3CCJP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 42
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ccjP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ccjP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ccjP02
3CPWO 1S72P 3CCEP 1YJNP 1QVGO 1VQOP 3CMAP 2QA4P 3CC2P 3CD6P 1N8RQ 2OTLP 1JJ2O 1YI2P 3CC7P 3G71P 1VQ8P 3CC4P 1VQ4P 1VQMP 3I56P 1VQNP 3CXCO 3CCRP 3CCSP 2QEXP 1K8AQ 1VQ7P 1VQ5P 1VQ6P 1Q86Q 3G6EP 1VQPP 1YIJP 1Q81Q 1M90Q 3CCQP 1Q82Q 2OTJP 3CCVP 1VQKP 3I55P 1KD1Q 3G4SP 1YHQP 1Q7YQ 1K73Q 3OW2O 3CCMP 1KQSO 1VQ9P 1VQLP 1K9MQ 3CCLP 1NJIQ 1YJWP 1QVFO 1W2BO 3CCJP 1YITP 1YJ9P 1M1KQ 3CCUP 3CMEP 1KC8Q
chains in the Genus database with same CATH superfamily
2N1TB 4JQ0D 2NO8A 3Q2YA 2JEEA 4PD4H 5AVUB 3MD0A 4IFMA 3GMAA 2QEXP 2WSEH 2CNRA 1YQ3C 1KD1Q 2YKPA 1SQPE 2RKLA 4R0MA 2WVRA 4L76A 1NTMG 2YXRB 3WUUA 2GDWA 2JWAA 1HBWA 3G29A 1GXHA 1KFNA 1D1DA 4PV1B 4HYTB 2MF4A 1URQC 2GZFA 2PP6A 2NPSC 2C9LY 1M1JA 3K5BA 2E75D 1RH5B 3V5BA 5AW1B 1SFCA 3H32B 3KZIE 1CW5A 3VP9A 1MUUA 2LF4A 1IFDA 3L74J 3VOPA 4BPFA 4WY4D 1FR2A 2JDIH 3NFQA 1EMVA 2XNDH 1GU4A 1NU1J 2QJPC 3B4SA 5HGMA 1PP9E 2Z5IA 4ZMDA 3BCCE 3RBZA 1JY2P 4H44B 2KOPA 1GL2A 2HPCA 4U0CA 3SFEC 1M74A 1NU1G 3SSUA 3UIAA 2CPBA 1EC5A 1L0NK 1N86A 4BPHA 1Q7YQ 1VPCA 2BCCJ 4WBAA 2ERHA 3CMEP 2HODA 4AUWA 1QVGO 5B66E 3WU2E 4IL6H 5AW5B 3CXHD 3D6YA 1NTKK 3HE5A 4PV1C 3BCCJ 2J59M 2H43A 2K0DX 2GYKA 2K0YA 1N7SA 1LP1A 3T97A 3SFDC 5GTHE 3CC7P 2M8PA 1PFIA 4PV1D 1VQ8P 3CC4P 1ZOYC 4QKOA 1XTCC 5F2KA 3L74E 3H1LD 5EJDA 2Z45A 2QJPB 1G2CA 2JO0A 4WYMA 3CC2P 3M0DA 5AW7B 1ZMBA 1Z6MA 2K0XA 1FDOA 4H13D 1EZVG 1SFCB 3KYQA 1JO5A 4PJ0H 1AV1A 2NPSA 2D2CD 1EDLA 2KSJA 3V2NA 5I4TG 2EFJA 3MHVA 2KOQA 1P84E 1VQ4P 1ZV8A 3G3ZA 2BEQD 1QL1A 3TGUE 2FVEA 2LMLA 1L0NE 2CPSA 3H1IG 2G3AA 4GDOA 2PEQA 2XV6A 5C39A 1G1IA 3H1JE 5KLVD 4B86A 1IFNA 3CMAP 1OX3A 2E76D 5BS2A 1T6AA 3L75D 3G1IA 2YO2A 5KJ7A 2KOOA 1YHQP 1WMKA 3L36A 5HV8A 2E76C 3RL0g 1L0ND 1X79B 2K92A 3VTPC 3H1ID 2A06G 4U3FJ 5F2NA 1FZAA 3DS3A 1RF0C 3T97B 2YNYA 3L4FA 2KLVA 4RESB 4GT1A 1GL2D 1NH4A 4PD4D 1OR5A 1L0LG 1ZLLA 2PENA 2KNCB 2LKIA 4RO0A 3NTNA 2MY5A 3B5NB 3L74D 1LJ2A 3MUDC 2FYUE 5BVZA 1U7MA 1VQ5P 2P58A 2Z46A 2QIWA 1DV5A 1CI6A 1UIXA 1HQBA 1MFZA 1JEKA 4PD4E 1IMPA 2ITAA 3CWBE 2NRGA 3H1HD 1LTSC 5KLIC 2Y9ZA 4I1LA 2M5AB 1S5LH 1N7SC 5KAFH 3P32A 1QVFO 3A0BH 1BE3J 1NKNA 5KLVJ 3H1JJ 2M5RA 3CCEP 2QA4P 1SQXK 1NTKJ 4C7NB 1YI2P 2KGEA 3EJEA 2ZYGA 2WTYA 2E76B 3MGEA 4BXLA 2PEJA 1CI6B 2RN0A 1PL5A 4WY4B 1T3UA 4H2WC 1NAFA 2DNWA 2E75C 3EJBA 2FQ0A 1T2KD 4ASWA 1SS1A 3LIEA 1HVVA 2KS1B 2GUSA 2ZXEB 2V4HA 3BCCG 2XNXA 3AECC 3MIWA 1AQTA 5AVWB 3PH0A 3A0HE 1YTZI 1PP9D 2WT7A 3CXCO 5KLVK 3AEEC 1Q90D 1HJ0A 2P1JA 3II6A 2KUBA 1NU1D 4HJGH 1BGYD 3B5NA 1NHLA 1R8EA 2POHA 2OYIA 1S5LX 4M0IA 2YMYA 4U0AA 2O01J 1E6JP 1CEIA 1CSBA 1Y47A 2Y0CA 2EG5A 2QJKB 1RF0A 1GZLA 1BXIA 3GZLA 1GL2C 2KR5A 3CCUP 2JQ4A 5KKZB 2JP3A 3AE6C 3CXHH 3HD7B 4BWNA 3L75G 3B4QA 1ZP0C 1PPJE 2MR8A 1Q82Q 3RBXA 5EFWB 1M8OB 1JCDA 4GIFA 2C0WA 2WSEJ 1T8KA 2L9FA 5KP8B 4EYYQ 3A3YB 2FYNC 4CPGA 1LTJB 3CXHI 2P67A 5GTIH 4EOTA 2H7HA 1NTZG 1S1CX 1EDJA 2W6BA 1FE6A 1M57D 1VQ6P 1AFOA 4KJMA 1IFPA 1JTHA 3O6QA 1QX8A 4GOEA 1HJBA 5AW2B 2IDBA 4RKUJ 1ACPA 1IJDB 1LWUC 3HZQA 1JOCA 2UWJE 2AFEA 2QRXA 2BEZF 1SQPG 1SQXD 1RQUA 4H2XC 3NXSA 3Q1MA 1S2EA 2OYIC 2O1JA 3CPWO 2XKMA 2H8PD 1LP1B 1AVYA 3HRNA 2IFMA 3H1HJ 2A45G 1BCCG 2KOGA 3SWFA 3L72J 3EFFK 2N50A 3Q20A 1FZCB 2K1AA 2QJYB 1PPJG 5CJ0A 1SQQD 3FWNA 2YKQA 1BE3G 2MKVA 1AF8A 4R4MA 2KIKA 5BU8B 4N6JA 3L35A 1HTLC 2R3SA 3OAKA 1GDTA 2N1TC 3S9OA 3TYYA 2FQ2A 1SQXJ 1X8YA 4Y99C 1H0TB 2FYNB 2KWLA 2HODB 3L37A 1OXZA 1HUCA 4XFXA 2YIUB 3HUSB 1YBKA 2K5XA 1NQ4A 2A45H 2K9JB 1URQD 4OGQC 3NTEA 2FXOA 2IZ1A 2FFDB 1EDIA 2D2CB 2GDYA 2N5IA 1W5CE 4DT0A 1YQ4C 1IFMA 3L70E 3RL0C 3H1HE 2K37A 3VMZA 4U3FD 1HY8A 3EFGA 2K88A 1IFJA 2AXTH 4XRQA 2Q1KA 2KZIA 2LKMA 3H1JD 5KLVE 1NVOA 1OW7A 2RMZA 1LWUA 4LLHA 1NAYA 4C7NA 5AVZB 2JU1A 3TGUD 1JMBA 2BCCE 1KZUB 1EQ7A 2DW3A 5DJUB 3WMM0 2N6ZA 4DZOA 1KQLA 1K8AQ 2FXMA 2Q6QA 3H32A 4H44C 5HGOA 2BHVA 3BRTB 4TT3H 4QMAA 4IPYA 2M8NA 1PIXA 2OYOA 5BU5A 3DS4A 1SQVK 1H89A 2PGDA 1L0LD 3DS5A 1U7JA 1UIIA 3B71A 2FYUJ 2XXMA 4ZKUA 3Q5SA 1IZNB 2C9NY 3BVHA 4GR2A 3AE8C 1D7MA 1N73C 2M3BA 2L0QA 5AVVB 1ZRTE 3M06A 5H2FH 2OTJP 3H25A 2WPVB 3OW2O 1GPJA 4MRTC 2OYHC 2YIUC 1L2PA 2WSSH 2QJKC 5KP6B 4U7JA 1VQMP 1JCCA 1SQBE 2L5GB 1SQQK 2VLPA 1JTHB 3O6QB 4PXHB 2P10A 3CX5D 3VN0A 2WQYC 3B5ND 2FYUK 2AFDA 3MZWB 2KP8A 4UB8H 1KB9H 5KTBA 3V4WA 3B8EB 1SQPJ 1KN7A 2RH0A 3AE9C 4OVNF 1LTGC 4D6TE 4IFDK 1BE3D 2KYVA 4N78E 3P8MC 3V2QA 2ZT9C 2BCCD 3BCCD 1M1KQ 3JSVC 1YTZT 4PWVB 1SFCC 1SQBK 3TGUJ 4IOIH 2P9XA 2E5TA 2IBZE 4HB1A 4ASVA 3DS2A 1M1JB 4U0BA 2LIUA 1EZVE 5CCHC 2JU2A 4D6TJ 2Q7CA 4BRYB 2V7QJ 2FHSC 5EW5E 5AVTB 2WSCH 3VMAA 3CX5I 3M0AA 3H0DA 1RQVA 3RK3D 2W27A 5CBNA 2M0BA 5DCKA 4YPCA 1KYOD 1JJ2O 1LT9C 3DS0A 3H4EA 4O9BA 1GK6A 2W8ZA 2OYIB 1N7SD 1J1DB 1Q86Q 1SQVE 3OJAB 2AVAA 3KQGA 2PEIA 1DEBA 3F5HA 2EIAA 2MD9A 1FAVA 1A02J 2FYZA 1BE3E 1FZCC 2H89C 3P8CE 2XZ1C 1S3JA 1AJYA 3CWBJ 2QE7H 1RNIA 1SQVD 1PEUA 4JF7A 1R5SA 2KB7P 5CZDB 1E0HA 5AW8B 2GZEA 4W7ZA 2JYLA 2IBZG 2N1TD 4DOJA 2HLOA 1K04A 3L73D 4H0LB 5CMZA 1NYHA 1GK4A 1A02F 1G1JA 3C8VA 2ZT9B 3PTZA 4IFFA 3EQ2A 1Y9BA 3CLQA 1YIJP 3PP5A 4JBZA 2L22A 3VMXA 2WSFH 3G4SP 3AE5C 2SPZA 3D6ZA 2J5UA 2GM4A 1PZQA 2QSIA 2R32A 3JCUH 1LNQA 3IAOA 1LTIC 3W68A 3E2DA 1BCCD 1BCCE 1KLPA 4WVZA 4C46A 3H6PA 2QG4A 2B87A 3AEDC 3GHGC 3JCUE 3I55P 1PGPA 3RL0B 3E7KA 1M6EX 2LPKA 4DG9A 2K9JA 1OWAA 4I6MC 4PH0A 1FZBA 5KLIB 5JPAA 1KYOI 3G28A 3PRJA 3CX5E 1SQBD 2GA1A 1FZEA 2R5BA 4CA3A 2FACA 3HE5B 4NPEA 1ZNVA 1R5LA 4K3AA 2PNGA 1A43A 3G71P 1PGOA 1L0NJ 2OARA 2PY8A 1X9VA 3U1CA 2O01N 3FXDA 3QWOC 1X22A 1VF5B 3BASA 1NTKG 2IX7C 4H0LC 1OVUA 3A2AA 3CCMP 2N6YA 5AW6B 3H1KE 3N7NA 1IK7A 3LW5J 1KQGB 1W2EA 2A06E 5HVCA 2JR8A 3SWKA 2DGYA 1ZN5A 1MZ9A 1XTGB 2OYHB 2ZT9D 1RF1A 2YO3A 3AE1C 1FOSE 5CCGC 4K35A 5CBOA 5AW3B 3A0HH 1QGKB 2FQ1A 1SQQJ 1IFIA 2HFED 1J1EB 1S72P 1L4AC 1BGYJ 3G9RA 3PHLA 3P7KA 2CQ8A 1OZHA 3CWBD 1VQNP 1KYOE 1VQ7P 2WPSA 1L4AA 3V6IA 3CCVP 2AF8A 1VQ9P 4GOFA 2KXPB 3RL0D 3HD7C 5CHXA 3H1IJ 4HH2A 4JYBA 2EHSA 1KILA 5B5EE 3I56P 5KAFE 1SFCD 1DEEG 4BPGA 1KORA 1L0NG 1JY3N 1NO4A 2NPSD 4XFZA 1PEQA 5DJTB 1ZR2A 2WT7B 1DH3A 1CZQA 3R2PA 1E5WA 4OGQD 1NKZB 3M1MA 5F2OA 3M91A 1ZR4A 2Q3EA 3MGNA 2E43A 1LTJA 3R4YA 3ABVC 2GUVA 2XT1A 3HD7A 1DD3A 3PJSK 1FC2C 3H1HG 1LTAC 2E1MA 3L72D 5AVQB 3KZIH 1RE3C 4NPDA 2FFDA 2CWOA 3ITKA 2P7JA 1G2CB 1EXJA 1FDIA 1J1DC 2VRSA 1LWUB 4ZKPA 2WPQA 3A7OA 2PEMA 3RK3B 2WMMA 5AVRB 1FOSF 3L75E 1K30A 5KAIE 1M6NA 1RO0A 2R44A 4LGDE 1J1EC 1P84D 4OH8B 1KILD 4C7RA 1RF1B 1JMMA 1L4AB 4JYCA 2WZ7A 3E1RA 5CCGA 1T8ZA 1SQQG 3KPEA 1IK9A 2OGUA 1SQVJ 3AE2C 4H13C 4GODA 1EOQA 4LC1A 4XA4A 2EHTA 1SQXE 5APVA 2B89A 3RG6C 4OWFA 1JUNA 1KB9D 3RGUA 3M9BA 2KOSA 2K94A 2Z44A 1YITP 2LOLA 4N78D 3V2RA 2VLNA 3KHUA 4D6TD 2HG5D 3MP7B 1JY3P 1NWQA 1OIPA 2XU6A 5APTA 1LTTC 3L73G 3DTJA 2LIWA 3EJDA 2KS1A 1NTMJ 1PP9G 1P84H 4PH1A 5KP7B 2R3CA 1WT6A 1MFTA 3D70A 2PEKA 2LXBA 3L73J 3CXHE 3L70D 3AEGC 3RG2A 1YYCA 2ZVOB 2JYGA 4GR6A 2KG6A 2JB0A 1HGVA 3G6EP 2J58A 1QRJA 1FDMA 1KB9I 3H1JG 4EIJA 2GZIA 4NPFX 2KG8A 1ZXGA 4TLFA 2H88C 2AEMA 2K3RA 4L74A 1NOHA 2A45I 3GLMA 4COPA 2I8DA 3TK1A 4H13B 1RHZB 2YMKA 5L8RJ 2K2QA 3G0VA 2FBWC 3RK2C 2WPTA 2XZRA 4UB8E 2KGDA 2VLOA 2LTEA 1PEOA 2KGAA 1VF5C 3BATA 2WPRA 1EXIA 1KILE 4WWIA 1LGHB 4IL6X 4Z1MH 1GW3A 1OW6A 1VQKP 4QNBA 3AE7C 4XE5B 2V7QH 3W67A 4XFJA 1W2BO 2KG9A 3H1LE 1KTMA 1N73B 2ZJSE 2WITA 1KQFB 1N8RQ 1NTZJ 1Z56A 1USDA 1OVRA 2BQ1E 1L0IA 3CCRP 3IR9A 3SWYA 4H0LD 3TDKA 3L73E 3TGUG 2LL8A 1F80D 2IZ0A 2PEOA 2KK7A 2ZFCA 3FWLA 1JM0A 1SP4A 4F37A 1GMJA 2G8YA 2FADA 3GF7A 1SQPD 2ZVNB 3FXEA 5GTIE 5APYA 3A5TA 1QLED 3IFMA 2QJYC 3AE3C 2PRRA 3S1KA 2PAJA 2ROQA 1S4XA 5E79E 3U1AA 2Y0DA 3VYIA 2IYPA 5AVYB 2FYUG 1NTZK 2FVFA 2Z5HA 4XROA 2JBGA 5AVXB 4RJTA 5CJ4A 4YXDC 2AEJA 4R4LA 2O1KA 3H1KJ 2CG5B 3RK2B 1PV3A 1PPJD 2AEFA 3Q5PA 3WUTA 1EZVD 1GD2E 2Z4EA 1NTKE 4BRYA 2ONTA 1M1JC 1MZ8A 3LIDA 4Y28J 1IUQA 3HUSC 2NPSB 2M5AA 2W6JH 5B5EH 2JAZA 2KORA 1DD4A 3Q5RA 1M7LA 4OGQB 2FYUD 4WY4A 1JNMA 3VP8A 5APSA 1WRGA 3RK3C 1LT9B 1M56D 1KYOH 2PFXA 3GW6A 2FY8A 3H1LJ 1T3JA 1AYIA 1Q2NA 1FJPA 1TU3F 1U57A 5APUA 3TSIA 1NTMK 4U0DA 3CCSP 2L6EA 1BGYG 2LXCB 2IFNA 3U43A 3NMDA 2VSQA 1HH0A 2WSCJ 1NGMB 1FZFA 2K9YA 3G26A 3M9QA 1E79H 3DPHA 3TNUA 5KLVG 4COCA 1VHNA 4AQRD 3H47A 2GDXA 1PGJA 1JY2O 1VKUA 2E74B 3DS1A 3V4QA 1GU5A 2KW2A 2KNCA 2QVAA 3NY7B 3B5NC 1EIAA 3VRLC 2M3EA 3HTKA 5TISH 4WB4A 3P05A 1RE4C 3TF5A 3I5CA 4UB6E 5APXA 1ZW0A 3LW5H 2JWDA 1KB9E 2C0XA 3L72G 2GZGA 1JY2N 3RK2D 2KZJA 4A7PA 1BSNA 5APQA 1SQPK 1LT1A 1ZMEC 4GKGA 2OQQA 3AEFC 2ZYDA 1L0HA 4EDFA 1SQQE 1FBMA 5CCHD 4NEOA 3LRYA 3AEAC 1N7LA 2X2BA 1FJKA 3HD7D 2IBZI 5KAIH 1GW4A 5H2FE 1GTWA 3MUDA 2BCCG 1OFCX 1K9MQ 2L4BA 3JC22 2WSFJ 1HWTC 1PEMA 2KI7B 2FXPA 2M8LA 2ZXXA 1HGZA 3M9HA 2E75B 3FX0A 1NU1K 1DX7A 2IPPA 1BSHA 2W90A 5HGNA 1K73Q 2JGPA 1OMIA 1NTME 3CCLP 3GHGA 1RE4A 1AUMA 4MN4C 1KILB 5AW9B 4W80A 3Q3DA 2QM7A 2NZ2A 1L4AD 1URQA 3CD6P 2HR3A 1IO4A 5BS1A 1FS0E 1MV8A 2LR2A 3IF4A 1RY3A 2E74D 3C9IA 3P8CD 1JY3O 3KDPB 2IYOA 2JJLA 3L74G 2B88A 1NJIQ 1LTBC 3S4RA 4U0EA 3CE7A 1M90Q 1PGQA 1UNKA 3RK3E 1SQBJ 4UB6H 2B9BA 1ZRTD 3IN6A 3CWBG 5TISE 7CEIA 1BCCJ 4EI2A 5KJ7C 2K93A 3CCQP 4I2LC 4L73A 1DNYA 2N5HA 4ZNCA 1L0LE 1J2JB 1A8OA 4H2YC 1BDDA 1VQOP 1BDCA 3HTKB 2AXCA 3L75J 1NTZE 3EWKA 4DCKA 2KODA 2IBZD 1SLQA 5KJ7D 2Y9YA 1Q81Q 1KMIZ 2Q3IA 2M8RA 1N2DC 1VDFA 1VL2A 5CCGD 4PJ0E 3WUVA 1N73A 4HKZH 1NTZD 1USEA 4L75A 3L71D 4KHXA 1KILC 1MKMA 1KV4A 1VQPP 1SQBG 2MJZA 3CL3D 1P84I 1BGYE 4PD4I 5TJHA 1KQSO 1URQB 3U59A 1YJWP 2ZAEB 1BAJA 1SVFA 3GHGB 2YKOA 2YXQB 4U3FE 2MVUA 1N7SB 3L70J 2MR7A 2FAEA 3A0BE 1X0TA 1LT9A 3WU2H 2CGQA 4UHPB 4M3LA 2KGCA 1RE3A 2XZ0D 3L71G 2JKVA 1PP9J 3GZMA 2W83C 4WY4C 3G1GA 1RF1C 3ZDMA 2O01H 4I7ZC 2QNWA 5CCHA 4IL6E 3CX5H 3HE4B 5B66H 5M1BA 5HGLA 3TNUB 1NTMD 4YXWH 2E74C 3GF3A 2BASA 3G21A 1JB0J 1VQLP 2KSEA 2GZJA 3O8ZA 1IC2A 1NTKD 4DJGA 3C1LA 4Y99B 2HYNA 4AYCA 3N4XA 2I1JA 1X3OA 3V2PA 1SQVG 2MVVA 2FKWB 1KC8Q 2CK3H 1KFMA 2XDJA 4W7YA 3AE4C 3HE4A 4JPZB 1GL2B 2Y0EA 2HPCB 5AW4B 3F89A 1IMQA 2FFDC 1FU1A 3L72E 2E5YA 2D2CC 1Y8AA 5KKZC 1S9KE 2R5DA 3L71J 1FZCA 2Q5UA 1AQ5A 4U0FA 3B5IA 5APWA 1SQXG 1AA0A 3FGAD 2OTKE 3L70G 3QH9A 4U3FG 1L0LK 2Q9IA 4IZ6A 1HF9A 5AVSB 5E79H 2I1KA 4I7ZB 1OVVA 1GXGA 3GKLC 3LMOA 3M0DC 1S9KD 1K05A 3GJNA 3BRVB 1LTJC 1T2KC 3HYBA 2FVAA 2O3JA 2AXTE 2WWWA 2B87B 3AEBC 1VF5D 2KLUA 1AVOA 3H1KG 5GTHH 3HUSA 3E1IA 3H1LG 3CI9A 3WBHA 3PLNA 1UJZA 3CCJP 3USSA 1H88A 1L0LJ 5K5GB 1FZGA 2N98A 1YJNP 2OTLP 3VMYA 1H0TA 3L71E 3D71A 4N3YB 2XV5A 4XFYA 1QEXA 3MTUE 1H8AA 3GG2A 2N1TA 1OW8A 2W6AA 5AW0B 1RO2A 3H1IE 4YTPC 2N9YB 2A06D 4H44D 2P2UA 3H1KD 2N9BA 1NU1E 4D6TG 1DIPA 2JO1A 2BUOA 4KT0J 1EDKA 3OA7A 1S5LE 2ZYAA 2OYHA 1EZVI 2L91A 2VLQA 2QM8A 4HKGA 1YJ9P 1QL2A 3KXDA 2E42A
chains in the Genus database with same CATH topology
2XT1A 3CCEP 1QVGO 3CD6P 3CMAP 2QA4P 3H47A 1YI2P 1A43A 5BS1A 2PEKA 3G71P 5BS2A 1VQMP 2OARA 2PY8A 3G1IA 3MGEA 1RNIA 2E1MA 2PEJA 4XFXA 2QEXP 1PEUA 3DS1A 2JYGA 4GR6A 3G6EP 1QRJA 1KD1Q 3NTEA 1YHQP 2CWOA 3CCMP 1EIAA 4XROA 1NJIQ 4U0EA 2JYLA 3VRLC 3P05A 1M90Q 1VQ6P 3G1GA 3G29A 2PEMA 3HYBA 1D1DA 3CC7P 2DGYA 2M8PA 1VQ8P 3CC4P 1K30A 5F2NA 3DS3A 3CXCO 1M6NA 1RO0A 4COPA 4XRQA 3HZQA 1YIJP 3CCQP 5F2KA 5HGLA 3G0VA 3G4SP 3WBHA 2ONTA 2LF4A 2Z45A 1IUQA 3CCJP 1M1KQ 2PENA 3G21A 1VQLP 2JO0A 1A8OA 3CPWO 1S72P 3CMEP 1PEOA 4WYMA 1YJNP 1VQOP 2P9XA 3CC2P 1EOQA 2OTLP 1ZMBA 4XFYA 3LRYA 3E2DA 4M0IA 3DS2A 1VQNP 4U0BA 4U0AA 1K8AQ 2KODA 1RO2A 1VQ7P 1E6JP 3RG6C 1VQ5P 5HGMA 5HGOA 2EG5A 2Z46A 3Q20A 2BHVA 1Q81Q 3CCVP 1VQKP 3I55P 4QNBA 4IPYA 2M8NA 3H0DA 1VQ9P 1K9MQ 3DS4A 1M6EX 1W2BO 2Z44A 5I4TG 1YITP 1PEMA 4PH0A 3CCUP 3DS5A 2EFJA 1KC8Q 5JPAA 2M8LA 3G28A 5DCKA 1N8RQ 1JJ2O 4U0CA 3DS0A 2XXMA 1M74A 3H4EA 1VQ4P 2BQ1E 4GR2A 3I56P 4U0DA 3CCRP 3CCSP 2BUOA 2L6EA 3DTJA 1Q86Q 1VQPP 4XFZA 1PEQA 1Q82Q 2OTJP 5HGNA 1Q7YQ 1K73Q 2PEIA 2PEOA 3OW2O 1KQSO 3CCLP 3M1MA 1AUMA 5F2OA 1YJWP 1QVFO 3G26A 2EIAA 1BAJA 2PEQA 2XV6A 1YJ9P 3DPHA 4PH1A 4U0FA 4COCA 3B5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPW O;  1S72 P;  3CCE P;  1YJN P;  1QVG O;  1VQO P;  3CMA P;  2QA4 P;  3CC2 P;  3CD6 P;  1N8R Q;  2OTL P;  1JJ2 O;  1YI2 P;  3CC7 P;  3G71 P;  1VQ8 P;  3CC4 P;  1VQ4 P;  1VQM P;  3I56 P;  1VQN P;  3CXC O;  3CCR P;  3CCS P;  2QEX P;  1K8A Q;  1VQ7 P;  1VQ5 P;  1VQ6 P;  1Q86 Q;  3G6E P;  1VQP P;  1YIJ P;  1Q81 Q;  1M90 Q;  3CCQ P;  1Q82 Q;  2OTJ P;  3CCV P;  1VQK P;  3I55 P;  1KD1 Q;  3G4S P;  1YHQ P;  1Q7Y Q;  1K73 Q;  3OW2 O;  3CCM P;  1KQS O;  1VQ9 P;  1VQL P;  1K9M Q;  3CCL P;  1NJI Q;  1YJW P;  1QVF O;  1W2B O;  3CCJ P;  1YIT P;  1YJ9 P;  1M1K Q;  3CCU P;  3CME P;  1KC8 Q; 
#chains in the Genus database with same CATH topology
 2N1T B;  4JQ0 D;  2NO8 A;  3Q2Y A;  2JEE A;  4PD4 H;  5AVU B;  3MD0 A;  4IFM A;  3GMA A;  2QEX P;  2WSE H;  2CNR A;  1YQ3 C;  1KD1 Q;  2YKP A;  1SQP E;  2RKL A;  4R0M A;  2WVR A;  4L76 A;  1NTM G;  2YXR B;  3WUU A;  2GDW A;  2JWA A;  1HBW A;  3G29 A;  1GXH A;  1KFN A;  1D1D A;  4PV1 B;  4HYT B;  2MF4 A;  1URQ C;  2GZF A;  2PP6 A;  2NPS C;  2C9L Y;  1M1J A;  3K5B A;  2E75 D;  1RH5 B;  3V5B A;  5AW1 B;  1SFC A;  3H32 B;  3KZI E;  1CW5 A;  3VP9 A;  1MUU A;  2LF4 A;  1IFD A;  3L74 J;  3VOP A;  4BPF A;  4WY4 D;  1FR2 A;  2JDI H;  3NFQ A;  1EMV A;  2XND H;  1GU4 A;  1NU1 J;  2QJP C;  3B4S A;  5HGM A;  1PP9 E;  2Z5I A;  4ZMD A;  3BCC E;  3RBZ A;  1JY2 P;  4H44 B;  2KOP A;  1GL2 A;  2HPC A;  4U0C A;  3SFE C;  1M74 A;  1NU1 G;  3SSU A;  3UIA A;  2CPB A;  1EC5 A;  1L0N K;  1N86 A;  4BPH A;  1Q7Y Q;  1VPC A;  2BCC J;  4WBA A;  2ERH A;  3CME P;  2HOD A;  4AUW A;  1QVG O;  5B66 E;  3WU2 E;  4IL6 H;  5AW5 B;  3CXH D;  3D6Y A;  1NTK K;  3HE5 A;  4PV1 C;  3BCC J;  2J59 M;  2H43 A;  2K0D X;  2GYK A;  2K0Y A;  1N7S A;  1LP1 A;  3T97 A;  3SFD C;  5GTH E;  3CC7 P;  2M8P A;  1PFI A;  4PV1 D;  1VQ8 P;  3CC4 P;  1ZOY C;  4QKO A;  1XTC C;  5F2K A;  3L74 E;  3H1L D;  5EJD A;  2Z45 A;  2QJP B;  1G2C A;  2JO0 A;  4WYM A;  3CC2 P;  3M0D A;  5AW7 B;  1ZMB A;  1Z6M A;  2K0X A;  1FDO A;  4H13 D;  1EZV G;  1SFC B;  3KYQ A;  1JO5 A;  4PJ0 H;  1AV1 A;  2NPS A;  2D2C D;  1EDL A;  2KSJ A;  3V2N A;  5I4T G;  2EFJ A;  3MHV A;  2KOQ A;  1P84 E;  1VQ4 P;  1ZV8 A;  3G3Z A;  2BEQ D;  1QL1 A;  3TGU E;  2FVE A;  2LML A;  1L0N E;  2CPS A;  3H1I G;  2G3A A;  4GDO A;  2PEQ A;  2XV6 A;  5C39 A;  1G1I A;  3H1J E;  5KLV D;  4B86 A;  1IFN A;  3CMA P;  1OX3 A;  2E76 D;  5BS2 A;  1T6A A;  3L75 D;  3G1I A;  2YO2 A;  5KJ7 A;  2KOO A;  1YHQ P;  1WMK A;  3L36 A;  5HV8 A;  2E76 C;  3RL0 g;  1L0N D;  1X79 B;  2K92 A;  3VTP C;  3H1I D;  2A06 G;  4U3F J;  5F2N A;  1FZA A;  3DS3 A;  1RF0 C;  3T97 B;  2YNY A;  3L4F A;  2KLV A;  4RES B;  4GT1 A;  1GL2 D;  1NH4 A;  4PD4 D;  1OR5 A;  1L0L G;  1ZLL A;  2PEN A;  2KNC B;  2LKI A;  4RO0 A;  3NTN A;  2MY5 A;  3B5N B;  3L74 D;  1LJ2 A;  3MUD C;  2FYU E;  5BVZ A;  1U7M A;  1VQ5 P;  2P58 A;  2Z46 A;  2QIW A;  1DV5 A;  1CI6 A;  1UIX A;  1HQB A;  1MFZ A;  1JEK A;  4PD4 E;  1IMP A;  2ITA A;  3CWB E;  2NRG A;  3H1H D;  1LTS C;  5KLI C;  2Y9Z A;  4I1L A;  2M5A B;  1S5L H;  1N7S C;  5KAF H;  3P32 A;  1QVF O;  3A0B H;  1BE3 J;  1NKN A;  5KLV J;  3H1J J;  2M5R A;  3CCE P;  2QA4 P;  1SQX K;  1NTK J;  4C7N B;  1YI2 P;  2KGE A;  3EJE A;  2ZYG A;  2WTY A;  2E76 B;  3MGE A;  4BXL A;  2PEJ A;  1CI6 B;  2RN0 A;  1PL5 A;  4WY4 B;  1T3U A;  4H2W C;  1NAF A;  2DNW A;  2E75 C;  3EJB A;  2FQ0 A;  1T2K D;  4ASW A;  1SS1 A;  3LIE A;  1HVV A;  2KS1 B;  2GUS A;  2ZXE B;  2V4H A;  3BCC G;  2XNX A;  3AEC C;  3MIW A;  1AQT A;  5AVW B;  3PH0 A;  3A0H E;  1YTZ I;  1PP9 D;  2WT7 A;  3CXC O;  5KLV K;  3AEE C;  1Q90 D;  1HJ0 A;  2P1J A;  3II6 A;  2KUB A;  1NU1 D;  4HJG H;  1BGY D;  3B5N A;  1NHL A;  1R8E A;  2POH A;  2OYI A;  1S5L X;  4M0I A;  2YMY A;  4U0A A;  2O01 J;  1E6J P;  1CEI A;  1CSB A;  1Y47 A;  2Y0C A;  2EG5 A;  2QJK B;  1RF0 A;  1GZL A;  1BXI A;  3GZL A;  1GL2 C;  2KR5 A;  3CCU P;  2JQ4 A;  5KKZ B;  2JP3 A;  3AE6 C;  3CXH H;  3HD7 B;  4BWN A;  3L75 G;  3B4Q A;  1ZP0 C;  1PPJ E;  2MR8 A;  1Q82 Q;  3RBX A;  5EFW B;  1M8O B;  1JCD A;  4GIF A;  2C0W A;  2WSE J;  1T8K A;  2L9F A;  5KP8 B;  4EYY Q;  3A3Y B;  2FYN C;  4CPG A;  1LTJ B;  3CXH I;  2P67 A;  5GTI H;  4EOT A;  2H7H A;  1NTZ G;  1S1C X;  1EDJ A;  2W6B A;  1FE6 A;  1M57 D;  1VQ6 P;  1AFO A;  4KJM A;  1IFP A;  1JTH A;  3O6Q A;  1QX8 A;  4GOE A;  1HJB A;  5AW2 B;  2IDB A;  4RKU J;  1ACP A;  1IJD B;  1LWU C;  3HZQ A;  1JOC A;  2UWJ E;  2AFE A;  2QRX A;  2BEZ F;  1SQP G;  1SQX D;  1RQU A;  4H2X C;  3NXS A;  3Q1M A;  1S2E A;  2OYI C;  2O1J A;  3CPW O;  2XKM A;  2H8P D;  1LP1 B;  1AVY A;  3HRN A;  2IFM A;  3H1H J;  2A45 G;  1BCC G;  2KOG A;  3SWF A;  3L72 J;  3EFF K;  2N50 A;  3Q20 A;  1FZC B;  2K1A A;  2QJY B;  1PPJ G;  5CJ0 A;  1SQQ D;  3FWN A;  2YKQ A;  1BE3 G;  2MKV A;  1AF8 A;  4R4M A;  2KIK A;  5BU8 B;  4N6J A;  3L35 A;  1HTL C;  2R3S A;  3OAK A;  1GDT A;  2N1T C;  3S9O A;  3TYY A;  2FQ2 A;  1SQX J;  1X8Y A;  4Y99 C;  1H0T B;  2FYN B;  2KWL A;  2HOD B;  3L37 A;  1OXZ A;  1HUC A;  4XFX A;  2YIU B;  3HUS B;  1YBK A;  2K5X A;  1NQ4 A;  2A45 H;  2K9J B;  1URQ D;  4OGQ C;  3NTE A;  2FXO A;  2IZ1 A;  2FFD B;  1EDI A;  2D2C B;  2GDY A;  2N5I A;  1W5C E;  4DT0 A;  1YQ4 C;  1IFM A;  3L70 E;  3RL0 C;  3H1H E;  2K37 A;  3VMZ A;  4U3F D;  1HY8 A;  3EFG A;  2K88 A;  1IFJ A;  2AXT H;  4XRQ A;  2Q1K A;  2KZI A;  2LKM A;  3H1J D;  5KLV E;  1NVO A;  1OW7 A;  2RMZ A;  1LWU A;  4LLH A;  1NAY A;  4C7N A;  5AVZ B;  2JU1 A;  3TGU D;  1JMB A;  2BCC E;  1KZU B;  1EQ7 A;  2DW3 A;  5DJU B;  3WMM 0;  2N6Z A;  4DZO A;  1KQL A;  1K8A Q;  2FXM A;  2Q6Q A;  3H32 A;  4H44 C;  5HGO A;  2BHV A;  3BRT B;  4TT3 H;  4QMA A;  4IPY A;  2M8N A;  1PIX A;  2OYO A;  5BU5 A;  3DS4 A;  1SQV K;  1H89 A;  2PGD A;  1L0L D;  3DS5 A;  1U7J A;  1UII A;  3B71 A;  2FYU J;  2XXM A;  4ZKU A;  3Q5S A;  1IZN B;  2C9N Y;  3BVH A;  4GR2 A;  3AE8 C;  1D7M A;  1N73 C;  2M3B A;  2L0Q A;  5AVV B;  1ZRT E;  3M06 A;  5H2F H;  2OTJ P;  3H25 A;  2WPV B;  3OW2 O;  1GPJ A;  4MRT C;  2OYH C;  2YIU C;  1L2P A;  2WSS H;  2QJK C;  5KP6 B;  4U7J A;  1VQM P;  1JCC A;  1SQB E;  2L5G B;  1SQQ K;  2VLP A;  1JTH B;  3O6Q B;  4PXH B;  2P10 A;  3CX5 D;  3VN0 A;  2WQY C;  3B5N D;  2FYU K;  2AFD A;  3MZW B;  2KP8 A;  4UB8 H;  1KB9 H;  5KTB A;  3V4W A;  3B8E B;  1SQP J;  1KN7 A;  2RH0 A;  3AE9 C;  4OVN F;  1LTG C;  4D6T E;  4IFD K;  1BE3 D;  2KYV A;  4N78 E;  3P8M C;  3V2Q A;  2ZT9 C;  2BCC D;  3BCC D;  1M1K Q;  3JSV C;  1YTZ T;  4PWV B;  1SFC C;  1SQB K;  3TGU J;  4IOI H;  2P9X A;  2E5T A;  2IBZ E;  4HB1 A;  4ASV A;  3DS2 A;  1M1J B;  4U0B A;  2LIU A;  1EZV E;  5CCH C;  2JU2 A;  4D6T J;  2Q7C A;  4BRY B;  2V7Q J;  2FHS C;  5EW5 E;  5AVT B;  2WSC H;  3VMA A;  3CX5 I;  3M0A A;  3H0D A;  1RQV A;  3RK3 D;  2W27 A;  5CBN A;  2M0B A;  5DCK A;  4YPC A;  1KYO D;  1JJ2 O;  1LT9 C;  3DS0 A;  3H4E A;  4O9B A;  1GK6 A;  2W8Z A;  2OYI B;  1N7S D;  1J1D B;  1Q86 Q;  1SQV E;  3OJA B;  2AVA A;  3KQG A;  2PEI A;  1DEB A;  3F5H A;  2EIA A;  2MD9 A;  1FAV A;  1A02 J;  2FYZ A;  1BE3 E;  1FZC C;  2H89 C;  3P8C E;  2XZ1 C;  1S3J A;  1AJY A;  3CWB J;  2QE7 H;  1RNI A;  1SQV D;  1PEU A;  4JF7 A;  1R5S A;  2KB7 P;  5CZD B;  1E0H A;  5AW8 B;  2GZE A;  4W7Z A;  2JYL A;  2IBZ G;  2N1T D;  4DOJ A;  2HLO A;  1K04 A;  3L73 D;  4H0L B;  5CMZ A;  1NYH A;  1GK4 A;  1A02 F;  1G1J A;  3C8V A;  2ZT9 B;  3PTZ A;  4IFF A;  3EQ2 A;  1Y9B A;  3CLQ A;  1YIJ P;  3PP5 A;  4JBZ A;  2L22 A;  3VMX A;  2WSF H;  3G4S P;  3AE5 C;  2SPZ A;  3D6Z A;  2J5U A;  2GM4 A;  1PZQ A;  2QSI A;  2R32 A;  3JCU H;  1LNQ A;  3IAO A;  1LTI C;  3W68 A;  3E2D A;  1BCC D;  1BCC E;  1KLP A;  4WVZ A;  4C46 A;  3H6P A;  2QG4 A;  2B87 A;  3AED C;  3GHG C;  3JCU E;  3I55 P;  1PGP A;  3RL0 B;  3E7K A;  1M6E X;  2LPK A;  4DG9 A;  2K9J A;  1OWA A;  4I6M C;  4PH0 A;  1FZB A;  5KLI B;  5JPA A;  1KYO I;  3G28 A;  3PRJ A;  3CX5 E;  1SQB D;  2GA1 A;  1FZE A;  2R5B A;  4CA3 A;  2FAC A;  3HE5 B;  4NPE A;  1ZNV A;  1R5L A;  4K3A A;  2PNG A;  1A43 A;  3G71 P;  1PGO A;  1L0N J;  2OAR A;  2PY8 A;  1X9V A;  3U1C A;  2O01 N;  3FXD A;  3QWO C;  1X22 A;  1VF5 B;  3BAS A;  1NTK G;  2IX7 C;  4H0L C;  1OVU A;  3A2A A;  3CCM P;  2N6Y A;  5AW6 B;  3H1K E;  3N7N A;  1IK7 A;  3LW5 J;  1KQG B;  1W2E A;  2A06 E;  5HVC A;  2JR8 A;  3SWK A;  2DGY A;  1ZN5 A;  1MZ9 A;  1XTG B;  2OYH B;  2ZT9 D;  1RF1 A;  2YO3 A;  3AE1 C;  1FOS E;  5CCG C;  4K35 A;  5CBO A;  5AW3 B;  3A0H H;  1QGK B;  2FQ1 A;  1SQQ J;  1IFI A;  2HFE D;  1J1E B;  1S72 P;  1L4A C;  1BGY J;  3G9R A;  3PHL A;  3P7K A;  2CQ8 A;  1OZH A;  3CWB D;  1VQN P;  1KYO E;  1VQ7 P;  2WPS A;  1L4A A;  3V6I A;  3CCV P;  2AF8 A;  1VQ9 P;  4GOF A;  2KXP B;  3RL0 D;  3HD7 C;  5CHX A;  3H1I J;  4HH2 A;  4JYB A;  2EHS A;  1KIL A;  5B5E E;  3I56 P;  5KAF E;  1SFC D;  1DEE G;  4BPG A;  1KOR A;  1L0N G;  1JY3 N;  1NO4 A;  2NPS D;  4XFZ A;  1PEQ A;  5DJT B;  1ZR2 A;  2WT7 B;  1DH3 A;  1CZQ A;  3R2P A;  1E5W A;  4OGQ D;  1NKZ B;  3M1M A;  5F2O A;  3M91 A;  1ZR4 A;  2Q3E A;  3MGN A;  2E43 A;  1LTJ A;  3R4Y A;  3ABV C;  2GUV A;  2XT1 A;  3HD7 A;  1DD3 A;  3PJS K;  1FC2 C;  3H1H G;  1LTA C;  2E1M A;  3L72 D;  5AVQ B;  3KZI H;  1RE3 C;  4NPD A;  2FFD A;  2CWO A;  3ITK A;  2P7J A;  1G2C B;  1EXJ A;  1FDI A;  1J1D C;  2VRS A;  1LWU B;  4ZKP A;  2WPQ A;  3A7O A;  2PEM A;  3RK3 B;  2WMM A;  5AVR B;  1FOS F;  3L75 E;  1K30 A;  5KAI E;  1M6N A;  1RO0 A;  2R44 A;  4LGD E;  1J1E C;  1P84 D;  4OH8 B;  1KIL D;  4C7R A;  1RF1 B;  1JMM A;  1L4A B;  4JYC A;  2WZ7 A;  3E1R A;  5CCG A;  1T8Z A;  1SQQ G;  3KPE A;  1IK9 A;  2OGU A;  1SQV J;  3AE2 C;  4H13 C;  4GOD A;  1EOQ A;  4LC1 A;  4XA4 A;  2EHT A;  1SQX E;  5APV A;  2B89 A;  3RG6 C;  4OWF A;  1JUN A;  1KB9 D;  3RGU A;  3M9B A;  2KOS A;  2K94 A;  2Z44 A;  1YIT P;  2LOL A;  4N78 D;  3V2R A;  2VLN A;  3KHU A;  4D6T D;  2HG5 D;  3MP7 B;  1JY3 P;  1NWQ A;  1OIP A;  2XU6 A;  5APT A;  1LTT C;  3L73 G;  3DTJ A;  2LIW A;  3EJD A;  2KS1 A;  1NTM J;  1PP9 G;  1P84 H;  4PH1 A;  5KP7 B;  2R3C A;  1WT6 A;  1MFT A;  3D70 A;  2PEK A;  2LXB A;  3L73 J;  3CXH E;  3L70 D;  3AEG C;  3RG2 A;  1YYC A;  2ZVO B;  2JYG A;  4GR6 A;  2KG6 A;  2JB0 A;  1HGV A;  3G6E P;  2J58 A;  1QRJ A;  1FDM A;  1KB9 I;  3H1J G;  4EIJ A;  2GZI A;  4NPF X;  2KG8 A;  1ZXG A;  4TLF A;  2H88 C;  2AEM A;  2K3R A;  4L74 A;  1NOH A;  2A45 I;  3GLM A;  4COP A;  2I8D A;  3TK1 A;  4H13 B;  1RHZ B;  2YMK A;  5L8R J;  2K2Q A;  3G0V A;  2FBW C;  3RK2 C;  2WPT A;  2XZR A;  4UB8 E;  2KGD A;  2VLO A;  2LTE A;  1PEO A;  2KGA A;  1VF5 C;  3BAT A;  2WPR A;  1EXI A;  1KIL E;  4WWI A;  1LGH B;  4IL6 X;  4Z1M H;  1GW3 A;  1OW6 A;  1VQK P;  4QNB A;  3AE7 C;  4XE5 B;  2V7Q H;  3W67 A;  4XFJ A;  1W2B O;  2KG9 A;  3H1L E;  1KTM A;  1N73 B;  2ZJS E;  2WIT A;  1KQF B;  1N8R Q;  1NTZ J;  1Z56 A;  1USD A;  1OVR A;  2BQ1 E;  1L0I A;  3CCR P;  3IR9 A;  3SWY A;  4H0L D;  3TDK A;  3L73 E;  3TGU G;  2LL8 A;  1F80 D;  2IZ0 A;  2PEO A;  2KK7 A;  2ZFC A;  3FWL A;  1JM0 A;  1SP4 A;  4F37 A;  1GMJ A;  2G8Y A;  2FAD A;  3GF7 A;  1SQP D;  2ZVN B;  3FXE A;  5GTI E;  5APY A;  3A5T A;  1QLE D;  3IFM A;  2QJY C;  3AE3 C;  2PRR A;  3S1K A;  2PAJ A;  2ROQ A;  1S4X A;  5E79 E;  3U1A A;  2Y0D A;  3VYI A;  2IYP A;  5AVY B;  2FYU G;  1NTZ K;  2FVF A;  2Z5H A;  4XRO A;  2JBG A;  5AVX B;  4RJT A;  5CJ4 A;  4YXD C;  2AEJ A;  4R4L A;  2O1K A;  3H1K J;  2CG5 B;  3RK2 B;  1PV3 A;  1PPJ D;  2AEF A;  3Q5P A;  3WUT A;  1EZV D;  1GD2 E;  2Z4E A;  1NTK E;  4BRY A;  2ONT A;  1M1J C;  1MZ8 A;  3LID A;  4Y28 J;  1IUQ A;  3HUS C;  2NPS B;  2M5A A;  2W6J H;  5B5E H;  2JAZ A;  2KOR A;  1DD4 A;  3Q5R A;  1M7L A;  4OGQ B;  2FYU D;  4WY4 A;  1JNM A;  3VP8 A;  5APS A;  1WRG A;  3RK3 C;  1LT9 B;  1M56 D;  1KYO H;  2PFX A;  3GW6 A;  2FY8 A;  3H1L J;  1T3J A;  1AYI A;  1Q2N A;  1FJP A;  1TU3 F;  1U57 A;  5APU A;  3TSI A;  1NTM K;  4U0D A;  3CCS P;  2L6E A;  1BGY G;  2LXC B;  2IFN A;  3U43 A;  3NMD A;  2VSQ A;  1HH0 A;  2WSC J;  1NGM B;  1FZF A;  2K9Y A;  3G26 A;  3M9Q A;  1E79 H;  3DPH A;  3TNU A;  5KLV G;  4COC A;  1VHN A;  4AQR D;  3H47 A;  2GDX A;  1PGJ A;  1JY2 O;  1VKU A;  2E74 B;  3DS1 A;  3V4Q A;  1GU5 A;  2KW2 A;  2KNC A;  2QVA A;  3NY7 B;  3B5N C;  1EIA A;  3VRL C;  2M3E A;  3HTK A;  5TIS H;  4WB4 A;  3P05 A;  1RE4 C;  3TF5 A;  3I5C A;  4UB6 E;  5APX A;  1ZW0 A;  3LW5 H;  2JWD A;  1KB9 E;  2C0X A;  3L72 G;  2GZG A;  1JY2 N;  3RK2 D;  2KZJ A;  4A7P A;  1BSN A;  5APQ A;  1SQP K;  1LT1 A;  1ZME C;  4GKG A;  2OQQ A;  3AEF C;  2ZYD A;  1L0H A;  4EDF A;  1SQQ E;  1FBM A;  5CCH D;  4NEO A;  3LRY A;  3AEA C;  1N7L A;  2X2B A;  1FJK A;  3HD7 D;  2IBZ I;  5KAI H;  1GW4 A;  5H2F E;  1GTW A;  3MUD A;  2BCC G;  1OFC X;  1K9M Q;  2L4B A;  3JC2 2;  2WSF J;  1HWT C;  1PEM A;  2KI7 B;  2FXP A;  2M8L A;  2ZXX A;  1HGZ A;  3M9H A;  2E75 B;  3FX0 A;  1NU1 K;  1DX7 A;  2IPP A;  1BSH A;  2W90 A;  5HGN A;  1K73 Q;  2JGP A;  1OMI A;  1NTM E;  3CCL P;  3GHG A;  1RE4 A;  1AUM A;  4MN4 C;  1KIL B;  5AW9 B;  4W80 A;  3Q3D A;  2QM7 A;  2NZ2 A;  1L4A D;  1URQ A;  3CD6 P;  2HR3 A;  1IO4 A;  5BS1 A;  1FS0 E;  1MV8 A;  2LR2 A;  3IF4 A;  1RY3 A;  2E74 D;  3C9I A;  3P8C D;  1JY3 O;  3KDP B;  2IYO A;  2JJL A;  3L74 G;  2B88 A;  1NJI Q;  1LTB C;  3S4R A;  4U0E A;  3CE7 A;  1M90 Q;  1PGQ A;  1UNK A;  3RK3 E;  1SQB J;  4UB6 H;  2B9B A;  1ZRT D;  3IN6 A;  3CWB G;  5TIS E;  7CEI A;  1BCC J;  4EI2 A;  5KJ7 C;  2K93 A;  3CCQ P;  4I2L C;  4L73 A;  1DNY A;  2N5H A;  4ZNC A;  1L0L E;  1J2J B;  1A8O A;  4H2Y C;  1BDD A;  1VQO P;  1BDC A;  3HTK B;  2AXC A;  3L75 J;  1NTZ E;  3EWK A;  4DCK A;  2KOD A;  2IBZ D;  1SLQ A;  5KJ7 D;  2Y9Y A;  1Q81 Q;  1KMI Z;  2Q3I A;  2M8R A;  1N2D C;  1VDF A;  1VL2 A;  5CCG D;  4PJ0 E;  3WUV A;  1N73 A;  4HKZ H;  1NTZ D;  1USE A;  4L75 A;  3L71 D;  4KHX A;  1KIL C;  1MKM A;  1KV4 A;  1VQP P;  1SQB G;  2MJZ A;  3CL3 D;  1P84 I;  1BGY E;  4PD4 I;  5TJH A;  1KQS O;  1URQ B;  3U59 A;  1YJW P;  2ZAE B;  1BAJ A;  1SVF A;  3GHG B;  2YKO A;  2YXQ B;  4U3F E;  2MVU A;  1N7S B;  3L70 J;  2MR7 A;  2FAE A;  3A0B E;  1X0T A;  1LT9 A;  3WU2 H;  2CGQ A;  4UHP B;  4M3L A;  2KGC A;  1RE3 A;  2XZ0 D;  3L71 G;  2JKV A;  1PP9 J;  3GZM A;  2W83 C;  4WY4 C;  3G1G A;  1RF1 C;  3ZDM A;  2O01 H;  4I7Z C;  2QNW A;  5CCH A;  4IL6 E;  3CX5 H;  3HE4 B;  5B66 H;  5M1B A;  5HGL A;  3TNU B;  1NTM D;  4YXW H;  2E74 C;  3GF3 A;  2BAS A;  3G21 A;  1JB0 J;  1VQL P;  2KSE A;  2GZJ A;  3O8Z A;  1IC2 A;  1NTK D;  4DJG A;  3C1L A;  4Y99 B;  2HYN A;  4AYC A;  3N4X A;  2I1J A;  1X3O A;  3V2P A;  1SQV G;  2MVV A;  2FKW B;  1KC8 Q;  2CK3 H;  1KFM A;  2XDJ A;  4W7Y A;  3AE4 C;  3HE4 A;  4JPZ B;  1GL2 B;  2Y0E A;  2HPC B;  5AW4 B;  3F89 A;  1IMQ A;  2FFD C;  1FU1 A;  3L72 E;  2E5Y A;  2D2C C;  1Y8A A;  5KKZ C;  1S9K E;  2R5D A;  3L71 J;  1FZC A;  2Q5U A;  1AQ5 A;  4U0F A;  3B5I A;  5APW A;  1SQX G;  1AA0 A;  3FGA D;  2OTK E;  3L70 G;  3QH9 A;  4U3F G;  1L0L K;  2Q9I A;  4IZ6 A;  1HF9 A;  5AVS B;  5E79 H;  2I1K A;  4I7Z B;  1OVV A;  1GXG A;  3GKL C;  3LMO A;  3M0D C;  1S9K D;  1K05 A;  3GJN A;  3BRV B;  1LTJ C;  1T2K C;  3HYB A;  2FVA A;  2O3J A;  2AXT E;  2WWW A;  2B87 B;  3AEB C;  1VF5 D;  2KLU A;  1AVO A;  3H1K G;  5GTH H;  3HUS A;  3E1I A;  3H1L G;  3CI9 A;  3WBH A;  3PLN A;  1UJZ A;  3CCJ P;  3USS A;  1H88 A;  1L0L J;  5K5G B;  1FZG A;  2N98 A;  1YJN P;  2OTL P;  3VMY A;  1H0T A;  3L71 E;  3D71 A;  4N3Y B;  2XV5 A;  4XFY A;  1QEX A;  3MTU E;  1H8A A;  3GG2 A;  2N1T A;  1OW8 A;  2W6A A;  5AW0 B;  1RO2 A;  3H1I E;  4YTP C;  2N9Y B;  2A06 D;  4H44 D;  2P2U A;  3H1K D;  2N9B A;  1NU1 E;  4D6T G;  1DIP A;  2JO1 A;  2BUO A;  4KT0 J;  1EDK A;  3OA7 A;  1S5L E;  2ZYA A;  2OYH A;  1EZV I;  2L91 A;  2VLQ A;  2QM8 A;  4HKG A;  1YJ9 P;  1QL2 A;  3KXD A;  2E42 A; 
#chains in the Genus database with same CATH homology
 2XT1 A;  3CCE P;  1QVG O;  3CD6 P;  3CMA P;  2QA4 P;  3H47 A;  1YI2 P;  1A43 A;  5BS1 A;  2PEK A;  3G71 P;  5BS2 A;  1VQM P;  2OAR A;  2PY8 A;  3G1I A;  3MGE A;  1RNI A;  2E1M A;  2PEJ A;  4XFX A;  2QEX P;  1PEU A;  3DS1 A;  2JYG A;  4GR6 A;  3G6E P;  1QRJ A;  1KD1 Q;  3NTE A;  1YHQ P;  2CWO A;  3CCM P;  1EIA A;  4XRO A;  1NJI Q;  4U0E A;  2JYL A;  3VRL C;  3P05 A;  1M90 Q;  1VQ6 P;  3G1G A;  3G29 A;  2PEM A;  3HYB A;  1D1D A;  3CC7 P;  2DGY A;  2M8P A;  1VQ8 P;  3CC4 P;  1K30 A;  5F2N A;  3DS3 A;  3CXC O;  1M6N A;  1RO0 A;  4COP A;  4XRQ A;  3HZQ A;  1YIJ P;  3CCQ P;  5F2K A;  5HGL A;  3G0V A;  3G4S P;  3WBH A;  2ONT A;  2LF4 A;  2Z45 A;  1IUQ A;  3CCJ P;  1M1K Q;  2PEN A;  3G21 A;  1VQL P;  2JO0 A;  1A8O A;  3CPW O;  1S72 P;  3CME P;  1PEO A;  4WYM A;  1YJN P;  1VQO P;  2P9X A;  3CC2 P;  1EOQ A;  2OTL P;  1ZMB A;  4XFY A;  3LRY A;  3E2D A;  4M0I A;  3DS2 A;  1VQN P;  4U0B A;  4U0A A;  1K8A Q;  2KOD A;  1RO2 A;  1VQ7 P;  1E6J P;  3RG6 C;  1VQ5 P;  5HGM A;  5HGO A;  2EG5 A;  2Z46 A;  3Q20 A;  2BHV A;  1Q81 Q;  3CCV P;  1VQK P;  3I55 P;  4QNB A;  4IPY A;  2M8N A;  3H0D A;  1VQ9 P;  1K9M Q;  3DS4 A;  1M6E X;  1W2B O;  2Z44 A;  5I4T G;  1YIT P;  1PEM A;  4PH0 A;  3CCU P;  3DS5 A;  2EFJ A;  1KC8 Q;  5JPA A;  2M8L A;  3G28 A;  5DCK A;  1N8R Q;  1JJ2 O;  4U0C A;  3DS0 A;  2XXM A;  1M74 A;  3H4E A;  1VQ4 P;  2BQ1 E;  4GR2 A;  3I56 P;  4U0D A;  3CCR P;  3CCS P;  2BUO A;  2L6E A;  3DTJ A;  1Q86 Q;  1VQP P;  4XFZ A;  1PEQ A;  1Q82 Q;  2OTJ P;  5HGN A;  1Q7Y Q;  1K73 Q;  2PEI A;  2PEO A;  3OW2 O;  1KQS O;  3CCL P;  3M1M A;  1AUM A;  5F2O A;  1YJW P;  1QVF O;  3G26 A;  2EIA A;  1BAJ A;  2PEQ A;  2XV6 A;  1YJ9 P;  3DPH A;  4PH1 A;  4U0F A;  4COC A;  3B5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...