 C;  3V2P A;  3L75 E;  2KS1 A;  1PGQ A;  3EWK A;  1K8A Q;  2WVR A;  2JB0 A;  3MUD C;  1PEM A;  2NPS A;  2KUB A;  2WZ7 A;  3MGN A;  2CPB A;  1PPJ D;  2N50 A;  2JP3 A;  3L74 G;  3GLM A;  4H44 C;  3L74 J;  4I2L C;  1BXI A;  5APW A;  2FFD A;  2VLQ A;  2JWA A;  2IZ0 A;  3RL0 g;  3CL3 D;  1KD1 Q;  1LTG C;  1E5W A;  4NEO A;  1VF5 D;  1FBM A;  2JBG A;  3JCU E;  3ITK A;  3WMM 0;  1NTZ D;  1HH0 A;  3N7N A;  1RF1 A;  2PEK A;  1BDC A;  1KOR A;  2E75 B;  1SS1 A;  2JKV A;  3FGA D;  3SWY A;  1LTJ C;  4PD4 H;  3O6Q B;  4IL6 H;  3VP8 A;  2IBZ E;  3M0D A;  2YXR B;  4KJM A;  1KIL E;  2I1J A;  1D7M A;  2KP8 A;  3CWB D;  5APV A;  3CXH E;  1NKZ B;  2OYH A;  4PD4 I;  3L72 J;  3P7K A;  2KGA A;  1OR5 A;  3V4W A;  1NHL A;  1OW6 A;  2FAE A;  1P84 I;  2ZYG A;  1A43 A;  1RE3 A;  1GL2 C;  2YKP A;  1SFC D;  1RO0 A;  3CD6 P;  3CCL P;  1JY2 O;  1H0T A;  1EIA A;  1YIJ P;  3GMA A;  3LW5 J;  2PGD A;  3MZW B;  2FBW C;  1LWU C;  4WY4 D;  1PZQ A;  3KDP B;  2P58 A;  1VQ9 P;  1X22 A;  2O01 N;  2Z45 A;  3VTP C;  1M6N A;  4NPD A;  2L9F A;  1PGJ A;  2C0W A;  3RG6 C;  3BCC D;  4DG9 A;  1KTM A;  1EXI A;  3I55 P;  1PPJ G;  2OTK E;  1VQK P;  1URQ A;  2ROQ A;  2KB7 P;  1T6A A;  5AW7 B;  1W5C E;  2AEM A;  3H1H G;  2KI7 B;  5AVX B;  1N73 C;  3GHG C;  3DS1 A;  1IFP A;  3IFM A;  1Q81 Q;  1NTZ G;  3IR9 A;  3H1H J;  3QH9 A;  2XT1 A;  5B5E H;  2NZ2 A;  4NPE A;  1HTL C;  2QJP C;  1NTZ J;  3ABV C;  4IFM A;  1N7S C;  3RK3 D;  2KNC A;  3SFE C;  4IFD K;  5GTH H;  2W83 C;  4KHX A;  4L73 A;  1H88 A;  1X8Y A;  2AVA A;  3T97 A;  5KAI E;  3TGU J;  5TIS E;  1LJ2 A;  4CA3 A;  1VPC A;  3CWB G;  5GTI H;  2Y0C A;  1X0T A;  4F37 A;  5KP6 B;  2M3E A;  1AFO A;  2XZR A;  2GZE A;  3CCU P;  3TYY A;  2QJK C;  5APX A;  3TNU B;  2NRG A;  3A3Y B;  1OW7 A;  1ZW0 A;  1FAV A;  1IFJ A;  3M9B A;  1VQ6 P;  1X9V A;  1RE4 C;  1NTZ K;  2KOG A;  3JCU H;  5AW3 B;  5KJ7 A;  3CWB E;  1T2K C;  1BAJ A;  1AQT A;  2KLU A;  2QE7 H;  2FVF A;  2KXP B;  3VMZ A;  2N1T A;  5AVS B;  2KG8 A;  1NAY A;  2AF8 A;  1AF8 A;  1FE6 A;  1KMI Z;  3PRJ A;  3BCC G;  1S5L E;  3WUV A;  4BRY A;  4D6T J;  2A45 G;  2E76 B;  2WSF J;  3H1J D;  1JY2 P;  5AVU B;  2K5X A;  1IUQ A;  1DEE G;  3M9Q A;  3AEB C;  1DD3 A;  2G3A A;  1NQ4 A;  3VMY A;  2MKV A;  2ZFC A;  3M1M A;  1LNQ A;  1BSN A;  3BCC E;  3AE6 C;  2ZXX A;  5CCH D;  1LTA C;  4YTP C;  4BXL A;  1DX7 A;  1M8O B;  1L2P A;  1JNM A;  3KPE A;  2ITA A;  2Y0D A;  2L5G B;  3H1K D;  2GZF A;  4PD4 D;  1ACP A;  2DW3 A;  1IFI A;  2N9B A;  3W68 A;  3C9I A;  1KLP A;  2WPV B;  2OTJ P;  3RK2 C;  4RJT A;  1OWA A;  1FZC A;  5F2N A;  1NTM D;  3RL0 C;  2JO1 A;  5L8R J;  2O01 H;  1FJP A;  2Q3I A;  2HPC A;  1LTB C;  1QRJ A;  2KOP A;  3GZM A;  5I4T G;  3L35 A;  5AVT B;  2L22 A;  1QVF O;  1L0N D;  3VMX A;  2FKW B;  3KXD A;  1L4A A;  3RK3 E;  1FJK A;  2OYI C;  3CC4 P;  3G29 A;  1KB9 E;  3G71 P;  4H2W C;  4U0A A;  3SSU A;  1OVU A;  2FYZ A;  1M57 D;  1OX3 A;  2QRX A;  1KN7 A;  4QNB A;  1T8Z A;  3P8C D;  2FYN B;  4N78 E;  1IJD B;  1PEO A;  1OW8 A;  2BHV A;  5HGN A;  3EFG A;  1KIL C;  2Y9Z A;  1DNY A;  2ZT9 B;  3G21 A;  3DS2 A;  4MN4 C;  1JMB A;  1M1J C;  1ZR2 A;  3NY7 B;  3CX5 H;  2FQ1 A;  3H1J G;  5CCG D;  4K35 A;  1QVG O;  4ASW A;  3H1J J;  1YQ4 C;  2AEF A;  2N6Y A;  3G1I A;  2D2C C;  2GUS A;  4PXH B;  4MRT C;  3CX5 I;  2HLO A;  4PWV B;  1EZV I;  1FZB A;  3Q5R A;  5BU8 B;  2K92 A;  1KZU B;  3H1K G;  2Q3E A;  3L75 D;  2LR2 A;  1FOS E;  3L73 D;  3S1K A;  3AEC C;  4EYY Q;  3B4S A;  3HZQ A;  1NH4 A;  5KLV E;  3WUT A;  1NTM G;  1GD2 E;  1JM0 A;  1LP1 B;  2LPK A;  3NFQ A;  1UIX A;  1K73 Q;  1NTM J;  2I8D A;  3KQG A;  5CJ4 A;  1SQV J;  3ZDM A;  1G1I A;  1XTC C;  1YJN P;  1L0N G;  3NXS A;  3H1K E;  4PD4 E;  1L0N J;  3C8V A;  3H1L D;  1WT6 A;  2AFE A;  3MP7 B;  2E76 D;  2FYU E;  1Y8A A;  1S72 P;  1EDJ A;  1S2E A;  1NWQ A;  5KLI C;  4M3L A;  2Z5H A;  2JU2 A;  3DS5 A;  3II6 A;  3B5N A;  3RG2 A;  2IBZ D;  1USE A;  1ZME C;  3FWN A;  4W7Z A;  1NTM K;  1JCC A;  1RNI A;  3GF7 A;  3WU2 E;  3H4E A;  3CCQ P;  2ZJS E;  3TK1 A;  5CZD B;  3U1C A;  3P8C E;  1L0N K;  1SQX D;  4C46 A;  2KS1 B;  2YO2 A;  4PH0 A;  3A7O A;  3A5T A;  2EHT A;  4L76 A;  4XFY A;  1RQV A;  5EFW B;  2JYG A;  1KB9 H;  2WPT A;  4H13 B;  4U0B A;  2P2U A;  2NPS B;  4AQR D;  1KQS O;  1JMM A;  1SP4 A;  2V7Q H;  2YMK A;  2MVV A;  3CMA P;  1XTG B;  1ZP0 C;  5AVV B;  1WRG A;  2MR7 A;  2FFD B;  3L75 G;  3L73 G;  2K1A A;  1SFC C;  2FXO A;  3L75 J;  1NOH A;  2GDY A;  3I56 P;  4WY4 C;  1RF1 B;  3CC2 P;  1OVV A;  2AXC A;  2QJY C;  4DT0 A;  3AE4 C;  1SQB E;  2WSC J;  2Y9Y A;  2JO0 A;  2H43 A;  2IFM A;  1IO4 A;  1EMV A;  5GTH E;  2N6Z A;  3L73 E;  2FQ2 A;  3S4R A;  3HD7 A;  1Q2N A;  3L37 A;  2PEQ A;  2ZT9 D;  3H1L G;  3TF5 A;  1GXH A;  2KG9 A;  1RQU A;  3U1A A;  2K93 A;  1S5L X;  2JWD A;  2IX7 C;  3MUD A;  5GTI E;  1T3U A;  4I7Z C;  5F2K A;  2WWW A;  2JGP A;  3Q5P A;  2FVA A;  1FR2 A;  5APS A;  2OYH B;  4QKO A;  1FZG A;  4ZNC A;  2QNW A;  3DPH A;  4ASV A;  3DS0 A;  1JUN A;  2IBZ G;  3H1L E;  3E1R A;  3CX5 D;  2BEQ D;  2SPZ A;  1H0T B;  5AW2 B;  1CZQ A;  3RK3 C;  3AE8 C;  1Q86 Q;  4OGQ B;  3H32 A;  2K0D X;  4N6J A;  2RN0 A;  4XFZ A;  1SQX G;  1HQB A;  2E74 C;  4W80 A;  4HKG A;  3HUS C;  2K0Y A;  3CCM P;  3RGU A;  1AYI A;  1BSH A;  1LTJ A;  3H6P A;  3V4Q A;  1AVO A;  1S9K D;  1FDM A;  4AYC A;  1P84 H;  3CCE P;  1J1E B;  1KYO I;  4I1L A;  2YIU B;  1URQ B;  1J1D B;  1IFD A;  2PAJ A;  1EXJ A;  2IYO A;  1YIT P;  1SQX E;  2BEZ F;  4PJ0 E;  1KC8 Q;  1K9M Q;  2G8Y A;  1A02 F;  2WSS H;  3B71 A;  3VP9 A;  2Q6Q A;  3CI9 A;  1CEI A;  3VRL C;  4DJG A;  1GW3 A;  3CCS P;  1X3O A;  2O01 J;  2BAS A;  1GL2 A;  2BCC D;  3GHG B;  2KOQ A;  3WU2 H;  1GDT A;  1SQX K;  2HYN A;  1ZRT D;  1G2C B;  2Q7C A;  1LWU A;  3NTE A;  2KNC B;  2B9B A;  2IZ1 A;  2E5T A;  4XRO A;  3HE4 A;  2AEJ A;  1NJI Q;  2VRS A;  1LTS C;  3T97 B;  1Q90 D;  5CBO A;  2E75 C;  4RES B;  3DS4 A;  2R44 A;  1GTW A;  2R3S A;  1BCC D;  1A02 J;  3OA7 A;  5HV8 A;  2KGD A;  4ZKP A;  1OMI A;  1VQM P;  2QM8 A;  1UJZ A;  1UNK A;  2M0B A;  5CCH C;  4H13 D;  1KQL A;  1JO5 A;  2DGY A;  3H1I D;  2NPS D;  3LRY A;  2PEJ A;  1VQ8 P;  3Q2Y A;  4XA4 A;  1E6J P;  1FDI A;  1N73 A;  3L36 A;  3GHG A;  3D70 A;  4IPY A;  2B89 A;  1W2E A;  2N1T B;  1G2C A;  4U0D A;  5AVY B;  2GZJ A;  1N7S A;  1KB9 D;  2CNR A;  1BGY D;  2E74 D;  3HTK B;  3LMO A;  1KQG B;  4BRY B;  3CX5 E;  3TSI A;  4Z1M H;  1Y9B A;  1VL2 A;  4KT0 J;  3AE2 C;  4U3F E;  1IMP A;  1EZV E;  2FAC A;  2KGE A;  4N78 D;  3S9O A;  2M8R A;  3CWB J;  1MZ8 A;  3BAT A;  4IL6 X;  3UIA A;  3L70 D;  2QVA A;  1HBW A;  1N8R Q;  3MTU E;  1HGZ A;  2Y0E A;  4JPZ B;  5K5G B;  5E79 H;  1RF0 C;  2QA4 P;  1S9K E;  2UWJ E;  3EJD A;  4IZ6 A;  2BCC G;  1RE4 A;  3GZL A;  4WYM A;  1NU1 D;  2W6J H;  1YJ9 P;  4UHP B;  4YXW H;  4K3A A;  5AW0 B;  4C7N A;  1FZC B;  3RK2 B;  2QG4 A;  2LKM A;  5CCG C;  3G1G A;  3HTK A;  1R8E A;  3IAO A;  1OVR A;  5HGO A;  2HPC B;  3BCC J;  4OGQ D;  2BCC E;  2X2B A;  3EJB A;  2FY8 A;  1BCC G;  2E75 D;  1L4A B;  1ZRT E;  1FU1 A;  1VQO P;  3CCJ P;  2FHS C;  4PJ0 H;  3I5C A;  1JY2 N;  3WBH A;  3A2A A;  2E43 A;  5KLV D;  2H8P D;  3H1I G;  1Q82 Q;  3FXE A;  2PP6 A;  5EW5 E;  5CBN A;  3BAS A;  4UB8 H;  2KLV A;  1URQ D;  1IC2 A;  1EQ7 A;  4U0E A;  2GZI A;  2YKQ A;  1BCC E;  2J59 M;  2B87 A;  3CPW O;  3MIW A;  2Z46 A;  2AFD A;  1BGY G;  5KKZ C;  4GT1 A;  4XFX A;  2LXB A;  2KSJ A;  1OZH A;  1P84 D;  3H1I E;  3CXH I;  2FYU D;  4GDO A;  1JEK A;  2C9L Y;  1EDK A;  4OH8 B;  4PH1 A;  3G28 A;  3LIE A;  4GKG A;  3SWK A;  3Q5S A;  1DEB A;  3L70 G;  5HVC A;  1OXZ A;  1PP9 D;  1BGY E;  1K04 A;  2H7H A;  2E76 C;  2OYI A;  2D2C B;  1VQN P;  3F5H A;  2JJL A;  3AE5 C;  3K5B A;  3HRN A;  1NU1 G;  3AE1 C;  5AW6 B;  2C0X A;  2M5A A;  3L70 E;  1VQL P;  5CMZ A;  3M06 A;  1JB0 J;  1KIL A;  3IN6 A;  4L75 A;  1JTH B;  3R4Y A;  2C9N Y;  2P1J A;  2NO8 A;  4R0M A;  1M1J A;  3O8Z A;  2W6A A;  1NU1 E;  2LOL A;  3W67 A;  2CWO A;  1YTZ T;  1JOC A;  4UB6 H;  2W90 A;  4IFF A;  3V2Q A;  1JY3 O;  5KLV G;  2GA1 A;  2W8Z A;  1RO2 A;  1BE3 D;  5KLV J;  1PV3 A;  2KOO A;  5BS2 A;  1SQB D;  1DH3 A;  1NU1 K;  4O9B A;  2OTL P;  5BVZ A;  1SQQ D;  2XZ0 D;  1PGO A;  5KLI B;  5AW5 B;  3L4F A;  4H2Y C;  1VF5 B;  1VDF A;  2KZJ A;  2M5R A;  3B5N B;  3H1K J;  1CI6 A;  2P67 A;  2Z4E A;  2WTY A;  3H0D A;  3AEA C;  3NMD A;  1BDD A;  2FYN C;  5APY A;  2OQQ A;  2FYU G;  1JTH A;  1L0L E;  1AJY A;  1KYO E;  1R5S A;  4PV1 B;  1FZA A;  2ZT9 C;  5HGL A;  3VN0 A;  2MY5 A;  3G26 A;  2WPS A;  3BRV B;  5KLV K;  1JCD A;  2YNY A;  2K9J A;  1P84 E;  5AVW B;  1M90 Q;  1IMQ A;  2HFE D;  4Y99 B;  1DD4 A;  2KR5 A;  1KFN A;  3HE5 A;  4WB4 A;  2LF4 A;  4XE5 B;  2KK7 A;  4DCK A;  3HYB A;  1L4A D;  2WSE H;  2XV6 A;  3CCR P;  1EC5 A;  1HVV A;  1LT9 C;  1PP9 E;  1S1C X;  4H2X C;  2ONT A;  2R32 A;  3EFF K;  4NPF X;  2I1K A;  2FYU K;  3U59 A;  1YI2 P;  4TT3 H;  4H0L B;  1MV8 A;  1SQP E;  5AVZ B;  1DIP A;  2ZYD A;  1HUC A;  1QEX A;  3HD7 B;  4BPG A;  5KAF E;  2XV5 A;  4B86 A;  3L71 E;  2A45 I;  2E42 A;  4HYT B;  3VYI A;  1BE3 G;  4WBA A;  2MVU A;  4N3Y B;  2FAD A;  1SQB G;  1PGP A;  2K88 A;  1MFZ A;  3AE7 C;  1NTK E;  1SQQ G;  2JR8 A;  1SQB J;  2FXM A;  4H44 B;  2EHS A;  5KTB A;  1HJB A;  2L91 A;  4BWN A;  4HH2 A;  4DOJ A;  1NGM B;  2ZYA A;  2JEE A;  3AEF C;  3L73 J;  2PNG A;  4JQ0 D;  1SFC A;  2PY8 A;  2XDJ A;  1FC2 C;  2LIU A;  3L72 D;  3USS A;  1QLE D;  2ZVO B;  2EIA A;  1VQ5 P;  1BE3 E;  4EIJ A;  4WY4 A;  3H32 B;  3Q20 A;  1QL1 A;  1E0H A;  2AXT H;  2GZG A;  1QX8 A; 
#chains in the Genus database with same CATH homology
 1YJ9 P;  2M8P A;  4M0I A;  2EG5 A;  5F2O A;  3DPH A;  3DS4 A;  3DS1 A;  1VQ7 P;  1Q81 Q;  1RNI A;  2PEO A;  1M90 Q;  1QVG O;  1M1K Q;  2XT1 A;  5JPA A;  3DS0 A;  3M1M A;  3H4E A;  3G1G A;  1M74 A;  3G6E P;  3CCQ P;  5DCK A;  1M6E X;  2LF4 A;  2M8L A;  4U0C A;  5HGO A;  3HYB A;  3G1I A;  1VQL P;  4U0F A;  1VQM P;  4GR6 A;  1VQ4 P;  3G0V A;  1AUM A;  1D1D A;  2XV6 A;  3CCR P;  1Q86 Q;  4PH0 A;  2DGY A;  3LRY A;  2PEJ A;  4XFY A;  1VQ8 P;  1VQO P;  3CCJ P;  4XFZ A;  2EFJ A;  2ONT A;  1A8O A;  4XRQ A;  2JYG A;  1E6J P;  2XXM A;  2PEI A;  4U0B A;  3CME P;  3CCM P;  2OAR A;  3WBH A;  5BS1 A;  2OTJ P;  2CWO A;  1KQS O;  2M8N A;  2P9X A;  1Q82 Q;  3CMA P;  2Z44 A;  4GR2 A;  5F2N A;  2BQ1 E;  4IPY A;  1YI2 P;  2PEM A;  3G4S P;  3CCU P;  3DS3 A;  4U0D A;  1ZMB A;  1A43 A;  3HZQ A;  4U0E A;  1YHQ P;  3CCE P;  1QRJ A;  1RO2 A;  1RO0 A;  3CD6 P;  5I4T G;  3CCL P;  1Q7Y Q;  1EIA A;  1YIJ P;  1QVF O;  2L6E A;  3MGE A;  3CPW O;  3H47 A;  2Z46 A;  3CXC O;  1K73 Q;  5BS2 A;  1YIT P;  1K8A Q;  2QEX P;  3I56 P;  1PEU A;  1VQ6 P;  1JJ2 O;  3CC4 P;  3G29 A;  1PEQ A;  1PEM A;  4XFX A;  2OTL P;  1VQ9 P;  5HGM A;  3G71 P;  2Z45 A;  1YJN P;  1KC8 Q;  1M6N A;  1K9M Q;  3CC2 P;  4U0A A;  1BAJ A;  3RG6 C;  4QNB A;  2JO0 A;  2PEN A;  3H0D A;  3VRL C;  3E2D A;  3CCS P;  4PH1 A;  3G28 A;  1N8R Q;  3CCV P;  3I55 P;  3B5I A;  2E1M A;  1VQK P;  3CC7 P;  1EOQ A;  1PEO A;  2PEQ A;  1S72 P;  2BUO A;  1K30 A;  2QA4 P;  4COP A;  2BHV A;  1KD1 Q;  5HGN A;  2PY8 A;  1W2B O;  3NTE A;  1VQP P;  3G21 A;  4COC A;  2EIA A;  4WYM A;  1VQ5 P;  1VQN P;  3DS2 A;  4XRO A;  5HGL A;  3OW2 O;  5F2K A;  1IUQ A;  3Q20 A;  3P05 A;  1YJW P;  3DTJ A;  3G26 A;  1NJI Q;  2JYL A;  2KOD A;  2PEK A;  3DS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...