3CCJQ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3ccjQ00
1VQLQ 1YITQ 3CXCP 1VQMQ 1VQ7Q 1Q82R 1K9MR 2OTJQ 1YJNQ 1KD1R 2QEXQ 3CCUQ 1Q7YR 2OTLQ 3CPWP 1M90R 3OW2P 1QVGP 3I56Q 2QA4Q 1S72Q 3CC4Q 1VQPQ 1YHQQ 1VQ8Q 1YIJQ 1VQKQ 3CC2Q 1VQNQ 1W2BP 1Q86R 1YJWQ 1JJ2P 3CMEQ 3G6EQ 1VQ4Q 1M1KR 1NJIR 1N8RR 1K73R 1VQOQ 3CCRQ 3CCQQ 3CCVQ 3I55Q 3CCLQ 3G71Q 1KQSP 3CCEQ 3G4SQ 3CCSQ 1VQ9Q 1YJ9Q 1VQ5Q 3CD6Q 3CC7Q 1KC8R 1QVFP 1VQ6Q 3CCJQ 3CCMQ 1YI2Q 3CMAQ 1K8AR 1Q81R
chains in the Genus database with same CATH superfamily
3TU4K 1YJWA 1PWTA 1NE8A 1N27A 1BCMA 4ZTJA 3PIOA 2WSCE 1N5ZA 1WXBA 2RQWA 2D0NA 1R0CB 4J9CA 3CCRQ 2LX9A 2F5TX 2VV5A 3JB9J 1VYTA 2DD5A 2GCXA 2EJFA 5GANf 1WJRA 1E6GA 1MMNA 1VQ5Q 1VUBA 3LH0A 3PT9A 5CKDA 4CC7A 1XJWB 3G6EA 1Q82R 3BY7A 5GAOl 3CPWP 2RQUA 2FG0A 1WIEA 3PIPA 2CKKA 3EH2A 1M90C 3LX7A 4RG2A 4BI3A 4C0DC 5M9OA 4M77F 1YJ9Q 2EJGA 2CT4A 1JJ2S 1B3QA 1WJQA 2V26A 4M77G 2O88A 1MUZA 1CKAA 1YWPA 1VQMT 4OVAA 5IN1A 2DJZA 1QP2A 2LVMA 1S72Q 4GLKA 2HBPA 1YIJQ 3H0HA 2HSPA 1RI9A 2WACA 2DE0X 1XOVA 3CMEQ 1ZUUA 4XTXA 4JUVA 1WJSA 4KH0B 4JRKA 1YITA 2VYTA 4OB3B 4PLLA 2GNCA 5D7UA 4FCYA 2RQVA 4YTLA 4DEYA 5KE2A 5LJ3f 2M0YA 2PTKA 5A0DA 4C0DB 2DEQA 5LJ3j 5CKBA 2OAUA 1NZ9A 1FYNA 4C92C 3VU3C 5AT1B 3OA6A 2HQEA 2HKNA 2LNVA 3QYGB 2CP6A 4PJLA 3MEVA 4RMOA 2M1HA 4PJJA 2EYZA 2X3WD 5FRNA 3I55T 1NPRA 4K11A 3PTAA 1G5VA 3QG1A 1HK9A 1ZSZA 1RAGB 4FYVB 1FMWA 4LE9A 4RTYA 5IHNA 4ZNXA 3J80E 1C6VX 4J6YA 1GFCA 5GMKh 2DL8A 1MMAA 4OP0A 1U1TA 3IQLA 1WYXA 3WVDB 4Z88A 2A36A 3RBBB 2Y90A 3P8BB 1PSFA 4C92B 3QWXX 2JJ9A 2DJQA 2B86A 2OI3A 4A54A 4M75F 1YI2T 2DL5A 5CKHA 2E70A 1GRIA 4BI4A 1OU9A 1R77A 1LJOA 1OV3A 3OYIA 3CCJA 1RI0A 3MO8A 5GJVB 2KYMA 4F7UF 4M7AC 3M4GA 3C94A 4J7FA 4DBRA 3SD4A 1KHCA 5CIUA 1MMDA 2FRYA 1VQ7T 3M0RA 2AKLA 4BE2A 1MHNA 2MK5A 4A4HA 4C0GA 4MZPA 3NTIA 2RQRA 3RKYA 1NYGA 2YHTA 4AFSC 1VQOQ 2AT1B 3S6WA 1D0XA 3QYHB 1I81A 3UATA 2F1LA 3S3NA 3H0FA 5KYYA 3TCJA 1IGQA 3X26B 3J7AF 2LQKA 5GJWB 4NL2A 1Q7YR 2EGEA 3ER0A 4M7AB 3I55A 4IUPA 1Q82C 2F2WA 3META 5GAMg 2GF7A 4HA8A 1GCQC 4PJOG 3URGA 4QKUA 2L3SA 1VQ4Q 3BDUA 7AT1B 4JRQA 3GNFB 1ZBJA 2EJ9A 4C5IA 1QVPA 2OTLT 2ED1A 1VQNA 3BE3A 4RTXA 2MYSA 3E9GA 4PFPA 3TQ7P 2J6OA 2RHIA 2RH2A 2DA9A 3EG0A 4XU0A 2FZGB 1VA7A 4Q5WA 2XKOC 3H41A 2ROLA 3EG2A 1M90U 2PUOB 3S3OA 1VQ8A 1AWWA 4DOWA 4LDWA 4PJOD 4M77E 5KYWB 1RAAB 3C4SA 1AHJB 3CC4Q 2RF0A 1IB8A 2EYYA 3L2UA 4F16A 4HT8A 2XU8A 2D1XA 3CBPA 1ZSGA 3OYDA 1Y96A 5GMKj 2KR3A 3L2ZA 3EAEA 1C1AA 3HPWA 3A8GB 4LUDA 2ZPIB 4XU3A 3PVLA 2DBMA 2NWMA 4CRIA 2D8HA 1U8RA 1UHFA 3JB9I 4C8QG 3SDZA 3CCQQ 1R8OB 3CPWS 2XDBA 3JRZA 4QVZA 3KXTA 3NFCA 2DAQA 3QDFA 2WSFE 2CP5A 3NTKA 3FJ5A 3CC2Q 2JMAA 2GFAA 5EG2A 1TSFA 2RI5A 3CCLQ 2QDYB 1PM3A 2JMCA 3G4SQ 3QDRB 2PZ1A 1IXDA 1W2BS 4E2FB 1DJ7B 4AFQC 2QASA 1XQHA 2XG8D 5IHKA 1YNZA 3OMCA 4E6RA 3OY9A 1FXXA 4BB7A 4C8QD 3P8HA 5KYUA 3ASKA 4ELZC 2EQJA 4OMLA 3PGGA 4M75E 2L5QA 3ZL7C 2RNAA 3CCMA 4FM4B 1QCFA 2DMOA 1WFWA 2OTJA 2COYA 2KDSA 3OYBA 3WVEB 1NM7A 5J39A 2MOXA 4PNOA 2DO3A 1MGQA 2SRCA 3SWNA 3JCMf 2A7YA 3A8OB 1BI1A 1K0SA 4RG8A 1I4K1 2FYKA 4JLGA 2QQAA 3CCEA 4M7DF 4F04B 1YJWQ 2F5KA 1JJ2P 3QXEB 2EQUA 2YUPA 2O31A 2QGGA 1KQ2A 2EVRA 1FMVA 5GMKe 4IKFA 1PNJA 1UEBA 2CP3A 2O9SA 2M51A 1SHFA 3RKXA 1KD1R 3F70A 3L2WA 1TTHB 4NS5A 2DXBA 3EHRA 4LDUA 4JDSA 4F7UB 3JCMQ 3UT1A 2HBWA 3G6EQ 4FT4A 2AZVA 2VC8A 2FL7A 1Q82U 3GLXA 2FZKB 5KYXB 4J7IA 2BUDA 2F2XA 1NYFA 3OYAA 3VS4A 1FWZA 3ZEHA 1OYXA 4LXCA 2DL3A 3SFMA 1TUCA 4N4HA 3OW2A 4DQ2A 2D0QB 1OEBA 3LGFA 4J6XA 1E7OA 1ZA1B 2K2VA 5GAN6 4M77A 4PFOA 4JJDA 1QCOA 2NUZA 3JCMJ 1N8RC 1FMKA 1BYMA 4XTZA 1YITQ 3A8MB 1W1FA 1OI1A 1JO8A 4CC3A 3DLMA 3CCVA 2X3XD 2EKHA 2BZ8A 4IUTA 1VQ9A 3JSCA 1QQJA 1Y71A 4AFUC 1YCSB 1HJDA 3LGLA 1WHLA 3OMGA 2O9VA 1BBZA 3QZ9B 3NPFA 4M78F 1WGSA 4XTWA 1ZX6A 3HP9A 3QUIA 3JB9D 1QWFA 5D6WA 3G1JA 1ZA2B 4EIKA 2F2VA 5GANd 1YJNT 2DD4A 4OMNA 2NUTA 5A0LA 3GF5A 1BIBA 1YBYA 2QTXA 2YDLA 2L8DA 2CDTA 2YUOA 3CMAA 4XU2A 1QVGS 3MEAA 2YRDA 3C95A 2LQ8A 2XICA 4C8QE 1VQPA 2J06A 1IHWA 2JT4A 2FO0A 4C92G 4JZ3A 1PKTA 2K4YA 2C06A 5KCOA 1ZSZC 1B34A 3KBGA 1G8XA 5GAN8 2EGCA 3FC3A 1N9SA 2J6KA 1X6OA 2CUBA 4XK8E 3MKDA 1NLPC 2H8HA 3ME9A 1KQSP 2DXUA 1WI7A 4M75A 3CCJQ 4HVWA 5FRMA 2RI2A 3VJPA 2KRSA 4MMLA 2LNHB 1M9SA 1X43A 2RJEA 2HDAA 2EYXA 2K3BA 4AG2C 2VKNA 2CS7A 2ZGWA 3GPLA 5I2MA 5J3BA 2O2OA 2FPDA 1K76A 5IT9E 5ECAA 3MEWA 1ZSZB 3QO3A 3CD6Q 4C92D 1YHQA 2X4YA 3V8JA 2QDLA 2QG9B 2QQ9A 1QKXA 1QKWA 2LCCA 1K9MR 1OPKA 2DM1A 3G71A 3I56T 4J9IA 2GQIA 3M59A 1EFNA 3M58A 1VOMA 3U23A 5GAMh 1OULA 5LJ5g 3I55Q 5GAOn 4M7DE 2RHUA 4BUGA 1MMGA 3OS5A 2ZPHB 1NG2A 1BB9A 2MMPA 4A4GA 3REBB 5A2QE 1SHGA 3ZBDA 2CP7A 2RPNA 1SEMA 4KGVB 2E4HA 3L42A 5GMKm 1LVKA 3FRNA 1K8AC 3QWYA 4C0FA 2EYWA 2CH4W 2VGNA 1VQNQ 3PMTA 1K0XA 2ZPFB 3M0TA 3M56A 4OMQA 2KXCA 2BZXA 1LNXA 3L1AA 1UGVA 4NOYA 3CC7T 1VQ6T 2DERA 1HD3A 4JJCA 2LDMA 2QQBA 4KT0E 2CUDA 3M9QA 4HVUA 4RTZA 4QVDA 4D6WA 2KY9A 2PNIA 4M7AD 1G3SA 1VQ8Q 2EFIA 1X27A 2G3RA 4XQ3A 2M0OA 2JTEA 3OSVA 3HKSA 4BI8B 3C0CA 5KYYB 4ZGDB 4RUGA 3LH5A 4FYYB 4IUQA 1IHVA 4NL3A 2P4RA 1RADB 1N8RU 3BDLA 4OB2B 4A4FA 1V29B 4EMGA 4RKUE 3H6ZA 4KGXB 4DEXA 1ZHIA 5CKEA 3CCSA 4IURA 1W2BP 2LX7A 1T3SA 4GBQA 1NJIR 1VQLA 1RAIB 4RTTA 2I0NA 1TS9A 4LDYA 3GP8A 2RO0A 4EPCA 4J8OA 2X51A 1VQKA 1GFDA 3M54A 2JM8A 2RB6A 3RKWA 3RMQA 1WXUA 2MAMA 4M78E 2P84A 4N4IA 2ROTA 4FT2A 2R58A 5GMKl 4D8DA 4C8QA 2FEIA 1BK2A 2J7IA 3JCMW 5FLXE 2PVDB 1TH7A 4B9XA 3FJPA 2YLBA 1PCXA 3DLLA 1AZGB 1KC8R 1AD5A 5GANg 3I5SA 2AK5A 2YRVA 5L23A 1IREB 1AWJA 1OPLA 3EFOA 1K73C 4J9DA 2EQKA 2R5AA 1A0NB 1Y96B 1W4SA 1O9SA 4HCBA 2E65A 1G3TA 3BFMA 3OYFA 3CCMQ 1UHCA 1D3BA 2OTJQ 1WHGA 2QEXQ 2K5LA 3CCUT 2RHZA 5GAMj 2XI9A 2LCSA 5LL6S 4OGCA 1M2VA 2EBPA 4FSSA 3RNJA 3CCRT 1VQMA 4X34A 1Q86C 1M1GA 2KT1A 3CCEQ 5GAN7 4MDXA 1VQ5T 1UTIA 2H3EB 2AKKA 1U1SA 4M7DA 2YXYA 3M53A 1I07A 4J83A 1QWEA 2LTOA 2ZCFB 3SWNC 4ZN1A 2DVEA 2FPEA 3NMZC 1LCKA 1SSFA 4OB0B 1QLYA 2K5FA 2DYIA 1YJ9T 3OYGA 4E7JA 1ARKA 3DKMA 1Z9ZA 1UJYA 5KYUB 4FSXA 2LMJA 1ZBXA 4LNPA 2YRCA 4II1A 4E7KA 1KQSS 3UA6A 2DF6A 1S72T 2DZCA 2QA4Q 3M4YA 2K79A 4ZN3A 1YIJT 4HVVA 4PJOF 1JJ2A 2E64A 3CMET 3V7CA 4MZTA 4P5NA 1K8AU 3HRTA 8AT1B 1AWOA 2O4XA 4FW2A 4WF2A 2FVUA 4HT9A 2OAWA 2ESWA 5L8RE 3SWNB 2JS0A 2JVVA 4B9WA 2BE9B 1TU0B 4E7SA 3A8LB 1X6BA 3VRYA 3JCMd 1QVGP 1I5LA 5AYFA 3EGDA 2BKDN 1K9AA 1YI2A 3OYKA 4R55A 4QT7A 3CCVQ 2LJ0A 4XU1A 3CCUA 1VQ9Q 1D1BA 8ATCB 4D8KA 4AFZC 2GQVA 4M77C 3JV3A 1S1NA 4QQ6A 5GAMe 2X9HA 3JB9H 3TSWA 3MPUB 5FROA 4KGZB 4M78A 3VS1A 4LUEA 3RMSA 3MP8A 1VQ7A 2PVGB 2K5IA 4ATOA 4KBMB 2D6FA 1WZOA 1K1ZA 2CZ6B 3CMAQ 1I8FA 2HMAA 2HKQB 4ELYC 2ECZA 1UFFA 2XD0A 1QVFS 2COZA 1PD0A 3H9NA 1YJ9A 1C0MA 1VQPQ 4M77B 1PC0A 4C8QF 4KRTA 1AOJA 1VIEA 1QP3A 1U3OA 4DBQA 5CKFA 3OW2S 4N4GA 2RHXA 3V7SA 2KI7A 1J3TA 4F17A 1Y57A 2LP5A 2E3HA 3EH1A 4FIBA 1PRMC 1K73U 1ABOA 2OTLA 1VQOT 2VXEA 2XDPA 1I0CA 2DYBA 1ABQA 4JLIA 3VKIA 4ME7A 2C0OA 2DL7A 2JNGA 2NUTB 2K6DA 4CC2A 4M75C 2KRNA 1PG5B 1YHQQ 4FW1A 1X2KA 3JCMb 1VQ4T 1JRIA 1H3ZA 4BE0A 1UGRB 4DBFA 1OU8A 3G71Q 4WTOB 4JZ4A 3TEEA 5LJ5h 1BI0A 2GTJA 5LJ5d 3A1PA 2MWPA 4BACA 4E7ZA 1Q86U 3L2QA 2K9GA 2HL3A 1B34B 3VS3A 1KK7A 4L6V5 2RM4A 1WA7A 1Q7YC 1ZLMA 1LOJA 4C5EA 5IHIA 4M75B 4PKCC 2G6FX 2FRWA 1RUWA 4ANJA 4KUDK 3MP6A 2CZ1B 5GAN2 3CXCA 5CQXA 2V1QA 1SRMA 4XTYA 1M30A 2PUKB 3M55A 3CC4T 2ZAEA 4L59A 3G7ZA 3R6NA 1W70A 1WHMA 4PJNA 2WSEE 3LWIA 1I1JA 4V2SA 3QPHA 3OYHA 4PJOE 4RTVA 2FPFA 1N9RA 3OYCA 1JBMA 3EG9A 2JZ2A 3JB9F 4J6WA 4N0AA 2KT8A 3HSBA 2A28A 3JB9G 3X20B 5KYWA 4E7LA 2LZ6B 1CKBA 5CQYA 2DFUA 3CCQT 3A8HB 2V8JA 3QSUA 2KK4A 2J05A 2R5MA 3CCSQ 2EAYA 3UF4A 2COWA 1VQLQ 3VUBA 1UJ0A 1JQQA 3JCMg 2JTFA 4RTUA 3CPWA 1VQKQ 4C5GA 3OS0A 3MHXA 3CBMA 4MZMA 3CC2T 2L3RA 2BE7D 3FLGA 3QZ5B 5GAN5 2RI3A 1GL5A 3CCLT 1G3YA 3G4ST 2MF2A 1GBQA 4AT1B 1X6GA 3VUZA 2ZPGB 5GANh 2P0KA 4HCKA 1M90R 3GOXA 1K4US 3PE0A 1W2BA 4A4KA 4X9CA 4MDWA 3S3MA 1UGSB 2GFUA 4EMKA 2HL5C 3M0UA 2E10A 4C8QC 3EGUA 1EZZB 3R6OA 1YP5A 4OMOA 3VS5A 2E6ZA 2HZYA 2JTMA 4C92F 1BU1A 1PKSA 2DNUA 2RA2A 3FEOA 4FYWB 4ZTFA 3X25B 4JRPA 3VS6A 1YJWT 4R0KA 4E47A 2LJ1A 3KUFA 5KCHA 2L0AA 2EQIA 3QBYA 4Y28E 5FWBA 4Y91A 2QTVA 1JXOA 2X4JA 1WXTA 1G3WA 1UE9A 1VQMQ 4C8QB 2W10A 3J81E 9ATCB 2DX1A 2QAZA 2DL4A 1PD1A 2L3PA 5LJ3h 1KHIA 5LJ3d 1R0BG 3G6ET 3HRUA 4OF1A 2C0IA 3VS2A 5C0MA 4IUUA 2YSQA 3CEYA 4RTWA 2DETA 3WXMB 2E12A 2KBTA 2XIDA 1LPLA 3EGXA 3EFOB 5GAOm 2L2PA 4ZGEB 4IIMA 4C5HA 1WQWA 3A5ZB 2FZCB 1KD1C 3EFRA 3EHQA 4HKEA 3OBYA 4KULA 2CREA 1M1KR 4M7AF 3PFSA 4BE1A 4M7DC 2LRQA 3GBQA 4M7AG 1YJNA 3LLRA 1T0HA 1Q7YU 1YITT 2IG0A 2QYZA 4AMCA 2HEQA 1UG1A 2VVKA 4CI0C 5IH2A 5GAOq 2NUPA 5HCKA 4OMMA 5KE3A 3LW5E 4PJOA 4OGEA 1M2VB 2HCKA 1PSEA 4F14A 4L5GA 1D1CA 3OS2A 4BDZA 3OS1A 2X35A 4HCCA 1RAFB 3RR6A 1D1AA 4Z8AA 1EIFA 2EWNA 2GGRA 3V8KA 2K3XA 1H641 1QVFP 3JAME 5HY6A 1BKBA 1YI2Q 1E6HA 2BZYA 3Q1JA 4M7DB 1KG1A 1JB0E 1CSKA 1OX9A 3CCUQ 4FYXB 2OJ2A 3OW2P 1MNEA 3GNGA 5LJ5e 1YFNA 1U06A 2MIOA 1RABB 2KRMA 2JN0A 3NTHA 5GANj 1W6XA 2RK1A 4J9BA 1H3HA 1SRLA 1ZUYA 2YUQA 1VQ7Q 1V1CA 3QKJA 2AIRB 1T0JA 1QVGA 2PVOB 3AT1B 2DK3A 2VWFA 3I5RA 2O4XB 2JS2A 2HAXA 2RN8A 3UDCA 1IZ6A 1UUEA 1M1FA 1M4ZA 2Z0WA 2ATCB 3MEUA 3CCJT 2ENMA 2H3JA 2LJ3A 4M78C 3I56A 3QHSA 1X69A 1Q81R 3E2UA 1TUGB 2DLPA 2O01E 2YUNA 4X9DA 5FWCA 3ZFJA 3EGDB 2E5KA 1U5SA 2FB7A 3M0SA 2MCNA 3TSZA 1QMCA 3JCMX 4J9GA 3M0PA 3JCMV 5KH6A 1UDLA 2DKGA 3I35A 3CD6T 2B8AA 3SB2A 3M5AA 5GAN4 1BCOA 2OTLQ 2V8IA 1G2BA 5C6SA 1VYUA 4XTVA 2JXBA 2X4XA 4JJBA 3HRSA 2CGHA 4M78B 4RCBA 3V7RA 3CC7A 1VQ6A 4IIOA 4C92E 1WHKA 5I21A 4M77D 1GBRA 2QGFB 2ED0A 5J26A 1MV3A 1JXMA 3CPFA 3H8ZA 2K57A 2DXTA 1RAEB 2KYBA 4ZGJB 3KFVA 3D7SB 1X2QA 3PVQA 2IPOB 3QIIA 3HL8A 4VUBA 1SKUB 1WX6A 5GAMf 3NGPA 1K9MC 1ZUKA 2CSIA 2K7AA 2M16A 3EG1A 3HTRA 3QJYA 1VQNT 1OOTA 4BY6C 4O5VA 5GANe 3O5ZA 4E7HA 1M1KC 1X01A 3MP1A 3HFNA 2VASA 1GXIE 2QXFA 1T3LA 2KROA 1PHTA 4M75G 4GY5A 3I9QA 4LDXA 2JOYA 1AWXA 5LJ3g 1VQ8T 1XNIA 3OB9A 2V8KA 2OX7A 2NYSA 5FU7C 3VRZA 4ORZA 1KSWA 1YN8A 5IXBA 2IIMA 2LT4A 4ESRA 1KD1U 2P0QA 2KGTA 1H92A 2CT3A 4F7UG 4BY6B 4M7AE 2Y4XA 4PLIA 1MV0B 2E3IA 3OYLA 3FIFA 3UWNA 1M8MA 4LN2A 3CD6A 3PMIA 3MJXA 2V1RA 2LC4A 3LYIA 3N5BB 1HYOA 4M75D 2E6NA 2HQXA 3X24B 5FU7B 2HNIA 5I2SA 4RCCA 5LJ3e 1YWOA 3JCMP 2A3LA 2K3YA 2YT6A 2ABLA 2EQMA 3UPUA 5CCAA 1QCNA 2EW3A 3JCMh 2RJDA 5CK9A 1Z9QA 4A53A 5IAYA 1PRLC 2K2MA 4N0AC 2DPPB 3RUXA 2L3QA 3VYGA 4KUIA 2YWWA 4PK4A 1UGPB 1G83A 4HCZA 1NJIC 3E1SA 4PL6A 3E19A 3MCAB 3TVTA 2XK0A 1F1BB 2DTOA 1Q81C 4PJMA 4EMHA 3CCRA 2LQNA 2DBKA 4C0ZA 2LT1A 2HSEB 2DTHA 1WHHA 3CXCS 4LD6A 1I5OB 2XMFA 5EC7A 1VQ5A 2X4WA 2YLCA 4LD9K 1TXQA 3OYEA 1VIFA 3EG9B 4QW2A 3CCMT 5GMKi 2CYZB 4BDYA 4IUVA 2OTJT 1KC8C 5GAOr 4UC4A 2QEXT 1WNLA 2FHDA 1EX4A 2KEAA 3FDRA 1GCPA 1JU5C 1N8RR 5CO7A 1O75A 1TWBA 1XTDA 2A0FB 1OZ3A 3SEMA 2CZ7B 3CCET 4Y92A 2RJFA 2LQWA 1WPYA 2DEUA 1Q95G 1RLPC 1AT1B 4EMKC 4C92A 1S72A 1YIJA 4JRIA 1HSQA 2PQWA 4Z02A 3CMEA 1AZEA 3DB3A 1V76A 2CP0A 3LWHA 1KQ1A 2RD1A 4QQGA 1WHJA 3L2VA 3REAB 5D6XA 3P8DA 2E5QA 3OBWA 2M02A 3AHUA 3HFOA 4AG1C 2EKOA 1H8KA 1SG5A 3UA7A 3VV0A 1Y07A 5GAOp 5DLOA 2QA4T 4EMKB 3L2RA 1D09B 2AHJB 1M3BA 2NLUA 1K9MU 1YCYA 2RHYA 5CR2A 1IRXA 1KQSA 4M4ZA 4A63B 3O8VA 1N6AA 2KVQG 2JW4A 2E41A 5DY9A 1KIKA 1M1KU 4QQDA 4Z89A 4DBHA 1YJNQ 1TOVA 4R56A 2MWOA 3ULRB 1JEGA 2KE9A 1RAHB 4M7AA 4E7IA 5I11A 1OQKA 3CCVT 4JS4A 2KNBB 2QEXA 1AVZC 1VQ9T 3CBOA 1OX8A 4OMFB 1IGUA 4F7UE 3GIBA 4TVRA 2CP2A 5KYNA 4M7DG 3OSSC 3QJ6A 5HKCA 1RACB 2EIFA 3EG3A 1OZ2A 2VGMA 3JCMc 4CC4B 1KJWA 2ZPBB 3FB9A 4PJOC 3EGXB 1BI3A 2QQRA 4PFZA 1D0ZA 2KMTA 3CMAT 1D0YA 2L89A 4XAXB 2VUBA 1GCQA 1NEGA 1VQOA 1RL2A 3A98A 3OQ5A 2J6FA 4JJNK 2KSSA 1SF9A 3M57A 4JPBW 1VQPT 5CAIA 1SPKA 1KFZA 4O6JA 1TUDA 3E9FA 3RIRA 2F69A 2D8JA 3TREA 2DTIA 1QVFA 2GBQA 2DVJA 2QA4A 1P92A 4LDVA 1UECA 4MMKA 1K8AR 2NUPB 1IO6A 3V8LA 4WCIA 1VQ4A 4PJOB 1NJIU 4M7DD 1M3AA 3C12A 3T9NA 2DRMA 1BIAA 3I56Q 2Y4YA 4DA4A 1Q81U 2KQWA 2PU9B 5GAN3 1X75C 2CSQA 1M5Q1 2SEMA 3HHTB 2CZ0B 1WQ7A 1UGQB 2EYQA 3RESA 2R57A 1NBEB 3X28B 1YHQT 2ZPEB 4EDUA 1KC8U 1ACMB 2JUFA 1TG0A 4XTUA 4FL6A 4KH1B 4OB1B 2BTTA 2JM9A 2RJCA 4X1VA 4A4EA 5FW9A 3G71T 5A0GA 4M78G 4GLMA 1NEBA 3CC7Q 1VQ6Q 3JCMe 3CC4A 1B7TA 1NPPA 5I22A 3VYHB 2XHCA 2DRKA 1SSHA 3CQTA 2VB6A 2IVWA 5LJ5f 4J9FA 2KAFA 5FU6C 5LJ5j 1M3CA 3NHNA 2VXFA 1VYVA 4J9HA 2DIQA 5DM7R 3DB4A 1MNDA 3BW1A 3CCQA 3H0IA 2LCLA 4J9EA 2BIVA 2P0PA 4M78D 4HXJA 2DIGA 2DZ9A 2RK2A 4B6MA 5CVIA 5HK0A 2RMOA 3OYJA 2DXCA 1AEYA 3RERA 1BI2A 4FU6A 3VS7A 4DOVA 1K73R 3CC2A 3PNWC 2CH4A 4OMPA 5FU6B 2GTOA 2QQSA 2MPXC 2I2LA 1FX7A 3VS0A 2HQHA 3CCLA 5DLQE 3G4SA 2EGAA 5IXFA 3RDVA 2P4TA 1M2OA 3THKA 1QW1A 4F7UA 2QI2A 4BD3A 1Y0MA 2KXDA 2QK0A 3OYMA 2AZSA 4J5YA 3CCST 2XDDA 5KYXA 3OYYA 1D3BB 3M0QA 2EPDA 2M9UA 1VQLT 3CXCP 2A08A 2C0TA 1M27C 2MI6A 2A37A 3OYNA 1NLOC 2DILA 3SHWA 2RQTA 2HD0A 1UB4A 1VQKT 1WDXA 1RLQC 3INZA 2D9TA 1B07A 6AT1B 1Q86R 2W0ZA 4QVCA 5HK3A 5GAMd 1M8VA 1WLPB 5D6YA 1ZQ1A 2ZZDA 3EFSA 1HXDA 1Y7XA 4JS5A 2E1HA
chains in the Genus database with same CATH topology
1VQLQ 1YITQ 3CXCP 1VQMQ 1VQ7Q 1Q82R 1K9MR 2OTJQ 1YJNQ 1KD1R 2QEXQ 3CCUQ 1Q7YR 2OTLQ 3CPWP 1M90R 3OW2P 1QVGP 3I56Q 2QA4Q 1S72Q 3CC4Q 1VQPQ 1YHQQ 1VQ8Q 1YIJQ 1VQKQ 3CC2Q 1VQNQ 1W2BP 1Q86R 1YJWQ 1JJ2P 3CMEQ 3G6EQ 1VQ4Q 1M1KR 1NJIR 1N8RR 1K73R 1VQOQ 3CCRQ 3CCQQ 3CCVQ 3I55Q 3CCLQ 3G71Q 1KQSP 3CCEQ 3G4SQ 3CCSQ 1VQ9Q 1YJ9Q 1VQ5Q 3CD6Q 3CC7Q 1KC8R 1QVFP 1VQ6Q 3CCJQ 3CCMQ 1YI2Q 3CMAQ 1K8AR 1Q81R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQL Q;  1YIT Q;  3CXC P;  1VQM Q;  1VQ7 Q;  1Q82 R;  1K9M R;  2OTJ Q;  1YJN Q;  1KD1 R;  2QEX Q;  3CCU Q;  1Q7Y R;  2OTL Q;  3CPW P;  1M90 R;  3OW2 P;  1QVG P;  3I56 Q;  2QA4 Q;  1S72 Q;  3CC4 Q;  1VQP Q;  1YHQ Q;  1VQ8 Q;  1YIJ Q;  1VQK Q;  3CC2 Q;  1VQN Q;  1W2B P;  1Q86 R;  1YJW Q;  1JJ2 P;  3CME Q;  3G6E Q;  1VQ4 Q;  1M1K R;  1NJI R;  1N8R R;  1K73 R;  1VQO Q;  3CCR Q;  3CCQ Q;  3CCV Q;  3I55 Q;  3CCL Q;  3G71 Q;  1KQS P;  3CCE Q;  3G4S Q;  3CCS Q;  1VQ9 Q;  1YJ9 Q;  1VQ5 Q;  3CD6 Q;  3CC7 Q;  1KC8 R;  1QVF P;  1VQ6 Q;  3CCJ Q;  3CCM Q;  1YI2 Q;  3CMA Q;  1K8A R;  1Q81 R; 
#chains in the Genus database with same CATH topology
 3TU4 K;  1YJW A;  1PWT A;  1NE8 A;  1N27 A;  1BCM A;  4ZTJ A;  3PIO A;  2WSC E;  1N5Z A;  1WXB A;  2RQW A;  2D0N A;  1R0C B;  4J9C A;  3CCR Q;  2LX9 A;  2F5T X;  2VV5 A;  3JB9 J;  1VYT A;  2DD5 A;  2GCX A;  2EJF A;  5GAN f;  1WJR A;  1E6G A;  1MMN A;  1VQ5 Q;  1VUB A;  3LH0 A;  3PT9 A;  5CKD A;  4CC7 A;  1XJW B;  3G6E A;  1Q82 R;  3BY7 A;  5GAO l;  3CPW P;  2RQU A;  2FG0 A;  1WIE A;  3PIP A;  2CKK A;  3EH2 A;  1M90 C;  3LX7 A;  4RG2 A;  4BI3 A;  4C0D C;  5M9O A;  4M77 F;  1YJ9 Q;  2EJG A;  2CT4 A;  1JJ2 S;  1B3Q A;  1WJQ A;  2V26 A;  4M77 G;  2O88 A;  1MUZ A;  1CKA A;  1YWP A;  1VQM T;  4OVA A;  5IN1 A;  2DJZ A;  1QP2 A;  2LVM A;  1S72 Q;  4GLK A;  2HBP A;  1YIJ Q;  3H0H A;  2HSP A;  1RI9 A;  2WAC A;  2DE0 X;  1XOV A;  3CME Q;  1ZUU A;  4XTX A;  4JUV A;  1WJS A;  4KH0 B;  4JRK A;  1YIT A;  2VYT A;  4OB3 B;  4PLL A;  2GNC A;  5D7U A;  4FCY A;  2RQV A;  4YTL A;  4DEY A;  5KE2 A;  5LJ3 f;  2M0Y A;  2PTK A;  5A0D A;  4C0D B;  2DEQ A;  5LJ3 j;  5CKB A;  2OAU A;  1NZ9 A;  1FYN A;  4C92 C;  3VU3 C;  5AT1 B;  3OA6 A;  2HQE A;  2HKN A;  2LNV A;  3QYG B;  2CP6 A;  4PJL A;  3MEV A;  4RMO A;  2M1H A;  4PJJ A;  2EYZ A;  2X3W D;  5FRN A;  3I55 T;  1NPR A;  4K11 A;  3PTA A;  1G5V A;  3QG1 A;  1HK9 A;  1ZSZ A;  1RAG B;  4FYV B;  1FMW A;  4LE9 A;  4RTY A;  5IHN A;  4ZNX A;  3J80 E;  1C6V X;  4J6Y A;  1GFC A;  5GMK h;  2DL8 A;  1MMA A;  4OP0 A;  1U1T A;  3IQL A;  1WYX A;  3WVD B;  4Z88 A;  2A36 A;  3RBB B;  2Y90 A;  3P8B B;  1PSF A;  4C92 B;  3QWX X;  2JJ9 A;  2DJQ A;  2B86 A;  2OI3 A;  4A54 A;  4M75 F;  1YI2 T;  2DL5 A;  5CKH A;  2E70 A;  1GRI A;  4BI4 A;  1OU9 A;  1R77 A;  1LJO A;  1OV3 A;  3OYI A;  3CCJ A;  1RI0 A;  3MO8 A;  5GJV B;  2KYM A;  4F7U F;  4M7A C;  3M4G A;  3C94 A;  4J7F A;  4DBR A;  3SD4 A;  1KHC A;  5CIU A;  1MMD A;  2FRY A;  1VQ7 T;  3M0R A;  2AKL A;  4BE2 A;  1MHN A;  2MK5 A;  4A4H A;  4C0G A;  4MZP A;  3NTI A;  2RQR A;  3RKY A;  1NYG A;  2YHT A;  4AFS C;  1VQO Q;  2AT1 B;  3S6W A;  1D0X A;  3QYH B;  1I81 A;  3UAT A;  2F1L A;  3S3N A;  3H0F A;  5KYY A;  3TCJ A;  1IGQ A;  3X26 B;  3J7A F;  2LQK A;  5GJW B;  4NL2 A;  1Q7Y R;  2EGE A;  3ER0 A;  4M7A B;  3I55 A;  4IUP A;  1Q82 C;  2F2W A;  3MET A;  5GAM g;  2GF7 A;  4HA8 A;  1GCQ C;  4PJO G;  3URG A;  4QKU A;  2L3S A;  1VQ4 Q;  3BDU A;  7AT1 B;  4JRQ A;  3GNF B;  1ZBJ A;  2EJ9 A;  4C5I A;  1QVP A;  2OTL T;  2ED1 A;  1VQN A;  3BE3 A;  4RTX A;  2MYS A;  3E9G A;  4PFP A;  3TQ7 P;  2J6O A;  2RHI A;  2RH2 A;  2DA9 A;  3EG0 A;  4XU0 A;  2FZG B;  1VA7 A;  4Q5W A;  2XKO C;  3H41 A;  2ROL A;  3EG2 A;  1M90 U;  2PUO B;  3S3O A;  1VQ8 A;  1AWW A;  4DOW A;  4LDW A;  4PJO D;  4M77 E;  5KYW B;  1RAA B;  3C4S A;  1AHJ B;  3CC4 Q;  2RF0 A;  1IB8 A;  2EYY A;  3L2U A;  4F16 A;  4HT8 A;  2XU8 A;  2D1X A;  3CBP A;  1ZSG A;  3OYD A;  1Y96 A;  5GMK j;  2KR3 A;  3L2Z A;  3EAE A;  1C1A A;  3HPW A;  3A8G B;  4LUD A;  2ZPI B;  4XU3 A;  3PVL A;  2DBM A;  2NWM A;  4CRI A;  2D8H A;  1U8R A;  1UHF A;  3JB9 I;  4C8Q G;  3SDZ A;  3CCQ Q;  1R8O B;  3CPW S;  2XDB A;  3JRZ A;  4QVZ A;  3KXT A;  3NFC A;  2DAQ A;  3QDF A;  2WSF E;  2CP5 A;  3NTK A;  3FJ5 A;  3CC2 Q;  2JMA A;  2GFA A;  5EG2 A;  1TSF A;  2RI5 A;  3CCL Q;  2QDY B;  1PM3 A;  2JMC A;  3G4S Q;  3QDR B;  2PZ1 A;  1IXD A;  1W2B S;  4E2F B;  1DJ7 B;  4AFQ C;  2QAS A;  1XQH A;  2XG8 D;  5IHK A;  1YNZ A;  3OMC A;  4E6R A;  3OY9 A;  1FXX A;  4BB7 A;  4C8Q D;  3P8H A;  5KYU A;  3ASK A;  4ELZ C;  2EQJ A;  4OML A;  3PGG A;  4M75 E;  2L5Q A;  3ZL7 C;  2RNA A;  3CCM A;  4FM4 B;  1QCF A;  2DMO A;  1WFW A;  2OTJ A;  2COY A;  2KDS A;  3OYB A;  3WVE B;  1NM7 A;  5J39 A;  2MOX A;  4PNO A;  2DO3 A;  1MGQ A;  2SRC A;  3SWN A;  3JCM f;  2A7Y A;  3A8O B;  1BI1 A;  1K0S A;  4RG8 A;  1I4K 1;  2FYK A;  4JLG A;  2QQA A;  3CCE A;  4M7D F;  4F04 B;  1YJW Q;  2F5K A;  1JJ2 P;  3QXE B;  2EQU A;  2YUP A;  2O31 A;  2QGG A;  1KQ2 A;  2EVR A;  1FMV A;  5GMK e;  4IKF A;  1PNJ A;  1UEB A;  2CP3 A;  2O9S A;  2M51 A;  1SHF A;  3RKX A;  1KD1 R;  3F70 A;  3L2W A;  1TTH B;  4NS5 A;  2DXB A;  3EHR A;  4LDU A;  4JDS A;  4F7U B;  3JCM Q;  3UT1 A;  2HBW A;  3G6E Q;  4FT4 A;  2AZV A;  2VC8 A;  2FL7 A;  1Q82 U;  3GLX A;  2FZK B;  5KYX B;  4J7I A;  2BUD A;  2F2X A;  1NYF A;  3OYA A;  3VS4 A;  1FWZ A;  3ZEH A;  1OYX A;  4LXC A;  2DL3 A;  3SFM A;  1TUC A;  4N4H A;  3OW2 A;  4DQ2 A;  2D0Q B;  1OEB A;  3LGF A;  4J6X A;  1E7O A;  1ZA1 B;  2K2V A;  5GAN 6;  4M77 A;  4PFO A;  4JJD A;  1QCO A;  2NUZ A;  3JCM J;  1N8R C;  1FMK A;  1BYM A;  4XTZ A;  1YIT Q;  3A8M B;  1W1F A;  1OI1 A;  1JO8 A;  4CC3 A;  3DLM A;  3CCV A;  2X3X D;  2EKH A;  2BZ8 A;  4IUT A;  1VQ9 A;  3JSC A;  1QQJ A;  1Y71 A;  4AFU C;  1YCS B;  1HJD A;  3LGL A;  1WHL A;  3OMG A;  2O9V A;  1BBZ A;  3QZ9 B;  3NPF A;  4M78 F;  1WGS A;  4XTW A;  1ZX6 A;  3HP9 A;  3QUI A;  3JB9 D;  1QWF A;  5D6W A;  3G1J A;  1ZA2 B;  4EIK A;  2F2V A;  5GAN d;  1YJN T;  2DD4 A;  4OMN A;  2NUT A;  5A0L A;  3GF5 A;  1BIB A;  1YBY A;  2QTX A;  2YDL A;  2L8D A;  2CDT A;  2YUO A;  3CMA A;  4XU2 A;  1QVG S;  3MEA A;  2YRD A;  3C95 A;  2LQ8 A;  2XIC A;  4C8Q E;  1VQP A;  2J06 A;  1IHW A;  2JT4 A;  2FO0 A;  4C92 G;  4JZ3 A;  1PKT A;  2K4Y A;  2C06 A;  5KCO A;  1ZSZ C;  1B34 A;  3KBG A;  1G8X A;  5GAN 8;  2EGC A;  3FC3 A;  1N9S A;  2J6K A;  1X6O A;  2CUB A;  4XK8 E;  3MKD A;  1NLP C;  2H8H A;  3ME9 A;  1KQS P;  2DXU A;  1WI7 A;  4M75 A;  3CCJ Q;  4HVW A;  5FRM A;  2RI2 A;  3VJP A;  2KRS A;  4MML A;  2LNH B;  1M9S A;  1X43 A;  2RJE A;  2HDA A;  2EYX A;  2K3B A;  4AG2 C;  2VKN A;  2CS7 A;  2ZGW A;  3GPL A;  5I2M A;  5J3B A;  2O2O A;  2FPD A;  1K76 A;  5IT9 E;  5ECA A;  3MEW A;  1ZSZ B;  3QO3 A;  3CD6 Q;  4C92 D;  1YHQ A;  2X4Y A;  3V8J A;  2QDL A;  2QG9 B;  2QQ9 A;  1QKX A;  1QKW A;  2LCC A;  1K9M R;  1OPK A;  2DM1 A;  3G71 A;  3I56 T;  4J9I A;  2GQI A;  3M59 A;  1EFN A;  3M58 A;  1VOM A;  3U23 A;  5GAM h;  1OUL A;  5LJ5 g;  3I55 Q;  5GAO n;  4M7D E;  2RHU A;  4BUG A;  1MMG A;  3OS5 A;  2ZPH B;  1NG2 A;  1BB9 A;  2MMP A;  4A4G A;  3REB B;  5A2Q E;  1SHG A;  3ZBD A;  2CP7 A;  2RPN A;  1SEM A;  4KGV B;  2E4H A;  3L42 A;  5GMK m;  1LVK A;  3FRN A;  1K8A C;  3QWY A;  4C0F A;  2EYW A;  2CH4 W;  2VGN A;  1VQN Q;  3PMT A;  1K0X A;  2ZPF B;  3M0T A;  3M56 A;  4OMQ A;  2KXC A;  2BZX A;  1LNX A;  3L1A A;  1UGV A;  4NOY A;  3CC7 T;  1VQ6 T;  2DER A;  1HD3 A;  4JJC A;  2LDM A;  2QQB A;  4KT0 E;  2CUD A;  3M9Q A;  4HVU A;  4RTZ A;  4QVD A;  4D6W A;  2KY9 A;  2PNI A;  4M7A D;  1G3S A;  1VQ8 Q;  2EFI A;  1X27 A;  2G3R A;  4XQ3 A;  2M0O A;  2JTE A;  3OSV A;  3HKS A;  4BI8 B;  3C0C A;  5KYY B;  4ZGD B;  4RUG A;  3LH5 A;  4FYY B;  4IUQ A;  1IHV A;  4NL3 A;  2P4R A;  1RAD B;  1N8R U;  3BDL A;  4OB2 B;  4A4F A;  1V29 B;  4EMG A;  4RKU E;  3H6Z A;  4KGX B;  4DEX A;  1ZHI A;  5CKE A;  3CCS A;  4IUR A;  1W2B P;  2LX7 A;  1T3S A;  4GBQ A;  1NJI R;  1VQL A;  1RAI B;  4RTT A;  2I0N A;  1TS9 A;  4LDY A;  3GP8 A;  2RO0 A;  4EPC A;  4J8O A;  2X51 A;  1VQK A;  1GFD A;  3M54 A;  2JM8 A;  2RB6 A;  3RKW A;  3RMQ A;  1WXU A;  2MAM A;  4M78 E;  2P84 A;  4N4I A;  2ROT A;  4FT2 A;  2R58 A;  5GMK l;  4D8D A;  4C8Q A;  2FEI A;  1BK2 A;  2J7I A;  3JCM W;  5FLX E;  2PVD B;  1TH7 A;  4B9X A;  3FJP A;  2YLB A;  1PCX A;  3DLL A;  1AZG B;  1KC8 R;  1AD5 A;  5GAN g;  3I5S A;  2AK5 A;  2YRV A;  5L23 A;  1IRE B;  1AWJ A;  1OPL A;  3EFO A;  1K73 C;  4J9D A;  2EQK A;  2R5A A;  1A0N B;  1Y96 B;  1W4S A;  1O9S A;  4HCB A;  2E65 A;  1G3T A;  3BFM A;  3OYF A;  3CCM Q;  1UHC A;  1D3B A;  2OTJ Q;  1WHG A;  2QEX Q;  2K5L A;  3CCU T;  2RHZ A;  5GAM j;  2XI9 A;  2LCS A;  5LL6 S;  4OGC A;  1M2V A;  2EBP A;  4FSS A;  3RNJ A;  3CCR T;  1VQM A;  4X34 A;  1Q86 C;  1M1G A;  2KT1 A;  3CCE Q;  5GAN 7;  4MDX A;  1VQ5 T;  1UTI A;  2H3E B;  2AKK A;  1U1S A;  4M7D A;  2YXY A;  3M53 A;  1I07 A;  4J83 A;  1QWE A;  2LTO A;  2ZCF B;  3SWN C;  4ZN1 A;  2DVE A;  2FPE A;  3NMZ C;  1LCK A;  1SSF A;  4OB0 B;  1QLY A;  2K5F A;  2DYI A;  1YJ9 T;  3OYG A;  4E7J A;  1ARK A;  3DKM A;  1Z9Z A;  1UJY A;  5KYU B;  4FSX A;  2LMJ A;  1ZBX A;  4LNP A;  2YRC A;  4II1 A;  4E7K A;  1KQS S;  3UA6 A;  2DF6 A;  1S72 T;  2DZC A;  2QA4 Q;  3M4Y A;  2K79 A;  4ZN3 A;  1YIJ T;  4HVV A;  4PJO F;  1JJ2 A;  2E64 A;  3CME T;  3V7C A;  4MZT A;  4P5N A;  1K8A U;  3HRT A;  8AT1 B;  1AWO A;  2O4X A;  4FW2 A;  4WF2 A;  2FVU A;  4HT9 A;  2OAW A;  2ESW A;  5L8R E;  3SWN B;  2JS0 A;  2JVV A;  4B9W A;  2BE9 B;  1TU0 B;  4E7S A;  3A8L B;  1X6B A;  3VRY A;  3JCM d;  1QVG P;  1I5L A;  5AYF A;  3EGD A;  2BKD N;  1K9A A;  1YI2 A;  3OYK A;  4R55 A;  4QT7 A;  3CCV Q;  2LJ0 A;  4XU1 A;  3CCU A;  1VQ9 Q;  1D1B A;  8ATC B;  4D8K A;  4AFZ C;  2GQV A;  4M77 C;  3JV3 A;  1S1N A;  4QQ6 A;  5GAM e;  2X9H A;  3JB9 H;  3TSW A;  3MPU B;  5FRO A;  4KGZ B;  4M78 A;  3VS1 A;  4LUE A;  3RMS A;  3MP8 A;  1VQ7 A;  2PVG B;  2K5I A;  4ATO A;  4KBM B;  2D6F A;  1WZO A;  1K1Z A;  2CZ6 B;  3CMA Q;  1I8F A;  2HMA A;  2HKQ B;  4ELY C;  2ECZ A;  1UFF A;  2XD0 A;  1QVF S;  2COZ A;  1PD0 A;  3H9N A;  1YJ9 A;  1C0M A;  1VQP Q;  4M77 B;  1PC0 A;  4C8Q F;  4KRT A;  1AOJ A;  1VIE A;  1QP3 A;  1U3O A;  4DBQ A;  5CKF A;  3OW2 S;  4N4G A;  2RHX A;  3V7S A;  2KI7 A;  1J3T A;  4F17 A;  1Y57 A;  2LP5 A;  2E3H A;  3EH1 A;  4FIB A;  1PRM C;  1K73 U;  1ABO A;  2OTL A;  1VQO T;  2VXE A;  2XDP A;  1I0C A;  2DYB A;  1ABQ A;  4JLI A;  3VKI A;  4ME7 A;  2C0O A;  2DL7 A;  2JNG A;  2NUT B;  2K6D A;  4CC2 A;  4M75 C;  2KRN A;  1PG5 B;  1YHQ Q;  4FW1 A;  1X2K A;  3JCM b;  1VQ4 T;  1JRI A;  1H3Z A;  4BE0 A;  1UGR B;  4DBF A;  1OU8 A;  3G71 Q;  4WTO B;  4JZ4 A;  3TEE A;  5LJ5 h;  1BI0 A;  2GTJ A;  5LJ5 d;  3A1P A;  2MWP A;  4BAC A;  4E7Z A;  1Q86 U;  3L2Q A;  2K9G A;  2HL3 A;  1B34 B;  3VS3 A;  1KK7 A;  4L6V 5;  2RM4 A;  1WA7 A;  1Q7Y C;  1ZLM A;  1LOJ A;  4C5E A;  5IHI A;  4M75 B;  4PKC C;  2G6F X;  2FRW A;  1RUW A;  4ANJ A;  4KUD K;  3MP6 A;  2CZ1 B;  5GAN 2;  3CXC A;  5CQX A;  2V1Q A;  1SRM A;  4XTY A;  1M30 A;  2PUK B;  3M55 A;  3CC4 T;  2ZAE A;  4L59 A;  3G7Z A;  3R6N A;  1W70 A;  1WHM A;  4PJN A;  2WSE E;  3LWI A;  1I1J A;  4V2S A;  3QPH A;  3OYH A;  4PJO E;  4RTV A;  2FPF A;  1N9R A;  3OYC A;  1JBM A;  3EG9 A;  2JZ2 A;  3JB9 F;  4J6W A;  4N0A A;  2KT8 A;  3HSB A;  2A28 A;  3JB9 G;  3X20 B;  5KYW A;  4E7L A;  2LZ6 B;  1CKB A;  5CQY A;  2DFU A;  3CCQ T;  3A8H B;  2V8J A;  3QSU A;  2KK4 A;  2J05 A;  2R5M A;  3CCS Q;  2EAY A;  3UF4 A;  2COW A;  1VQL Q;  3VUB A;  1UJ0 A;  1JQQ A;  3JCM g;  2JTF A;  4RTU A;  3CPW A;  1VQK Q;  4C5G A;  3OS0 A;  3MHX A;  3CBM A;  4MZM A;  3CC2 T;  2L3R A;  2BE7 D;  3FLG A;  3QZ5 B;  5GAN 5;  2RI3 A;  1GL5 A;  3CCL T;  1G3Y A;  3G4S T;  2MF2 A;  1GBQ A;  4AT1 B;  1X6G A;  3VUZ A;  2ZPG B;  5GAN h;  2P0K A;  4HCK A;  1M90 R;  3GOX A;  1K4U S;  3PE0 A;  1W2B A;  4A4K A;  4X9C A;  4MDW A;  3S3M A;  1UGS B;  2GFU A;  4EMK A;  2HL5 C;  3M0U A;  2E10 A;  4C8Q C;  3EGU A;  1EZZ B;  3R6O A;  1YP5 A;  4OMO A;  3VS5 A;  2E6Z A;  2HZY A;  2JTM A;  4C92 F;  1BU1 A;  1PKS A;  2DNU A;  2RA2 A;  3FEO A;  4FYW B;  4ZTF A;  3X25 B;  4JRP A;  3VS6 A;  1YJW T;  4R0K A;  4E47 A;  2LJ1 A;  3KUF A;  5KCH A;  2L0A A;  2EQI A;  3QBY A;  4Y28 E;  5FWB A;  4Y91 A;  2QTV A;  1JXO A;  2X4J A;  1WXT A;  1G3W A;  1UE9 A;  1VQM Q;  4C8Q B;  2W10 A;  3J81 E;  9ATC B;  2DX1 A;  2QAZ A;  2DL4 A;  1PD1 A;  2L3P A;  5LJ3 h;  1KHI A;  5LJ3 d;  1R0B G;  3G6E T;  3HRU A;  4OF1 A;  2C0I A;  3VS2 A;  5C0M A;  4IUU A;  2YSQ A;  3CEY A;  4RTW A;  2DET A;  3WXM B;  2E12 A;  2KBT A;  2XID A;  1LPL A;  3EGX A;  3EFO B;  5GAO m;  2L2P A;  4ZGE B;  4IIM A;  4C5H A;  1WQW A;  3A5Z B;  2FZC B;  1KD1 C;  3EFR A;  3EHQ A;  4HKE A;  3OBY A;  4KUL A;  2CRE A;  1M1K R;  4M7A F;  3PFS A;  4BE1 A;  4M7D C;  2LRQ A;  3GBQ A;  4M7A G;  1YJN A;  3LLR A;  1T0H A;  1Q7Y U;  1YIT T;  2IG0 A;  2QYZ A;  4AMC A;  2HEQ A;  1UG1 A;  2VVK A;  4CI0 C;  5IH2 A;  5GAO q;  2NUP A;  5HCK A;  4OMM A;  5KE3 A;  3LW5 E;  4PJO A;  4OGE A;  1M2V B;  2HCK A;  1PSE A;  4F14 A;  4L5G A;  1D1C A;  3OS2 A;  4BDZ A;  3OS1 A;  2X35 A;  4HCC A;  1RAF B;  3RR6 A;  1D1A A;  4Z8A A;  1EIF A;  2EWN A;  2GGR A;  3V8K A;  2K3X A;  1H64 1;  1QVF P;  3JAM E;  5HY6 A;  1BKB A;  1YI2 Q;  1E6H A;  2BZY A;  3Q1J A;  4M7D B;  1KG1 A;  1JB0 E;  1CSK A;  1OX9 A;  3CCU Q;  4FYX B;  2OJ2 A;  3OW2 P;  1MNE A;  3GNG A;  5LJ5 e;  1YFN A;  1U06 A;  2MIO A;  1RAB B;  2KRM A;  2JN0 A;  3NTH A;  5GAN j;  1W6X A;  2RK1 A;  4J9B A;  1H3H A;  1SRL A;  1ZUY A;  2YUQ A;  1VQ7 Q;  1V1C A;  3QKJ A;  2AIR B;  1T0J A;  1QVG A;  2PVO B;  3AT1 B;  2DK3 A;  2VWF A;  3I5R A;  2O4X B;  2JS2 A;  2HAX A;  2RN8 A;  3UDC A;  1IZ6 A;  1UUE A;  1M1F A;  1M4Z A;  2Z0W A;  2ATC B;  3MEU A;  3CCJ T;  2ENM A;  2H3J A;  2LJ3 A;  4M78 C;  3I56 A;  3QHS A;  1X69 A;  1Q81 R;  3E2U A;  1TUG B;  2DLP A;  2O01 E;  2YUN A;  4X9D A;  5FWC A;  3ZFJ A;  3EGD B;  2E5K A;  1U5S A;  2FB7 A;  3M0S A;  2MCN A;  3TSZ A;  1QMC A;  3JCM X;  4J9G A;  3M0P A;  3JCM V;  5KH6 A;  1UDL A;  2DKG A;  3I35 A;  3CD6 T;  2B8A A;  3SB2 A;  3M5A A;  5GAN 4;  1BCO A;  2OTL Q;  2V8I A;  1G2B A;  5C6S A;  1VYU A;  4XTV A;  2JXB A;  2X4X A;  4JJB A;  3HRS A;  2CGH A;  4M78 B;  4RCB A;  3V7R A;  3CC7 A;  1VQ6 A;  4IIO A;  4C92 E;  1WHK A;  5I21 A;  4M77 D;  1GBR A;  2QGF B;  2ED0 A;  5J26 A;  1MV3 A;  1JXM A;  3CPF A;  3H8Z A;  2K57 A;  2DXT A;  1RAE B;  2KYB A;  4ZGJ B;  3KFV A;  3D7S B;  1X2Q A;  3PVQ A;  2IPO B;  3QII A;  3HL8 A;  4VUB A;  1SKU B;  1WX6 A;  5GAM f;  3NGP A;  1K9M C;  1ZUK A;  2CSI A;  2K7A A;  2M16 A;  3EG1 A;  3HTR A;  3QJY A;  1VQN T;  1OOT A;  4BY6 C;  4O5V A;  5GAN e;  3O5Z A;  4E7H A;  1M1K C;  1X01 A;  3MP1 A;  3HFN A;  2VAS A;  1GXI E;  2QXF A;  1T3L A;  2KRO A;  1PHT A;  4M75 G;  4GY5 A;  3I9Q A;  4LDX A;  2JOY A;  1AWX A;  5LJ3 g;  1VQ8 T;  1XNI A;  3OB9 A;  2V8K A;  2OX7 A;  2NYS A;  5FU7 C;  3VRZ A;  4ORZ A;  1KSW A;  1YN8 A;  5IXB A;  2IIM A;  2LT4 A;  4ESR A;  1KD1 U;  2P0Q A;  2KGT A;  1H92 A;  2CT3 A;  4F7U G;  4BY6 B;  4M7A E;  2Y4X A;  4PLI A;  1MV0 B;  2E3I A;  3OYL A;  3FIF A;  3UWN A;  1M8M A;  4LN2 A;  3CD6 A;  3PMI A;  3MJX A;  2V1R A;  2LC4 A;  3LYI A;  3N5B B;  1HYO A;  4M75 D;  2E6N A;  2HQX A;  3X24 B;  5FU7 B;  2HNI A;  5I2S A;  4RCC A;  5LJ3 e;  1YWO A;  3JCM P;  2A3L A;  2K3Y A;  2YT6 A;  2ABL A;  2EQM A;  3UPU A;  5CCA A;  1QCN A;  2EW3 A;  3JCM h;  2RJD A;  5CK9 A;  1Z9Q A;  4A53 A;  5IAY A;  1PRL C;  2K2M A;  4N0A C;  2DPP B;  3RUX A;  2L3Q A;  3VYG A;  4KUI A;  2YWW A;  4PK4 A;  1UGP B;  1G83 A;  4HCZ A;  1NJI C;  3E1S A;  4PL6 A;  3E19 A;  3MCA B;  3TVT A;  2XK0 A;  1F1B B;  2DTO A;  1Q81 C;  4PJM A;  4EMH A;  3CCR A;  2LQN A;  2DBK A;  4C0Z A;  2LT1 A;  2HSE B;  2DTH A;  1WHH A;  3CXC S;  4LD6 A;  1I5O B;  2XMF A;  5EC7 A;  1VQ5 A;  2X4W A;  2YLC A;  4LD9 K;  1TXQ A;  3OYE A;  1VIF A;  3EG9 B;  4QW2 A;  3CCM T;  5GMK i;  2CYZ B;  4BDY A;  4IUV A;  2OTJ T;  1KC8 C;  5GAO r;  4UC4 A;  2QEX T;  1WNL A;  2FHD A;  1EX4 A;  2KEA A;  3FDR A;  1GCP A;  1JU5 C;  1N8R R;  5CO7 A;  1O75 A;  1TWB A;  1XTD A;  2A0F B;  1OZ3 A;  3SEM A;  2CZ7 B;  3CCE T;  4Y92 A;  2RJF A;  2LQW A;  1WPY A;  2DEU A;  1Q95 G;  1RLP C;  1AT1 B;  4EMK C;  4C92 A;  1S72 A;  1YIJ A;  4JRI A;  1HSQ A;  2PQW A;  4Z02 A;  3CME A;  1AZE A;  3DB3 A;  1V76 A;  2CP0 A;  3LWH A;  1KQ1 A;  2RD1 A;  4QQG A;  1WHJ A;  3L2V A;  3REA B;  5D6X A;  3P8D A;  2E5Q A;  3OBW A;  2M02 A;  3AHU A;  3HFO A;  4AG1 C;  2EKO A;  1H8K A;  1SG5 A;  3UA7 A;  3VV0 A;  1Y07 A;  5GAO p;  5DLO A;  2QA4 T;  4EMK B;  3L2R A;  1D09 B;  2AHJ B;  1M3B A;  2NLU A;  1K9M U;  1YCY A;  2RHY A;  5CR2 A;  1IRX A;  1KQS A;  4M4Z A;  4A63 B;  3O8V A;  1N6A A;  2KVQ G;  2JW4 A;  2E41 A;  5DY9 A;  1KIK A;  1M1K U;  4QQD A;  4Z89 A;  4DBH A;  1YJN Q;  1TOV A;  4R56 A;  2MWO A;  3ULR B;  1JEG A;  2KE9 A;  1RAH B;  4M7A A;  4E7I A;  5I11 A;  1OQK A;  3CCV T;  4JS4 A;  2KNB B;  2QEX A;  1AVZ C;  1VQ9 T;  3CBO A;  1OX8 A;  4OMF B;  1IGU A;  4F7U E;  3GIB A;  4TVR A;  2CP2 A;  5KYN A;  4M7D G;  3OSS C;  3QJ6 A;  5HKC A;  1RAC B;  2EIF A;  3EG3 A;  1OZ2 A;  2VGM A;  3JCM c;  4CC4 B;  1KJW A;  2ZPB B;  3FB9 A;  4PJO C;  3EGX B;  1BI3 A;  2QQR A;  4PFZ A;  1D0Z A;  2KMT A;  3CMA T;  1D0Y A;  2L89 A;  4XAX B;  2VUB A;  1GCQ A;  1NEG A;  1VQO A;  1RL2 A;  3A98 A;  3OQ5 A;  2J6F A;  4JJN K;  2KSS A;  1SF9 A;  3M57 A;  4JPB W;  1VQP T;  5CAI A;  1SPK A;  1KFZ A;  4O6J A;  1TUD A;  3E9F A;  3RIR A;  2F69 A;  2D8J A;  3TRE A;  2DTI A;  1QVF A;  2GBQ A;  2DVJ A;  2QA4 A;  1P92 A;  4LDV A;  1UEC A;  4MMK A;  1K8A R;  2NUP B;  1IO6 A;  3V8L A;  4WCI A;  1VQ4 A;  4PJO B;  1NJI U;  4M7D D;  1M3A A;  3C12 A;  3T9N A;  2DRM A;  1BIA A;  3I56 Q;  2Y4Y A;  4DA4 A;  1Q81 U;  2KQW A;  2PU9 B;  5GAN 3;  1X75 C;  2CSQ A;  1M5Q 1;  2SEM A;  3HHT B;  2CZ0 B;  1WQ7 A;  1UGQ B;  2EYQ A;  3RES A;  2R57 A;  1NBE B;  3X28 B;  1YHQ T;  2ZPE B;  4EDU A;  1KC8 U;  1ACM B;  2JUF A;  1TG0 A;  4XTU A;  4FL6 A;  4KH1 B;  4OB1 B;  2BTT A;  2JM9 A;  2RJC A;  4X1V A;  4A4E A;  5FW9 A;  3G71 T;  5A0G A;  4M78 G;  4GLM A;  1NEB A;  3CC7 Q;  1VQ6 Q;  3JCM e;  3CC4 A;  1B7T A;  1NPP A;  5I22 A;  3VYH B;  2XHC A;  2DRK A;  1SSH A;  3CQT A;  2VB6 A;  2IVW A;  5LJ5 f;  4J9F A;  2KAF A;  5FU6 C;  5LJ5 j;  1M3C A;  3NHN A;  2VXF A;  1VYV A;  4J9H A;  2DIQ A;  5DM7 R;  3DB4 A;  1MND A;  3BW1 A;  3CCQ A;  3H0I A;  2LCL A;  4J9E A;  2BIV A;  2P0P A;  4M78 D;  4HXJ A;  2DIG A;  2DZ9 A;  2RK2 A;  4B6M A;  5CVI A;  5HK0 A;  2RMO A;  3OYJ A;  2DXC A;  1AEY A;  3RER A;  1BI2 A;  4FU6 A;  3VS7 A;  4DOV A;  1K73 R;  3CC2 A;  3PNW C;  2CH4 A;  4OMP A;  5FU6 B;  2GTO A;  2QQS A;  2MPX C;  2I2L A;  1FX7 A;  3VS0 A;  2HQH A;  3CCL A;  5DLQ E;  3G4S A;  2EGA A;  5IXF A;  3RDV A;  2P4T A;  1M2O A;  3THK A;  1QW1 A;  4F7U A;  2QI2 A;  4BD3 A;  1Y0M A;  2KXD A;  2QK0 A;  3OYM A;  2AZS A;  4J5Y A;  3CCS T;  2XDD A;  5KYX A;  3OYY A;  1D3B B;  3M0Q A;  2EPD A;  2M9U A;  1VQL T;  3CXC P;  2A08 A;  2C0T A;  1M27 C;  2MI6 A;  2A37 A;  3OYN A;  1NLO C;  2DIL A;  3SHW A;  2RQT A;  2HD0 A;  1UB4 A;  1VQK T;  1WDX A;  1RLQ C;  3INZ A;  2D9T A;  1B07 A;  6AT1 B;  1Q86 R;  2W0Z A;  4QVC A;  5HK3 A;  5GAM d;  1M8V A;  1WLP B;  5D6Y A;  1ZQ1 A;  2ZZD A;  3EFS A;  1HXD A;  1Y7X A;  4JS5 A;  2E1H A; 
#chains in the Genus database with same CATH homology
 1VQL Q;  1YIT Q;  3CXC P;  1VQM Q;  1VQ7 Q;  1Q82 R;  1K9M R;  2OTJ Q;  1YJN Q;  1KD1 R;  2QEX Q;  3CCU Q;  1Q7Y R;  2OTL Q;  3CPW P;  1M90 R;  3OW2 P;  1QVG P;  3I56 Q;  2QA4 Q;  1S72 Q;  3CC4 Q;  1VQP Q;  1YHQ Q;  1VQ8 Q;  1YIJ Q;  1VQK Q;  3CC2 Q;  1VQN Q;  1W2B P;  1Q86 R;  1YJW Q;  1JJ2 P;  3CME Q;  3G6E Q;  1VQ4 Q;  1M1K R;  1NJI R;  1N8R R;  1K73 R;  1VQO Q;  3CCR Q;  3CCQ Q;  3CCV Q;  3I55 Q;  3CCL Q;  3G71 Q;  1KQS P;  3CCE Q;  3G4S Q;  3CCS Q;  1VQ9 Q;  1YJ9 Q;  1VQ5 Q;  3CD6 Q;  3CC7 Q;  1KC8 R;  1QVF P;  1VQ6 Q;  3CCJ Q;  3CCM Q;  1YI2 Q;  3CMA Q;  1K8A R;  1Q81 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...