3CCJP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 42
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ccjP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ccjP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ccjP02
3OW2O 1K73Q 1VQLP 1Q86Q 1VQPP 2QA4P 1Q81Q 1VQKP 3I55P 3G6EP 1YIJP 3CCQP 2OTJP 3CMAP 1VQ9P 3CC2P 1VQ5P 1KD1Q 1N8RQ 1VQMP 3CCRP 1M1KQ 1W2BO 3CCSP 3CCJP 1YITP 1K8AQ 1S72P 3CC4P 3CCVP 3CD6P 3CXCO 3CCMP 1VQ6P 1YHQP 1YJNP 2QEXP 1YJ9P 1VQ8P 1VQ4P 1Q7YQ 1QVGO 1JJ2O 1Q82Q 3CCEP 3G71P 3CCUP 1YI2P 1KC8Q 1KQSO 3CMEP 1VQ7P 3CPWO 3CCLP 3G4SP 1YJWP 3CC7P 3I56P 1M90Q 1K9MQ 1NJIQ 2OTLP 1VQNP 1VQOP 1QVFO
chains in the Genus database with same CATH superfamily
2PP6A 3VMXA 3AE7C 2WVRA 3H1LD 1KILD 1JY2N 1JCCA 1GPJA 2L6EA 2W27A 2FKWB 2EFJA 1G1IA 3AE3C 2YO2A 4IFDK 2WT7A 1WT6A 1SVFA 4U3FG 3SWKA 2PY8A 1FDIA 3TNUB 2KGEA 2ITAA 5CJ0A 2JU1A 1RY3A 1X3OA 5B5EE 2LF4A 2MVVA 1SQQJ 3L70G 3AECC 1J1EB 4KT0J 3W67A 2ZXXA 3L75J 4NPDA 2FQ0A 4D6TD 2XKMA 1RE4C 2RH0A 2NRGA 3AEFC 4C7NA 3Q5PA 3G4SP 2W6JH 5HGLA 3G28A 1RF1C 1N73C 2YIUC 1S1CX 2VLNA 4C7RA 1LWUA 2GZFA 5K5GB 3CMAP 1TU3F 3P8CE 2K88A 1OXZA 2B89A 2N1TC 4H13B 3A0BE 2GUVA 2XV5A 1YJNP 4L76A 1KB9I 3KDPB 3GKLC 2ZVNB 4XA4A 2KZJA 2GA1A 1IFIA 2A06G 2MY5A 4EYYQ 1KORA 1NHLA 3C9IA 1PGOA 1KILA 2M8PA 4GOEA 1KYOE 4TLFA 2K94A 3P05A 4H2WC 1MFZA 5KJ7D 3H1JG 4OVNF 2QSIA 3M9QA 3H25A 3GZLA 4UHPB 2EIAA 1FZGA 4HH2A 2WQYC 5BU8B 1M6NA 2GZEA 1AUMA 1HGZA 1ACPA 1PV3A 4PJ0E 3P32A 1DNYA 2FYNB 2BQ1E 1GK6A 2BASA 1NU1J 3IF4A 1IMQA 1IC2A 1GW4A 3DS3A 1NU1E 2FYUK 4EDFA 1YYCA 3UIAA 2HR3A 2KNCA 1VF5B 3Q1MA 3L37A 3CWBD 2H43A 2Z44A 2OTKE 2KLVA 5CBOA 3IN6A 2WZ7A 2IFMA 4ZKPA 5BS2A 1DD3A 2KGDA 2I8DA 2KB7P 2E42A 5KJ7A 1S5LX 1OVVA 3HD7C 2O1KA 1KC8Q 1SQXE 1NTMG 2LPKA 4PD4H 1RH5B 4ZKUA 1W2EA 3CX5I 2IBZE 2KW2A 2O3JA 2QJYB 4H13C 5AVWB 1L4AB 1P84E 5APUA 3B5NB 5F2KA 3D6YA 2JAZA 3OAKA 1AQTA 3EFFK 2CNRA 3EJDA 3MP7B 3RGUA 2V7QJ 1ZXGA 3GMAA 1HUCA 1LP1B 2PEMA 5E79E 3FX0A 1PPJD 1A43A 1PP9D 2KG9A 3H1LJ 2Q3EA 2L22A 2L9FA 1BE3D 3F5HA 2ZAEB 2WPSA 3H1LE 1IFNA 1KILE 4DOJA 4Y28J 3MD0A 2OYOA 1OR5A 4U0BA 5C39A 3GJNA 3TDKA 1JY2O 2OARA 1LJ2A 3V2RA 3GHGB 2OGUA 3TGUG 1OW7A 2W6AA 1ZMBA 5AW9B 1R8EA 1PEMA 1VQ9P 5AVYB 4D6TE 5AW2B 2LR2A 3L36A 1SQBD 3A7OA 1X0TA 4IFMA 2N98A 1JEKA 2ONTA 1NTZD 1JNMA 3M91A 1UIXA 1ZRTD 1LTTC 5TISH 1GU4A 1VF5C 2M5RA 3HE5A 2CPBA 2FVEA 3WU2E 2KUBA 2D2CD 1FJKA 1LT9A 3VMAA 1ZP0C 2MD9A 2L91A 1YQ3C 2XU6A 3AEDC 4WY4D 4XE5B 2E75D 3VMYA 1T3UA 1FDMA 3CCUP 3EWKA 2SPZA 1S5LH 3CX5D 1MKMA 3M0DA 2FY8A 2JR8A 4OGQD 3TGUD 2IYOA 2KG6A 2C9NY 1M1JA 5APWA 1FE6A 3JC22 4Y99B 4QKOA 3MGNA 2Q1KA 2ZVOB 2BCCD 1Q90D 5HV8A 1NTKJ 1SQQG 2Z5HA 2KI7B 3WMM0 3L75G 2QJYC 3KHUA 2LXBA 1L4AC 1NVOA 1GW3A 1X8YA 1VQLP 3B5NC 2A45I 4OWFA 5CCGD 1VPCA 1HQBA 3L73J 4C7NB 3H0DA 2E43A 1G2CA 2L5GB 1L0ND 1SLQA 3ABVC 4TT3H 2I1KA 1RF0C 3HUSA 4GIFA 2ZYGA 3NXSA 1PIXA 1Q2NA 1SFCC 1PEUA 2K92A 3EJEA 3BATA 1SQVD 1URQD 2P58A 3H32A 1A8OA 4WY4A 3BVHA 4BPFA 1EDLA 2QJKB 2K9YA 3CWBE 4R4MA 1EIAA 1RO0A 1M74A 3GG2A 3GHGC 4ZMDA 3M1MA 1MZ8A 3A2AA 3CI9A 1FOSF 1T2KC 5B5EH 1YHQP 2A45G 4N6JA 2PAJA 3RK3D 4BPHA 1NJIQ 4N3YB 2ZJSE 1BSNA 2E5YA 4GOFA 5CCGA 1SP4A 3M9HA 2OQQA 2VLPA 2AXTE 1BGYD 1OMIA 5AW0B 4W7ZA 1YI2P 1SQPG 1M7LA 3A0BH 2KWLA 5AW6B 1JTHB 1QRJA 1URQA 1T8KA 2ZFCA 4DJGA 2OTJP 1S4XA 1S9KD 1PPJE 4Y99C 1BE3J 3CC4P 2KNCB 1PP9E 1Z56A 2CG5B 5GTHE 1QVGO 4QNBA 1BE3E 1EXJA 1KYOH 3CPWO 1J1DB 1FS0E 2K37A 1M56D 2LKIA 1L0LD 1WRGA 1FZEA 2P67A 2XNDH 3V2QA 2WITA 1XTGB 1RHZB 4GR6A 3CXHD 1NU1K 2M3EA 5APYA 3MUDA 3H1ID 2IX7C 1RE3A 1CZQA 3B71A 1K73Q 4U0AA 4B86A 1SQBE 1GL2B 3BCCG 4COPA 1VQ5P 1NTZE 3L74D 1K8AQ 3R4YA 4LGDE 3WUTA 1A02F 1BXIA 1ZRTE 1AYIA 3OJAB 4R4LA 2QJKC 1AVYA 4JBZA 4AYCA 2JB0A 4K3AA 4EIJA 3JCUH 4A7PA 2W83C 5AVQB 3TYYA 1NWQA 4WWIA 2WSSH 1SS1A 3VP8A 2Y9ZA 2H89C 3CX5E 1ZNVA 3CXHH 3TGUE 4OH8B 3AEGC 3VN0A 2GDWA 3U1AA 1N7SB 4GR2A 1KQFB 2HPCB 3BASA 3EQ2A 5CCHD 2Z46A 1QL2A 2BCCE 3VMZA 2O01H 3B8EB 2EHTA 3CCSP 5CJ4A 1AVOA 2YMKA 1UJZA 2XZ0D 4AUWA 1Q7YQ 3G71P 2IDBA 1OWAA 2Q5UA 1HVVA 1P84H 2UWJE 3O8ZA 1L0NE 3RK2B 5HGNA 2JU2A 1AJYA 3L72D 4H44B 3HD7B 2DNWA 3AE6C 1NOHA 1ZLLA 2XV6A 1JY3P 3HTKB 5DJUB 2AFDA 1SQVE 2OYIA 5E79H 2Y0DA 2V7QH 1FZCA 4HKGA 1LT9B 3C8VA 5KLVD 1RQUA 1J1DC 1OVUA 2JWAA 2N50A 4JYCA 2QJPC 1RO2A 2L4BA 4XRQA 2C9LY 2DW3A 3QWOC 2RKLA 3MHVA 4U3FD 2VSQA 2MKVA 5CCHA 1H0TB 3G6EP 3CCQP 3TK1A 1F80D 2IZ1A 1ZMEC 3L70D 1GL2C 1KMIZ 2FYUG 2Y9YA 3SWYA 3RK3E 2QVAA 3L73G 1AV1A 1HWTC 1YJWP 3PH0A 4H0LB 1G2CB 2IPPA 3V5BA 4QMAA 2HODA 4BRYA 2LL8A 1BGYE 5AW5B 2K9JA 3P7KA 5KTBA 4JPZB 3WU2H 1LNQA 2N1TD 3B4QA 4N78D 5BU5A 1KN7A 2OYHA 4DG9A 2KS1A 1JO5A 2OTLP 3L71G 1GK4A 2CWOA 3N7NA 2A06D 3HE4B 3PP5A 1S9KE 2KYVA 1NTKK 1S2EA 4PWVB 1N7SC 5JPAA 1FR2A 1DD4A 1PGQA 3AE5C 4YXWH 5APSA 2NPSB 2JWDA 1UIIA 2Q9IA 2ZYDA 3JCUE 4YXDC 2WTYA 2AEJA 3G21A 3K5BA 1L0LE 1HJBA 3H1JD 2M0BA 1VQKP 3H1KG 4PXHB 2JYGA 2KGAA 1NKNA 3HZQA 2M8RA 2KR5A 3H1IJ 2CQ8A 3AE8C 1T3JA 3RK2C 3CXHE 1LGHB 2KK7A 2P2UA 1KZUB 3H1IE 1SQXJ 2O01J 4H44C 1FOSE 1BCCG 1EOQA 2QNWA 2FADA 4W80A 3E7KA 3O6QB 1RF1A 3L74E 1PFIA 1N73A 3KYQA 3RG2A 3LMOA 1GZLA 1KB9D 1LT9C 3DS4A 2KGCA 3AE4C 3CCJP 2N1TA 4IPYA 3FWNA 1W5CE 4Z1MH 1LTJB 2AXCA 2KIKA 3HYBA 1N86A 4GT1A 5AW3B 3H1KD 1L2PA 2K0YA 2KOPA 1U7JA 3L35A 2WWWA 1NH4A 2PFXA 2JGPA 1Y47A 1QEXA 3KQGA 2N5HA 2AEFA 2FHSC 2YKOA 3GZMA 5CHXA 2M5AA 1HY8A 1SFCB 1FZBA 5AW7B 2Y0EA 1JMMA 4H2YC 3U59A 4NEOA 2PEIA 1NTMD 2IYPA 4H0LC 2PEOA 1KB9H 2EHSA 1IFMA 3BRVB 3M06A 5KAIE 5DCKA 3CD6P 2J58A 3A0HE 2FYZA 2N9BA 1QGKB 2KLUA 2KOQA 1R5LA 2AXTH 3PJSK 4H13D 3VTPC 4L73A 2BEZF 2YKPA 3L72J 4D6TJ 4IL6X 4PV1B 3H1HG 2E76B 3HRNA 5BVZA 3L72E 3JSVC 1ZW0A 4ASWA 2JYLA 5KLVJ 1EZVG 3MZWB 2PEKA 1A02J 2YXQB 1K04A 2NPSC 1D7MA 1L0IA 1OX3A 1U57A 5KLVE 4UB8E 2KZIA 3AEAC 5GTHH 4IZ6A 3OA7A 2ZT9B 4RO0A 2W8ZA 2WPRA 3II6A 4DT0A 3TNUA 1SQBK 3RL0B 3G26A 1NTZK 1OIPA 2E1MA 2HG5D 4U3FE 3ITKA 2H88C 3L70E 2GM4A 2B87A 2YO3A 3M9BA 1RQVA 4I1LA 1IUQA 2WT7B 3CCMP 2AEMA 4UB6E 1PEQA 3CCEP 1CW5A 1KFNA 1LTJC 2H7HA 2M8LA 2DGYA 1LTGC 1NGMB 1VF5D 1KD1Q 5HGMA 4W7YA 4N78E 3IR9A 1CEIA 2OYIB 1FDOA 2P7JA 2A06E 5H2FE 1LWUB 3EFGA 4HJGH 1VQOP 1E79H 3CX5H 3F89A 5KP8B 2J59M 1IMPA 1IJDB 2KXPB 5B66E 2E74B 4WVZA 1GDTA 1MFTA 1OW6A 4M3LA 1L0NK 3DS5A 2MF4A 3VYIA 3CWBJ 3H1JE 2LIWA 3MUDC 1SQQD 2QG4A 3L75D 3I56P 1M90Q 1JCDA 1BAJA 3MTUE 5EW5E 1KILB 1L4AD 1SQVK 4IFFA 4YTPC 3DS0A 1FJPA 4PV1C 2KSJA 3B5ND 2E76C 2XZRA 2RN0A 3AEBC 1DV5A 5AVSB 2WMMA 3LIEA 2WSCH 4BRYB 1KB9E 5KAFH 2K9JB 1FC2C 1KQGB 1EMVA 2Z4EA 1SFCD 3V4QA 2YKQA 1W2BO 2ZT9C 3NMDA 1HF9A 1Z6MA 3D71A 3RL0C 2R5DA 1VQ8P 1N7LA 1NU1G 2P9XA 2JBGA 1EC5A 3H1KE 3G29A 2C0WA 1X79B 5EFWB 5APVA 2JO0A 1PP9J 2X2BA 2N9YB 1NTMJ 2PGDA 1E0HA 1DEBA 1T2KD 4U0DA 2WPTA 1NTME 1VHNA 2FXPA 2G3AA 2ZYAA 1GU5A 2GUSA 1SQXG 2MVUA 3B5NA 3S1KA 2QJPB 4RESB 1KQLA 1S72P 3H6PA 1PGJA 2IBZG 2JP3A 3G1IA 3PLNA 3Q3DA 2VRSA 2OYIC 1RF0A 1LP1A 3CMEP 1SQPD 3CL3D 1R5SA 2ZXEB 1SQBJ 2FFDA 1LWUC 1NTZJ 3ZDMA 2QRXA 3A3YB 3CC2P 1CI6A 2JEEA 3V4WA 4GODA 4I2LC 3CCRP 3SFDC 4L74A 3A5TA 2E74C 2JJLA 1M6EX 3CCVP 2I1JA 4JQ0D 2Q7CA 3DS1A 3C1LA 3SWFA 1OFCX 2A45H 3B4SA 5CCHC 3G9RA 1Q81Q 1QVFO 1GD2E 3Q20A 3H47A 1SQXK 2P1JA 1VKUA 1KILC 3H1LG 2B9BA 1DX7A 4KJMA 2Q3IA 3TGUJ 1IFPA 2CK3H 3S4RA 2N5IA 2YNYA 1JUNA 2FVFA 2BCCJ 1Q86Q 1OW8A 2BEQD 2KORA 1T8ZA 2FXMA 3BCCD 1DH3A 4H2XC 1PL5A 4WBAA 2O1JA 4EOTA 2CPSA 2QEXP 5L8RJ 1EDKA 3VRLC 3G0VA 2R3CA 1NKZB 3DTJA 4MN4C 2GDXA 2K3RA 4IL6E 1VQNP 1L0NJ 2XZ1C 2GYKA 5CZDB 3IFMA 1JY2P 4XFZA 4XROA 3PRJA 3RL0g 3GF7A 2WSCJ 2JQ4A 2HFED 1VDFA 4JYBA 1LTSC 4PD4I 3SFEC 7CEIA 1MV8A 1ZR2A 4I7ZB 1SQVJ 5KAFE 3HE5B 3RBXA 3T97A 1YQ4C 4ZNCA 5AVTB 1JY3N 3P8MC 1YBKA 1T6AA 5BS1A 1S3JA 1GTWA 1SQQE 3CXCO 2QIWA 5KJ7C 5I4TG 3L75E 2POHA 4NPFX 2KOOA 1YTZI 4NPEA 2KSEA 5KAIH 2B87B 1M1JB 4I6MC 3A0HH 5APQA 4BWNA 3DPHA 5KLVK 1NTKG 1Y8AA 2NO8A 1D1DA 1M8OB 2QM7A 4CA3A 3S9OA 1E5WA 1AF8A 3AE9C 2FXOA 1HTLC 2N6YA 1K30A 1JM0A 2FQ1A 2XT1A 2IZ0A 2Z5IA 3GLMA 1BGYJ 3V6IA 1YIJP 4XFJA 1M57D 4UB8H 5CMZA 1K05A 1QL1A 4HYTB 3NTNA 3WUVA 3HUSB 3SSUA 2FBWC 2NZ2A 2D2CB 2MR8A 3RG6C 2VLQA 1KFMA 1OVRA 3Q2YA 3H32B 3CWBG 2E5TA 4WY4B 1NTKD 1RNIA 2E75B 5KLIB 3GF3A 4KHXA 2EG5A 5EJDA 4OGQB 4IOIH 1L0LJ 2FYUD 1USDA 1GL2D 1PEOA 2B88A 4EI2A 2XNXA 3L73D 2ERHA 4UB6H 4PD4D 3MGEA 1JTHA 2KG8A 1SQPJ 2FACA 5TJHA 3LIDA 2C0XA 1YJ9P 1SQPE 5AVZB 4DCKA 1JJ2O 2KOGA 1RE4A 1WMKA 4CPGA 4I7ZC 4RKUJ 3PTZA 3AE2C 3L74J 1QX8A 3L71D 1HH0A 3I5CA 5H2FH 4GDOA 5GTIE 3BRTB 1MZ9A 2K1AA 2WSEH 1H8AA 1J1EC 1N7SD 5CBNA 3WBHA 3LW5H 5B66H 1PPJG 3KZIE 1PP9G 4YPCA 1URQB 3M0DC 2HYNA 1BE3G 2LKMA 1EXIA 1JMBA 1M1JC 1VQPP 2FAEA 3D6ZA 1EZVI 2BUOA 2LOLA 1KTMA 4U0FA 2W90A 1GL2A 2K0DX 2LXCB 5APXA 1IZNB 2V4HA 3RK2D 3BCCJ 1BCCD 2WSFH 1K9MQ 1BDDA 4H44D 3HD7D 3GW6A 3BCCE 4U7JA 5AW8B 3NY7B 3R2PA 2M8NA 2JDIH 2XXMA 1IK9A 1SQBG 3AEEC 3RK3B 1NTZG 2N6ZA 4WB4A 2GZJA 4COCA 3G3ZA 3HUSC 2FFDB 1UNKA 2Z45A 2CGQA 5HGOA 5KKZB 1CI6B 2ROQA 3N4XA 2D2CC 1NTMK 3W68A 1H89A 1JB0J 5M1BA 2GZIA 1X22A 4WY4C 1ZR4A 2E75C 1N7SA 3L4FA 1USEA 5KLIC 2HPCA 1IO4A 1VQ4P 4OGQC 2RMZA 4AQRD 1HJ0A 3H4EA 1KQSO 2FQ2A 3MIWA 2PENA 1U7MA 5HVCA 3USSA 2FYNC 4M0IA 2BCCG 2W6BA 1JY3O 4H0LD 4U0EA 4U3FJ 2AVAA 2K0XA 2K93A 1Y9BA 2P10A 2MJZA 2WPQA 4XFYA 3HD7A 3L70J 1NAYA 2IFNA 1J2JB 5CCGC 1NAFA 4C46A 1L0HA 1ZN5A 1LT1A 3HTKA 3H1HD 2O01N 1KYOI 3WUUA 1N8RQ 2PEJA 1L0NG 3Q5SA 1MUUA 1EZVD 1JOCA 4O9BA 2R32A 3CC7P 2NPSD 3KPEA 1URQC 4L75A 5AVUB 1SQVG 2LTEA 4LLHA 1FBMA 4MRTC 3E1IA 1LTIC 1YTZT 1H0TA 4K35A 5F2OA 2R3SA 3IAOA 4XFXA 1OZHA 4GKGA 3T97B 1Q82Q 1FZCB 2WSEJ 2K2QA 4HKZH 1FU1A 1NTKE 1G1JA 1H88A 3LW5J 2PNGA 2MR7A 2FYUJ 1HBWA 2XDJA 2PRRA 1DIPA 4F37A 1KV4A 1M1KQ 2FYUE 3H1JJ 3B5IA 4JF7A 3L73E 3M0AA 3RK3C 1N2DC 1NO4A 5AVXB 1E6JP 4LC1A 4PD4E 1RE3C 2GZGA 1EQ7A 1VQ7P 3CCLP 3G1GA 2FFDC 2QE7H 1FZFA 5KKZC 2QA4P 1BSHA 2QM8A 3CXHI 2KODA 4IL6H 1AFOA 2WSFJ 4R0MA 1AQ5A 3HE4A 5AVRB 3P8CD 1BGYG 3L71J 5AVVB 1BDCA 1SQQK 2NPSA 1IK7A 3L71E 2HODB 3E1RA 5DJTB 3FGAD 2IBZI 3I55P 2L0QA 2AFEA 1FAVA 1GXGA 4DZOA 1P84I 2OYHB 3QH9A 2KS1B 2JO1A 3KXDA 3H1KJ 1KLPA 1KYOD 4RJTA 3V2PA 4BPGA 1L0LG 3OW2O 1CSBA 4U0CA 2BHVA 2AF8A 3FXEA 1NQ4A 4BXLA 5F2NA 3O6QA 3EJBA 1BCCJ 1FZAA 1IFJA 1ZOYC 4PV1D 3TSIA 4PH0A 1NYHA 3DS2A 2E76D 1BCCE 1IFDA 3H1IG 3E2DA 5KP6B 5AW1B 1LTJA 1XTCC 2H8PD 1L4AA 1PZQA 2FVAA 2KP8A 3L74G 1LTAC 5TISE 1VQ6P 2ZT9D 1EDIA 2R5BA 2LIUA 1EDJA 1NU1D 1RF1B 3RL0D 3NTEA 3VP9A 1N73B 1FZCC 2YIUB 2VLOA 1X9VA 3AE1C 3FXDA 1L0LK 1SFCA 1PGPA 3V2NA 2N1TB 1VL2A 1GXHA 4WYMA 1S5LE 2J5UA 1ZV8A 3RBZA 1AA0A 1QLED 2HLOA 1SQPK 2GDYA 1HGVA 4PJ0H 3Q5RA 5AW4B 1SQXD 2YMYA 3GHGA 3TF5A 1VQMP 2YXRB 1GMJA 1YITP 2M5AB 3D70A 2Q6QA 2IBZD 3U1CA 3NFQA 3LRYA 3H1HJ 3CLQA 2JKVA 2LMLA 3CE7A 3H1HE 2KOSA 1P84D 3PHLA 4ASVA 5KP7B 2K5XA 3VOPA 2Y0CA 2R44A 1EZVE 3L72G 1DEEG 4D6TG 2WPVB 3FWLA 4HB1A 2G8YA 2PEQA 4PH1A 5GTIH 2E74D 2OYHC 5APTA 1LTBC 2M3BA 3KZIH 5KLVG 3U43A
chains in the Genus database with same CATH topology
2EIAA 3G6EP 3CCQP 3MGEA 3CC2P 3DS0A 3DS4A 1M1KQ 5BS1A 3CCRP 1M6NA 3B5IA 3CCJP 1M6EX 2L6EA 3CCVP 1AUMA 3G26A 2PEMA 3CXCO 4IPYA 1VQ6P 5I4TG 2EFJA 1YJ9P 1VQ4P 1A43A 3DS1A 1JJ2O 2E1MA 1E6JP 1YI2P 3H4EA 1KQSO 1VQ7P 3NTEA 3G1GA 1YJWP 3CCLP 2PENA 3HYBA 1Q81Q 2PY8A 1QVFO 3DPHA 1QRJA 1VQLP 3Q20A 4GR2A 2QA4P 3H47A 2BQ1E 2KODA 2Z46A 2OTJP 1D1DA 2LF4A 1W2BO 4M0IA 3CCSP 3H0DA 1IUQA 4WYMA 3CC4P 3WBHA 4U0EA 3DS3A 3CCMP 4U0BA 1VQ8P 1PEQA 1Q7YQ 1QVGO 4QNBA 3CCEP 2P9XA 3G71P 2OARA 3CPWO 4XFYA 3G4SP 5HGLA 1K30A 2OTLP 1PEUA 3G28A 2CWOA 2XT1A 2PEIA 2DGYA 2M8LA 1VQPP 1Q86Q 2Z44A 3I55P 1ZMBA 3G29A 1YIJP 1PEMA 3CMAP 1VQ9P 2BUOA 2JO0A 5JPAA 2PEOA 1KD1Q 1N8RQ 1VQMP 5HGMA 1A8OA 5HGNA 5BS2A 4U0FA 2PEJA 1YITP 5DCKA 3CD6P 2ONTA 1YJNP 2QEXP 3LRYA 4GR6A 3G21A 3VRLC 3G0VA 4U0DA 1KC8Q 2XV6A 3DTJA 1EIAA 3CC7P 3RG6C 1RO0A 1K9MQ 1M74A 1VQOP 1VQNP 3OW2O 1K73Q 1VQKP 4U0AA 1RNIA 2BHVA 2M8NA 3M1MA 4U0CA 2XXMA 4XFZA 4COPA 2JYGA 4XROA 1VQ5P 3HZQA 5F2NA 2EG5A 5F2OA 2M8PA 1K8AQ 2JYLA 1S72P 1RO2A 3DS5A 4COCA 4PH0A 3DS2A 1YHQP 3G1IA 2PEKA 2PEQA 3P05A 4PH1A 4XFXA 4XRQA 1PEOA 1Q82Q 2Z45A 3CCUP 5HGOA 3CMEP 1EOQA 3I56P 1M90Q 3E2DA 1BAJA 5F2KA 1NJIQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 O;  1K73 Q;  1VQL P;  1Q86 Q;  1VQP P;  2QA4 P;  1Q81 Q;  1VQK P;  3I55 P;  3G6E P;  1YIJ P;  3CCQ P;  2OTJ P;  3CMA P;  1VQ9 P;  3CC2 P;  1VQ5 P;  1KD1 Q;  1N8R Q;  1VQM P;  3CCR P;  1M1K Q;  1W2B O;  3CCS P;  3CCJ P;  1YIT P;  1K8A Q;  1S72 P;  3CC4 P;  3CCV P;  3CD6 P;  3CXC O;  3CCM P;  1VQ6 P;  1YHQ P;  1YJN P;  2QEX P;  1YJ9 P;  1VQ8 P;  1VQ4 P;  1Q7Y Q;  1QVG O;  1JJ2 O;  1Q82 Q;  3CCE P;  3G71 P;  3CCU P;  1YI2 P;  1KC8 Q;  1KQS O;  3CME P;  1VQ7 P;  3CPW O;  3CCL P;  3G4S P;  1YJW P;  3CC7 P;  3I56 P;  1M90 Q;  1K9M Q;  1NJI Q;  2OTL P;  1VQN P;  1VQO P;  1QVF O; 
#chains in the Genus database with same CATH topology
 2PP6 A;  3VMX A;  3AE7 C;  2WVR A;  3H1L D;  1KIL D;  1JY2 N;  1JCC A;  1GPJ A;  2L6E A;  2W27 A;  2FKW B;  2EFJ A;  1G1I A;  3AE3 C;  2YO2 A;  4IFD K;  2WT7 A;  1WT6 A;  1SVF A;  4U3F G;  3SWK A;  2PY8 A;  1FDI A;  3TNU B;  2KGE A;  2ITA A;  5CJ0 A;  2JU1 A;  1RY3 A;  1X3O A;  5B5E E;  2LF4 A;  2MVV A;  1SQQ J;  3L70 G;  3AEC C;  1J1E B;  4KT0 J;  3W67 A;  2ZXX A;  3L75 J;  4NPD A;  2FQ0 A;  4D6T D;  2XKM A;  1RE4 C;  2RH0 A;  2NRG A;  3AEF C;  4C7N A;  3Q5P A;  3G4S P;  2W6J H;  5HGL A;  3G28 A;  1RF1 C;  1N73 C;  2YIU C;  1S1C X;  2VLN A;  4C7R A;  1LWU A;  2GZF A;  5K5G B;  3CMA P;  1TU3 F;  3P8C E;  2K88 A;  1OXZ A;  2B89 A;  2N1T C;  4H13 B;  3A0B E;  2GUV A;  2XV5 A;  1YJN P;  4L76 A;  1KB9 I;  3KDP B;  3GKL C;  2ZVN B;  4XA4 A;  2KZJ A;  2GA1 A;  1IFI A;  2A06 G;  2MY5 A;  4EYY Q;  1KOR A;  1NHL A;  3C9I A;  1PGO A;  1KIL A;  2M8P A;  4GOE A;  1KYO E;  4TLF A;  2K94 A;  3P05 A;  4H2W C;  1MFZ A;  5KJ7 D;  3H1J G;  4OVN F;  2QSI A;  3M9Q A;  3H25 A;  3GZL A;  4UHP B;  2EIA A;  1FZG A;  4HH2 A;  2WQY C;  5BU8 B;  1M6N A;  2GZE A;  1AUM A;  1HGZ A;  1ACP A;  1PV3 A;  4PJ0 E;  3P32 A;  1DNY A;  2FYN B;  2BQ1 E;  1GK6 A;  2BAS A;  1NU1 J;  3IF4 A;  1IMQ A;  1IC2 A;  1GW4 A;  3DS3 A;  1NU1 E;  2FYU K;  4EDF A;  1YYC A;  3UIA A;  2HR3 A;  2KNC A;  1VF5 B;  3Q1M A;  3L37 A;  3CWB D;  2H43 A;  2Z44 A;  2OTK E;  2KLV A;  5CBO A;  3IN6 A;  2WZ7 A;  2IFM A;  4ZKP A;  5BS2 A;  1DD3 A;  2KGD A;  2I8D A;  2KB7 P;  2E42 A;  5KJ7 A;  1S5L X;  1OVV A;  3HD7 C;  2O1K A;  1KC8 Q;  1SQX E;  1NTM G;  2LPK A;  4PD4 H;  1RH5 B;  4ZKU A;  1W2E A;  3CX5 I;  2IBZ E;  2KW2 A;  2O3J A;  2QJY B;  4H13 C;  5AVW B;  1L4A B;  1P84 E;  5APU A;  3B5N B;  5F2K A;  3D6Y A;  2JAZ A;  3OAK A;  1AQT A;  3EFF K;  2CNR A;  3EJD A;  3MP7 B;  3RGU A;  2V7Q J;  1ZXG A;  3GMA A;  1HUC A;  1LP1 B;  2PEM A;  5E79 E;  3FX0 A;  1PPJ D;  1A43 A;  1PP9 D;  2KG9 A;  3H1L J;  2Q3E A;  2L22 A;  2L9F A;  1BE3 D;  3F5H A;  2ZAE B;  2WPS A;  3H1L E;  1IFN A;  1KIL E;  4DOJ A;  4Y28 J;  3MD0 A;  2OYO A;  1OR5 A;  4U0B A;  5C39 A;  3GJN A;  3TDK A;  1JY2 O;  2OAR A;  1LJ2 A;  3V2R A;  3GHG B;  2OGU A;  3TGU G;  1OW7 A;  2W6A A;  1ZMB A;  5AW9 B;  1R8E A;  1PEM A;  1VQ9 P;  5AVY B;  4D6T E;  5AW2 B;  2LR2 A;  3L36 A;  1SQB D;  3A7O A;  1X0T A;  4IFM A;  2N98 A;  1JEK A;  2ONT A;  1NTZ D;  1JNM A;  3M91 A;  1UIX A;  1ZRT D;  1LTT C;  5TIS H;  1GU4 A;  1VF5 C;  2M5R A;  3HE5 A;  2CPB A;  2FVE A;  3WU2 E;  2KUB A;  2D2C D;  1FJK A;  1LT9 A;  3VMA A;  1ZP0 C;  2MD9 A;  2L91 A;  1YQ3 C;  2XU6 A;  3AED C;  4WY4 D;  4XE5 B;  2E75 D;  3VMY A;  1T3U A;  1FDM A;  3CCU P;  3EWK A;  2SPZ A;  1S5L H;  3CX5 D;  1MKM A;  3M0D A;  2FY8 A;  2JR8 A;  4OGQ D;  3TGU D;  2IYO A;  2KG6 A;  2C9N Y;  1M1J A;  5APW A;  1FE6 A;  3JC2 2;  4Y99 B;  4QKO A;  3MGN A;  2Q1K A;  2ZVO B;  2BCC D;  1Q90 D;  5HV8 A;  1NTK J;  1SQQ G;  2Z5H A;  2KI7 B;  3WMM 0;  3L75 G;  2QJY C;  3KHU A;  2LXB A;  1L4A C;  1NVO A;  1GW3 A;  1X8Y A;  1VQL P;  3B5N C;  2A45 I;  4OWF A;  5CCG D;  1VPC A;  1HQB A;  3L73 J;  4C7N B;  3H0D A;  2E43 A;  1G2C A;  2L5G B;  1L0N D;  1SLQ A;  3ABV C;  4TT3 H;  2I1K A;  1RF0 C;  3HUS A;  4GIF A;  2ZYG A;  3NXS A;  1PIX A;  1Q2N A;  1SFC C;  1PEU A;  2K92 A;  3EJE A;  3BAT A;  1SQV D;  1URQ D;  2P58 A;  3H32 A;  1A8O A;  4WY4 A;  3BVH A;  4BPF A;  1EDL A;  2QJK B;  2K9Y A;  3CWB E;  4R4M A;  1EIA A;  1RO0 A;  1M74 A;  3GG2 A;  3GHG C;  4ZMD A;  3M1M A;  1MZ8 A;  3A2A A;  3CI9 A;  1FOS F;  1T2K C;  5B5E H;  1YHQ P;  2A45 G;  4N6J A;  2PAJ A;  3RK3 D;  4BPH A;  1NJI Q;  4N3Y B;  2ZJS E;  1BSN A;  2E5Y A;  4GOF A;  5CCG A;  1SP4 A;  3M9H A;  2OQQ A;  2VLP A;  2AXT E;  1BGY D;  1OMI A;  5AW0 B;  4W7Z A;  1YI2 P;  1SQP G;  1M7L A;  3A0B H;  2KWL A;  5AW6 B;  1JTH B;  1QRJ A;  1URQ A;  1T8K A;  2ZFC A;  4DJG A;  2OTJ P;  1S4X A;  1S9K D;  1PPJ E;  4Y99 C;  1BE3 J;  3CC4 P;  2KNC B;  1PP9 E;  1Z56 A;  2CG5 B;  5GTH E;  1QVG O;  4QNB A;  1BE3 E;  1EXJ A;  1KYO H;  3CPW O;  1J1D B;  1FS0 E;  2K37 A;  1M56 D;  2LKI A;  1L0L D;  1WRG A;  1FZE A;  2P67 A;  2XND H;  3V2Q A;  2WIT A;  1XTG B;  1RHZ B;  4GR6 A;  3CXH D;  1NU1 K;  2M3E A;  5APY A;  3MUD A;  3H1I D;  2IX7 C;  1RE3 A;  1CZQ A;  3B71 A;  1K73 Q;  4U0A A;  4B86 A;  1SQB E;  1GL2 B;  3BCC G;  4COP A;  1VQ5 P;  1NTZ E;  3L74 D;  1K8A Q;  3R4Y A;  4LGD E;  3WUT A;  1A02 F;  1BXI A;  1ZRT E;  1AYI A;  3OJA B;  4R4L A;  2QJK C;  1AVY A;  4JBZ A;  4AYC A;  2JB0 A;  4K3A A;  4EIJ A;  3JCU H;  4A7P A;  2W83 C;  5AVQ B;  3TYY A;  1NWQ A;  4WWI A;  2WSS H;  1SS1 A;  3VP8 A;  2Y9Z A;  2H89 C;  3CX5 E;  1ZNV A;  3CXH H;  3TGU E;  4OH8 B;  3AEG C;  3VN0 A;  2GDW A;  3U1A A;  1N7S B;  4GR2 A;  1KQF B;  2HPC B;  3BAS A;  3EQ2 A;  5CCH D;  2Z46 A;  1QL2 A;  2BCC E;  3VMZ A;  2O01 H;  3B8E B;  2EHT A;  3CCS P;  5CJ4 A;  1AVO A;  2YMK A;  1UJZ A;  2XZ0 D;  4AUW A;  1Q7Y Q;  3G71 P;  2IDB A;  1OWA A;  2Q5U A;  1HVV A;  1P84 H;  2UWJ E;  3O8Z A;  1L0N E;  3RK2 B;  5HGN A;  2JU2 A;  1AJY A;  3L72 D;  4H44 B;  3HD7 B;  2DNW A;  3AE6 C;  1NOH A;  1ZLL A;  2XV6 A;  1JY3 P;  3HTK B;  5DJU B;  2AFD A;  1SQV E;  2OYI A;  5E79 H;  2Y0D A;  2V7Q H;  1FZC A;  4HKG A;  1LT9 B;  3C8V A;  5KLV D;  1RQU A;  1J1D C;  1OVU A;  2JWA A;  2N50 A;  4JYC A;  2QJP C;  1RO2 A;  2L4B A;  4XRQ A;  2C9L Y;  2DW3 A;  3QWO C;  2RKL A;  3MHV A;  4U3F D;  2VSQ A;  2MKV A;  5CCH A;  1H0T B;  3G6E P;  3CCQ P;  3TK1 A;  1F80 D;  2IZ1 A;  1ZME C;  3L70 D;  1GL2 C;  1KMI Z;  2FYU G;  2Y9Y A;  3SWY A;  3RK3 E;  2QVA A;  3L73 G;  1AV1 A;  1HWT C;  1YJW P;  3PH0 A;  4H0L B;  1G2C B;  2IPP A;  3V5B A;  4QMA A;  2HOD A;  4BRY A;  2LL8 A;  1BGY E;  5AW5 B;  2K9J A;  3P7K A;  5KTB A;  4JPZ B;  3WU2 H;  1LNQ A;  2N1T D;  3B4Q A;  4N78 D;  5BU5 A;  1KN7 A;  2OYH A;  4DG9 A;  2KS1 A;  1JO5 A;  2OTL P;  3L71 G;  1GK4 A;  2CWO A;  3N7N A;  2A06 D;  3HE4 B;  3PP5 A;  1S9K E;  2KYV A;  1NTK K;  1S2E A;  4PWV B;  1N7S C;  5JPA A;  1FR2 A;  1DD4 A;  1PGQ A;  3AE5 C;  4YXW H;  5APS A;  2NPS B;  2JWD A;  1UII A;  2Q9I A;  2ZYD A;  3JCU E;  4YXD C;  2WTY A;  2AEJ A;  3G21 A;  3K5B A;  1L0L E;  1HJB A;  3H1J D;  2M0B A;  1VQK P;  3H1K G;  4PXH B;  2JYG A;  2KGA A;  1NKN A;  3HZQ A;  2M8R A;  2KR5 A;  3H1I J;  2CQ8 A;  3AE8 C;  1T3J A;  3RK2 C;  3CXH E;  1LGH B;  2KK7 A;  2P2U A;  1KZU B;  3H1I E;  1SQX J;  2O01 J;  4H44 C;  1FOS E;  1BCC G;  1EOQ A;  2QNW A;  2FAD A;  4W80 A;  3E7K A;  3O6Q B;  1RF1 A;  3L74 E;  1PFI A;  1N73 A;  3KYQ A;  3RG2 A;  3LMO A;  1GZL A;  1KB9 D;  1LT9 C;  3DS4 A;  2KGC A;  3AE4 C;  3CCJ P;  2N1T A;  4IPY A;  3FWN A;  1W5C E;  4Z1M H;  1LTJ B;  2AXC A;  2KIK A;  3HYB A;  1N86 A;  4GT1 A;  5AW3 B;  3H1K D;  1L2P A;  2K0Y A;  2KOP A;  1U7J A;  3L35 A;  2WWW A;  1NH4 A;  2PFX A;  2JGP A;  1Y47 A;  1QEX A;  3KQG A;  2N5H A;  2AEF A;  2FHS C;  2YKO A;  3GZM A;  5CHX A;  2M5A A;  1HY8 A;  1SFC B;  1FZB A;  5AW7 B;  2Y0E A;  1JMM A;  4H2Y C;  3U59 A;  4NEO A;  2PEI A;  1NTM D;  2IYP A;  4H0L C;  2PEO A;  1KB9 H;  2EHS A;  1IFM A;  3BRV B;  3M06 A;  5KAI E;  5DCK A;  3CD6 P;  2J58 A;  3A0H E;  2FYZ A;  2N9B A;  1QGK B;  2KLU A;  2KOQ A;  1R5L A;  2AXT H;  3PJS K;  4H13 D;  3VTP C;  4L73 A;  2BEZ F;  2YKP A;  3L72 J;  4D6T J;  4IL6 X;  4PV1 B;  3H1H G;  2E76 B;  3HRN A;  5BVZ A;  3L72 E;  3JSV C;  1ZW0 A;  4ASW A;  2JYL A;  5KLV J;  1EZV G;  3MZW B;  2PEK A;  1A02 J;  2YXQ B;  1K04 A;  2NPS C;  1D7M A;  1L0I A;  1OX3 A;  1U57 A;  5KLV E;  4UB8 E;  2KZI A;  3AEA C;  5GTH H;  4IZ6 A;  3OA7 A;  2ZT9 B;  4RO0 A;  2W8Z A;  2WPR A;  3II6 A;  4DT0 A;  3TNU A;  1SQB K;  3RL0 B;  3G26 A;  1NTZ K;  1OIP A;  2E1M A;  2HG5 D;  4U3F E;  3ITK A;  2H88 C;  3L70 E;  2GM4 A;  2B87 A;  2YO3 A;  3M9B A;  1RQV A;  4I1L A;  1IUQ A;  2WT7 B;  3CCM P;  2AEM A;  4UB6 E;  1PEQ A;  3CCE P;  1CW5 A;  1KFN A;  1LTJ C;  2H7H A;  2M8L A;  2DGY A;  1LTG C;  1NGM B;  1VF5 D;  1KD1 Q;  5HGM A;  4W7Y A;  4N78 E;  3IR9 A;  1CEI A;  2OYI B;  1FDO A;  2P7J A;  2A06 E;  5H2F E;  1LWU B;  3EFG A;  4HJG H;  1VQO P;  1E79 H;  3CX5 H;  3F89 A;  5KP8 B;  2J59 M;  1IMP A;  1IJD B;  2KXP B;  5B66 E;  2E74 B;  4WVZ A;  1GDT A;  1MFT A;  1OW6 A;  4M3L A;  1L0N K;  3DS5 A;  2MF4 A;  3VYI A;  3CWB J;  3H1J E;  2LIW A;  3MUD C;  1SQQ D;  2QG4 A;  3L75 D;  3I56 P;  1M90 Q;  1JCD A;  1BAJ A;  3MTU E;  5EW5 E;  1KIL B;  1L4A D;  1SQV K;  4IFF A;  4YTP C;  3DS0 A;  1FJP A;  4PV1 C;  2KSJ A;  3B5N D;  2E76 C;  2XZR A;  2RN0 A;  3AEB C;  1DV5 A;  5AVS B;  2WMM A;  3LIE A;  2WSC H;  4BRY B;  1KB9 E;  5KAF H;  2K9J B;  1FC2 C;  1KQG B;  1EMV A;  2Z4E A;  1SFC D;  3V4Q A;  2YKQ A;  1W2B O;  2ZT9 C;  3NMD A;  1HF9 A;  1Z6M A;  3D71 A;  3RL0 C;  2R5D A;  1VQ8 P;  1N7L A;  1NU1 G;  2P9X A;  2JBG A;  1EC5 A;  3H1K E;  3G29 A;  2C0W A;  1X79 B;  5EFW B;  5APV A;  2JO0 A;  1PP9 J;  2X2B A;  2N9Y B;  1NTM J;  2PGD A;  1E0H A;  1DEB A;  1T2K D;  4U0D A;  2WPT A;  1NTM E;  1VHN A;  2FXP A;  2G3A A;  2ZYA A;  1GU5 A;  2GUS A;  1SQX G;  2MVU A;  3B5N A;  3S1K A;  2QJP B;  4RES B;  1KQL A;  1S72 P;  3H6P A;  1PGJ A;  2IBZ G;  2JP3 A;  3G1I A;  3PLN A;  3Q3D A;  2VRS A;  2OYI C;  1RF0 A;  1LP1 A;  3CME P;  1SQP D;  3CL3 D;  1R5S A;  2ZXE B;  1SQB J;  2FFD A;  1LWU C;  1NTZ J;  3ZDM A;  2QRX A;  3A3Y B;  3CC2 P;  1CI6 A;  2JEE A;  3V4W A;  4GOD A;  4I2L C;  3CCR P;  3SFD C;  4L74 A;  3A5T A;  2E74 C;  2JJL A;  1M6E X;  3CCV P;  2I1J A;  4JQ0 D;  2Q7C A;  3DS1 A;  3C1L A;  3SWF A;  1OFC X;  2A45 H;  3B4S A;  5CCH C;  3G9R A;  1Q81 Q;  1QVF O;  1GD2 E;  3Q20 A;  3H47 A;  1SQX K;  2P1J A;  1VKU A;  1KIL C;  3H1L G;  2B9B A;  1DX7 A;  4KJM A;  2Q3I A;  3TGU J;  1IFP A;  2CK3 H;  3S4R A;  2N5I A;  2YNY A;  1JUN A;  2FVF A;  2BCC J;  1Q86 Q;  1OW8 A;  2BEQ D;  2KOR A;  1T8Z A;  2FXM A;  3BCC D;  1DH3 A;  4H2X C;  1PL5 A;  4WBA A;  2O1J A;  4EOT A;  2CPS A;  2QEX P;  5L8R J;  1EDK A;  3VRL C;  3G0V A;  2R3C A;  1NKZ B;  3DTJ A;  4MN4 C;  2GDX A;  2K3R A;  4IL6 E;  1VQN P;  1L0N J;  2XZ1 C;  2GYK A;  5CZD B;  3IFM A;  1JY2 P;  4XFZ A;  4XRO A;  3PRJ A;  3RL0 g;  3GF7 A;  2WSC J;  2JQ4 A;  2HFE D;  1VDF A;  4JYB A;  1LTS C;  4PD4 I;  3SFE C;  7CEI A;  1MV8 A;  1ZR2 A;  4I7Z B;  1SQV J;  5KAF E;  3HE5 B;  3RBX A;  3T97 A;  1YQ4 C;  4ZNC A;  5AVT B;  1JY3 N;  3P8M C;  1YBK A;  1T6A A;  5BS1 A;  1S3J A;  1GTW A;  1SQQ E;  3CXC O;  2QIW A;  5KJ7 C;  5I4T G;  3L75 E;  2POH A;  4NPF X;  2KOO A;  1YTZ I;  4NPE A;  2KSE A;  5KAI H;  2B87 B;  1M1J B;  4I6M C;  3A0H H;  5APQ A;  4BWN A;  3DPH A;  5KLV K;  1NTK G;  1Y8A A;  2NO8 A;  1D1D A;  1M8O B;  2QM7 A;  4CA3 A;  3S9O A;  1E5W A;  1AF8 A;  3AE9 C;  2FXO A;  1HTL C;  2N6Y A;  1K30 A;  1JM0 A;  2FQ1 A;  2XT1 A;  2IZ0 A;  2Z5I A;  3GLM A;  1BGY J;  3V6I A;  1YIJ P;  4XFJ A;  1M57 D;  4UB8 H;  5CMZ A;  1K05 A;  1QL1 A;  4HYT B;  3NTN A;  3WUV A;  3HUS B;  3SSU A;  2FBW C;  2NZ2 A;  2D2C B;  2MR8 A;  3RG6 C;  2VLQ A;  1KFM A;  1OVR A;  3Q2Y A;  3H32 B;  3CWB G;  2E5T A;  4WY4 B;  1NTK D;  1RNI A;  2E75 B;  5KLI B;  3GF3 A;  4KHX A;  2EG5 A;  5EJD A;  4OGQ B;  4IOI H;  1L0L J;  2FYU D;  1USD A;  1GL2 D;  1PEO A;  2B88 A;  4EI2 A;  2XNX A;  3L73 D;  2ERH A;  4UB6 H;  4PD4 D;  3MGE A;  1JTH A;  2KG8 A;  1SQP J;  2FAC A;  5TJH A;  3LID A;  2C0X A;  1YJ9 P;  1SQP E;  5AVZ B;  4DCK A;  1JJ2 O;  2KOG A;  1RE4 A;  1WMK A;  4CPG A;  4I7Z C;  4RKU J;  3PTZ A;  3AE2 C;  3L74 J;  1QX8 A;  3L71 D;  1HH0 A;  3I5C A;  5H2F H;  4GDO A;  5GTI E;  3BRT B;  1MZ9 A;  2K1A A;  2WSE H;  1H8A A;  1J1E C;  1N7S D;  5CBN A;  3WBH A;  3LW5 H;  5B66 H;  1PPJ G;  3KZI E;  1PP9 G;  4YPC A;  1URQ B;  3M0D C;  2HYN A;  1BE3 G;  2LKM A;  1EXI A;  1JMB A;  1M1J C;  1VQP P;  2FAE A;  3D6Z A;  1EZV I;  2BUO A;  2LOL A;  1KTM A;  4U0F A;  2W90 A;  1GL2 A;  2K0D X;  2LXC B;  5APX A;  1IZN B;  2V4H A;  3RK2 D;  3BCC J;  1BCC D;  2WSF H;  1K9M Q;  1BDD A;  4H44 D;  3HD7 D;  3GW6 A;  3BCC E;  4U7J A;  5AW8 B;  3NY7 B;  3R2P A;  2M8N A;  2JDI H;  2XXM A;  1IK9 A;  1SQB G;  3AEE C;  3RK3 B;  1NTZ G;  2N6Z A;  4WB4 A;  2GZJ A;  4COC A;  3G3Z A;  3HUS C;  2FFD B;  1UNK A;  2Z45 A;  2CGQ A;  5HGO A;  5KKZ B;  1CI6 B;  2ROQ A;  3N4X A;  2D2C C;  1NTM K;  3W68 A;  1H89 A;  1JB0 J;  5M1B A;  2GZI A;  1X22 A;  4WY4 C;  1ZR4 A;  2E75 C;  1N7S A;  3L4F A;  1USE A;  5KLI C;  2HPC A;  1IO4 A;  1VQ4 P;  4OGQ C;  2RMZ A;  4AQR D;  1HJ0 A;  3H4E A;  1KQS O;  2FQ2 A;  3MIW A;  2PEN A;  1U7M A;  5HVC A;  3USS A;  2FYN C;  4M0I A;  2BCC G;  2W6B A;  1JY3 O;  4H0L D;  4U0E A;  4U3F J;  2AVA A;  2K0X A;  2K93 A;  1Y9B A;  2P10 A;  2MJZ A;  2WPQ A;  4XFY A;  3HD7 A;  3L70 J;  1NAY A;  2IFN A;  1J2J B;  5CCG C;  1NAF A;  4C46 A;  1L0H A;  1ZN5 A;  1LT1 A;  3HTK A;  3H1H D;  2O01 N;  1KYO I;  3WUU A;  1N8R Q;  2PEJ A;  1L0N G;  3Q5S A;  1MUU A;  1EZV D;  1JOC A;  4O9B A;  2R32 A;  3CC7 P;  2NPS D;  3KPE A;  1URQ C;  4L75 A;  5AVU B;  1SQV G;  2LTE A;  4LLH A;  1FBM A;  4MRT C;  3E1I A;  1LTI C;  1YTZ T;  1H0T A;  4K35 A;  5F2O A;  2R3S A;  3IAO A;  4XFX A;  1OZH A;  4GKG A;  3T97 B;  1Q82 Q;  1FZC B;  2WSE J;  2K2Q A;  4HKZ H;  1FU1 A;  1NTK E;  1G1J A;  1H88 A;  3LW5 J;  2PNG A;  2MR7 A;  2FYU J;  1HBW A;  2XDJ A;  2PRR A;  1DIP A;  4F37 A;  1KV4 A;  1M1K Q;  2FYU E;  3H1J J;  3B5I A;  4JF7 A;  3L73 E;  3M0A A;  3RK3 C;  1N2D C;  1NO4 A;  5AVX B;  1E6J P;  4LC1 A;  4PD4 E;  1RE3 C;  2GZG A;  1EQ7 A;  1VQ7 P;  3CCL P;  3G1G A;  2FFD C;  2QE7 H;  1FZF A;  5KKZ C;  2QA4 P;  1BSH A;  2QM8 A;  3CXH I;  2KOD A;  4IL6 H;  1AFO A;  2WSF J;  4R0M A;  1AQ5 A;  3HE4 A;  5AVR B;  3P8C D;  1BGY G;  3L71 J;  5AVV B;  1BDC A;  1SQQ K;  2NPS A;  1IK7 A;  3L71 E;  2HOD B;  3E1R A;  5DJT B;  3FGA D;  2IBZ I;  3I55 P;  2L0Q A;  2AFE A;  1FAV A;  1GXG A;  4DZO A;  1P84 I;  2OYH B;  3QH9 A;  2KS1 B;  2JO1 A;  3KXD A;  3H1K J;  1KLP A;  1KYO D;  4RJT A;  3V2P A;  4BPG A;  1L0L G;  3OW2 O;  1CSB A;  4U0C A;  2BHV A;  2AF8 A;  3FXE A;  1NQ4 A;  4BXL A;  5F2N A;  3O6Q A;  3EJB A;  1BCC J;  1FZA A;  1IFJ A;  1ZOY C;  4PV1 D;  3TSI A;  4PH0 A;  1NYH A;  3DS2 A;  2E76 D;  1BCC E;  1IFD A;  3H1I G;  3E2D A;  5KP6 B;  5AW1 B;  1LTJ A;  1XTC C;  2H8P D;  1L4A A;  1PZQ A;  2FVA A;  2KP8 A;  3L74 G;  1LTA C;  5TIS E;  1VQ6 P;  2ZT9 D;  1EDI A;  2R5B A;  2LIU A;  1EDJ A;  1NU1 D;  1RF1 B;  3RL0 D;  3NTE A;  3VP9 A;  1N73 B;  1FZC C;  2YIU B;  2VLO A;  1X9V A;  3AE1 C;  3FXD A;  1L0L K;  1SFC A;  1PGP A;  3V2N A;  2N1T B;  1VL2 A;  1GXH A;  4WYM A;  1S5L E;  2J5U A;  1ZV8 A;  3RBZ A;  1AA0 A;  1QLE D;  2HLO A;  1SQP K;  2GDY A;  1HGV A;  4PJ0 H;  3Q5R A;  5AW4 B;  1SQX D;  2YMY A;  3GHG A;  3TF5 A;  1VQM P;  2YXR B;  1GMJ A;  1YIT P;  2M5A B;  3D70 A;  2Q6Q A;  2IBZ D;  3U1C A;  3NFQ A;  3LRY A;  3H1H J;  3CLQ A;  2JKV A;  2LML A;  3CE7 A;  3H1H E;  2KOS A;  1P84 D;  3PHL A;  4ASV A;  5KP7 B;  2K5X A;  3VOP A;  2Y0C A;  2R44 A;  1EZV E;  3L72 G;  1DEE G;  4D6T G;  2WPV B;  3FWL A;  4HB1 A;  2G8Y A;  2PEQ A;  4PH1 A;  5GTI H;  2E74 D;  2OYH C;  5APT A;  1LTB C;  2M3B A;  3KZI H;  5KLV G;  3U43 A; 
#chains in the Genus database with same CATH homology
 2EIA A;  3G6E P;  3CCQ P;  3MGE A;  3CC2 P;  3DS0 A;  3DS4 A;  1M1K Q;  5BS1 A;  3CCR P;  1M6N A;  3B5I A;  3CCJ P;  1M6E X;  2L6E A;  3CCV P;  1AUM A;  3G26 A;  2PEM A;  3CXC O;  4IPY A;  1VQ6 P;  5I4T G;  2EFJ A;  1YJ9 P;  1VQ4 P;  1A43 A;  3DS1 A;  1JJ2 O;  2E1M A;  1E6J P;  1YI2 P;  3H4E A;  1KQS O;  1VQ7 P;  3NTE A;  3G1G A;  1YJW P;  3CCL P;  2PEN A;  3HYB A;  1Q81 Q;  2PY8 A;  1QVF O;  3DPH A;  1QRJ A;  1VQL P;  3Q20 A;  4GR2 A;  2QA4 P;  3H47 A;  2BQ1 E;  2KOD A;  2Z46 A;  2OTJ P;  1D1D A;  2LF4 A;  1W2B O;  4M0I A;  3CCS P;  3H0D A;  1IUQ A;  4WYM A;  3CC4 P;  3WBH A;  4U0E A;  3DS3 A;  3CCM P;  4U0B A;  1VQ8 P;  1PEQ A;  1Q7Y Q;  1QVG O;  4QNB A;  3CCE P;  2P9X A;  3G71 P;  2OAR A;  3CPW O;  4XFY A;  3G4S P;  5HGL A;  1K30 A;  2OTL P;  1PEU A;  3G28 A;  2CWO A;  2XT1 A;  2PEI A;  2DGY A;  2M8L A;  1VQP P;  1Q86 Q;  2Z44 A;  3I55 P;  1ZMB A;  3G29 A;  1YIJ P;  1PEM A;  3CMA P;  1VQ9 P;  2BUO A;  2JO0 A;  5JPA A;  2PEO A;  1KD1 Q;  1N8R Q;  1VQM P;  5HGM A;  1A8O A;  5HGN A;  5BS2 A;  4U0F A;  2PEJ A;  1YIT P;  5DCK A;  3CD6 P;  2ONT A;  1YJN P;  2QEX P;  3LRY A;  4GR6 A;  3G21 A;  3VRL C;  3G0V A;  4U0D A;  1KC8 Q;  2XV6 A;  3DTJ A;  1EIA A;  3CC7 P;  3RG6 C;  1RO0 A;  1K9M Q;  1M74 A;  1VQO P;  1VQN P;  3OW2 O;  1K73 Q;  1VQK P;  4U0A A;  1RNI A;  2BHV A;  2M8N A;  3M1M A;  4U0C A;  2XXM A;  4XFZ A;  4COP A;  2JYG A;  4XRO A;  1VQ5 P;  3HZQ A;  5F2N A;  2EG5 A;  5F2O A;  2M8P A;  1K8A Q;  2JYL A;  1S72 P;  1RO2 A;  3DS5 A;  4COC A;  4PH0 A;  3DS2 A;  1YHQ P;  3G1I A;  2PEK A;  2PEQ A;  3P05 A;  4PH1 A;  4XFX A;  4XRQ A;  1PEO A;  1Q82 Q;  2Z45 A;  3CCU P;  5HGO A;  3CME P;  1EOQ A;  3I56 P;  1M90 Q;  3E2D A;  1BAJ A;  5F2K A;  1NJI Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...