3CCLF

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535c. density for anisomycin is visible but not included in model.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 34
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3cclF00
1VQ5F 3CPQA 2OTJF 5A2QM 3LWRC 2OHWA 1VQKF 3CC7F 3N4ZA 3J80M 3CCSF 3VMFB 1QVGF 1M90H 2KTVA 2OTLF 1M1KH 3G6EF 1JJ2F 1YIJF 5G4VC 3MCAB 5FLXM 3PLAC 3SIUA 5GAPK 2VGMA 1CK2A 5GINC 3SIVA 1E7KA 1YITF 2WALA 3AGKA 4NUTA 3CC4F 3VI6A 1X7OA 4X3LA 3E20B 1Q86H 1YJWF 3JAMM 1VQNF 1W3EX 3I55F 3NVKE 1KD1H 3CCQF 4X3MA 3WXMB 3G71F 4TZZA 3CCMF 1GZ0A 1W41A 3CMEF 3NK7A 1VQ6F 1W2BF 3IR9A 3LWVC 1QVFF 2KG4A 3NVIB 5GANK 1VQ4F 3V7EA 1Q82H 1K9MH 3ON1A 1Q81H 5EO3A 3CG6A 1NJIH 3GYQA 1SDSA 1VQPF 2KTUA 3CPWF 2ALEA 1W42A 1X7PA 1N8RH 3I56F 1VQLF 1RA4A 1CN7A 1NMUB 4C4WC 2QI2A 2AIFA 3CCUF 1IPAA 2LBXA 3LFOA 1KQSF 1XBIA 3OW2F 5IT9M 1VQ9F 1VQ7F 1H7MA 1YHQF 4BY9D 2HVYD 1YJNF 1W40A 1X52A 3V7QA 2FC3A 2OZBA 2QA4F 5GIPC 3LWPC 3CXCF 3JCMM 1VQMF 1VQOF 3CCRF 1T0KB 3NK6A 3E1YA 1ZWZA 1Q7YH 2CZWA 3OBYA 2I6DA 3PAFA 1S72F 3CD6F 3J7AR 3OBWA 1K73H 3CCJF 1K8AH 3CC2F 2VGNA 1YJ9F 3LWOC 3HAXD 3CCEF 3NMUC 5FJ4C 4BW0B 2JNBA 3G4SF 3N4YA 3O85A 5GIOC 1GO0A 1PXWA 3FFMA 3CMAF 3CCLF 1YI2F 5DCVA 3J81M 1RLGA 2QEXF 1DT9A 5EWRA 3RA5A 1KC8H 2LBWA 4LCKA 5G4UC 3CCVF 2BO1A 3HJWC 1VQ8F 3LWQC 1GO1A 3RA6A
chains in the Genus database with same CATH superfamily
3U0OA 5JQGA 5EAZA 3HKDA 3QTYA 3RE3A 4G88A 3CPQA 2UYJA 3LWRC 1KNKA 4ERHA 3RYIB 3CCSF 3VMFB 4I55A 5AVMA 1M90H 4O2BA 5IJ9B 3VOBA 3WGKA 1JJ2F 1QU9A 2VAPA 4TV8A 4BT7A 5FLXM 4ZOLB 3SIUA 3QHDA 2CWJA 3BYQA 5HY4A 5HY2A 3TD5A 1YITF 1TVKB 4B62A 3VYTC 3E20B 2F9ZC 1YJWF 1Q8RA 1Q86H 1VQNF 2W8BC 2P6YA 3FPIA 1KD1H 2Z1TA 3CCQF 4G4XA 3DC2A 5CB4A 3LWVC 3UT5A 4EB6A 4LNUB 5J2TA 3JATB 1VQ4F 1JN1A 3V7EA 5HXUA 1Z5WA 3DDNA 1NJIH 2KTUA 2UZHA 3HKEB 5JH7B 5HXZA 4BT4A 3N2GA 3HWUA 3C9UA 2CHSA 2FGYA 3C9TA 1SA0B 2ZVZA 4O4IA 2Z01A 4YJ3B 3LYBA 2B33A 1NMUB 2QTPA 1TUBA 4C8IA 2AIFA 3CCUF 3ZP7A 1X25A 4O4LB 3LMEA 4I50B 3WGLA 3OW2F 3MBMA 2RHOA 3F0GA 2HVYD 2BTUA 2UYNB 1Z5VA 4B46A 3S06A 1VQOF 3HKBA 1VQMF 3D01A 3NK6A 4HNAA 3E1YA 3WPWA 1ZWZA 5FNVA 4BT2A 4EI7A 1VK3A 2I6DA 1S72F 3I7TA 3CD6F 3J7AR 3KJKA 4X20B 5EZYB 2EWCA 5LXTA 2HRYA 1W57A 3NMUC 3CCEF 5FJ4C 4YJ2A 2JNBA 4O4HB 1NQ3A 4F6RA 3KHNA 3JAKB 1RQ7A 3N4YA 1DBFA 3FFMA 1T0AA 5JCOA 4R40B 3E22B 2YXZA 2GLZA 4LCKA 5G4UC 2LBWA 2PHNA 2ZVYA 2BO1A 1JY8A 1FFXB 3RA6A 5GONA 4XCQA 4IHJA 3R0PA 3D00A 3K14A 5CA0B 5CA1B 3C8LA 2CW4A 4DRXA 5EB0A 5EYPA 4BVTA 3N4ZA 4O2AB 4IIJB 3RYHA 1M1KH 3GTZA 2DYYA 3RYCB 2G9IA 5G4VC 3MCAB 1W5AA 3RYFA 3HKCA 5GAPK 2VGMA 5GINC 4X1YB 3WJQA 4ZI7A 1XRGA 3VI6A 4TUYA 2ZODA 3D54A 3IEWA 3NVKE 2CVLA 1H48A 4X3MA 2HX0A 2IG8A 1QAHA 4U39A 3G71F 3B6NA 3F0EA 3CCMF 2HS3A 1QVFF 4X1IA 4I4TA 2CSLA 5EIBC 5HP7A 3WGNA 5MN5A 1JFFA 1Q81H 2HP0B 4G4VA 5KMGB 2ALEA 2IQQA 3I56F 4PWTA 1RA4A 3N2KA 1U43A 2HP3A 5LOVA 5JVDB 3F6MA 5C8YA 1XV2A 5HP8A 3LFOA 1YGYA 3JASB 5IJ0A 2BTQB 3JAWA 3M84A 3JARB 4B45A 4BY9D 3HTNA 1RQ2A 4FFBB 5LP6B 5HY0A 5LYJB 5EIBD 1W55A 2OZBA 3ZO8A 3IKEA 5GIPC 3CXCF 2VAWA 5LP6C 4O4JA 1Q7YH 2CZWA 4BVQA 3PAFA 2LCAA 4U3JA 5JQGB 3OBWA 1K73H 3JALA 3CCJF 1H47A 1W5BA 1YJ9F 3HAXD 4ZHQB 2UYPA 3F0FA 1GX1A 3LDTA 4I55B 3G4SF 3O85A 4O2BB 3S02A 3E22A 2H6LA 3VYUC 3WPXA 1IV2A 4TV8B 3J81M 4WBNA 3ZP4A 5BMVA 1PF5A 5EWRA 1KC8H 4E6EA 5KX5A 3CCVF 1FFXA 3HJWC 2DT4A 2H8CA 4TV9A 4BT3A 1KNJA 1YQNA 1VQ5F 1U40A 3K2XA 3FD6A 1FNJA 1R1MA 3KJJA 3FD5A 4IIJA 4X1KA 3KE1A 5CB4B 2KTVA 3UT5B 4EB6B 2OTLF 3MQWA 5LA6A 4EI8A 5ITZB 3PLAC 3VYSC 1CK2A 1VHAA 2N48A 3MCQA 1UFYA 3SIVA 5J2UB 2WALA 4NUTA 3CC4F 3N2GB 1X7OA 2ZF8A 3JAMM 1W3EX 3I55F 4O4IB 1ODEA 2KGWA 4M8IA 1U3PA 1TUBB 3RYIA 3M4SA 3CYPB 1GZ0A 3I3FA 1W2BF 5IJ9A 2KG4A 4DXDA 3CYQA 3VTIC 1FSZA 4G4WA 3WGMA 3VO8A 4C81A 3ON1A 4ZOLA 1K9MH 1SDSA 2NMUA 3TD4A 2V9YA 4G4ZA 1TVKA 3CPWF 5MN4A 1X7PA 3F0DA 2GVIA 3HKBB 3IMPA 1N8RH 1VQLF 1CN7A 5EB1B 3FBAA 4HNAB 5IYZB 3ELCA 5LXTB 1IPAA 2LBXA 3M1XA 4LNUA 3JATA 4YJ2B 3V3TA 1FNKA 1XBIA 4F6RB 1VQ9F 3C9RA 5IT9M 2CHTA 3Q8HA 4FFBA 2IAFA 1U3LA 1W40A 3V7QA 4EI9A 3HKEA 3WGJA 2FC3A 3P0ZA 2Q1XA 3V4DA 4BT5A 5JH7A 2QA4F 3P10A 4ZHWA 3CCRF 3MDOA 1SA0A 1OAPA 5JCOC 5HY1A 2OTMA 3OBYA 4YJ3A 5GONB 3VCZA 4IHJB 2RHLA 4ZHQA 1SZQA 3CC2F 4DRXB 4NQ3A 4BW0B 2RB9A 4O4LA 4I50A 5EYPB 2BTOA 1IV3A 3P4EA 3EORA 4NWOB 3RYHB 5GIOC 2AIZP 3CCLF 4B5CA 1YI2F 1VQVA 2UYNA 1RLGA 3VIUA 2QEXF 1DT9A 3RYFB 3HKCB 3VOAA 4ZI7B 2HS0A 1VQ8F 3ESJA 4TUYB 1CLIA 4X20A 1UI9A 5EZYA 2OTJF 5A2QM 2K1SA 3HKDB 1ONIA 2YYEA 2OHWA 1VQKF 3QUWA 4O4HA 2Z1FA 3CC7F 1J7HA 4KWEA 3J80M 1QVGF 3JAKA 4BVRA 4C82A 4X1IB 3GHZA 4I4TB 1RLUA 3G6EF 5ITZA 1YIJF 2HRUA 2AMTA 1W5FA 2VXYA 2ZOVA 1JFFB 5J2UA 2VAMA 4ZK7A 1E7KA 2ZAUA 3AGKA 4BT6A 4RHAA 4X3LA 2LBTA 4ZHYB 3N2KB 3IKFA 5LOVB 3WXMB 1VH8A 5CA0A 5CA1A 4TZZA 4O2AA 5C8YB 1W41A 3CMEF 3NK7A 1VQ6F 3IR9A 2Z1UA 3NVIB 3RYCA 5GANK 5HWEA 5IJ0B 5J2TB 3JAWB 1Q82H 3TD3A 1JD1A 3S0HA 5EO3A 3CG6A 4X1YA 3GYQA 1VQPF 3T80A 2HQSC 3KIZA 1W42A 4BVSA 3ZOPA 2Q1YA 1IV4A 5IYZA 3S03A 4O4JB 1W59A 4U3JB 1QD9A 4C4WC 4RQOA 2H8EA 2QI2A 3JALB 3IEQA 1COMA 2GZLA 1OFUA 1KQSF 1VQ7F 1H7MA 2L26A 1YHQF 1YJNF 2RHHA 2UYKA 3C9SA 2HP0A 1X52A 3WJPA 4WBNB 2PMPA 5BMVB 3S0YA 3ERNA 3K12A 5KMGA 2I6RA 5KX5B 3LWPC 3JCMM 1T0KB 2MQEA 3JVHA 4G4YA 5JVDA 4TV9B 5FNVB 2HS4A 3L7QA 1XHOA 1K8AH 2VGNA 3LWOC 3JASA 4X1KB 3S0WA 5B8FA 3JARA 4C8EA 1GO0A 1PXWA 3OONA 2R751 3CMAF 5DCVA 2RHJA 5LP6A 5LA6B 5LYJA 3CB2A 2Z1EA 3RA5A 1IV1A 1W5EA 2R6R1 5MN6A 4ZHVA 4C8GA 3LWQC 1GO1A 3K0TA 3WJRA 1W581
chains in the Genus database with same CATH topology
4XCQA 1VQ5F 3CPQA 3D00A 2OTJF 5A2QM 3LWRC 2OHWA 1VQKF 4BVTA 3CC7F 3N4ZA 3J80M 3CCSF 3VMFB 1QVGF 1M90H 4BVRA 2KTVA 2OTLF 1M1KH 3G6EF 1JJ2F 1YIJF 5G4VC 4EI8A 3MCAB 5FLXM 3PLAC 3SIUA 5GAPK 2VGMA 1CK2A 5GINC 5HY4A 3SIVA 1E7KA 5HY2A 1YITF 2WALA 3AGKA 4NUTA 3CC4F 3VI6A 1X7OA 4X3LA 3E20B 2F9ZC 1YJWF 3JAMM 1Q86H 1VQNF 1W3EX 3I55F 3NVKE 1KD1H 3CCQF 4X3MA 3WXMB 3G71F 4TZZA 3CCMF 1GZ0A 1W41A 3CMEF 3NK7A 1VQ6F 1W2BF 3IR9A 3LWVC 1QVFF 2KG4A 3NVIB 5GANK 1VQ4F 5HWEA 3V7EA 5HXUA 1Q82H 1K9MH 3ON1A 1Q81H 5EO3A 3CG6A 1NJIH 3GYQA 1SDSA 1VQPF 2KTUA 3CPWF 2ALEA 1W42A 5HXZA 1X7PA 4BVSA 1N8RH 3I56F 1VQLF 1RA4A 1CN7A 2FGYA 1NMUB 4C4WC 2QI2A 2AIFA 3CCUF 1IPAA 2LBXA 3LFOA 3V3TA 1KQSF 1XBIA 3OW2F 5IT9M 1VQ9F 1VQ7F 1H7MA 1YHQF 4BY9D 2HVYD 1YJNF 1W40A 1X52A 5HY0A 3V7QA 4EI9A 2FC3A 2OZBA 2QA4F 5GIPC 3LWPC 3CXCF 3JCMM 1VQMF 1VQOF 3CCRF 1T0KB 3NK6A 3E1YA 1ZWZA 5HY1A 1Q7YH 2CZWA 3OBYA 4BVQA 4EI7A 2I6DA 3PAFA 1S72F 3CD6F 3J7AR 3OBWA 1K73H 3CCJF 1K8AH 3CC2F 2VGNA 1YJ9F 3LWOC 3HAXD 3CCEF 3NMUC 4NQ3A 4BW0B 5FJ4C 2JNBA 3G4SF 3N4YA 3O85A 5GIOC 1GO0A 1PXWA 3FFMA 3CMAF 3CCLF 1YI2F 5DCVA 3J81M 1RLGA 2GLZA 2QEXF 1DT9A 5EWRA 3RA5A 1KC8H 2LBWA 4LCKA 5G4UC 3CCVF 2BO1A 3HJWC 1VQ8F 3LWQC 1GO1A 3RA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ5 F;  3CPQ A;  2OTJ F;  5A2Q M;  3LWR C;  2OHW A;  1VQK F;  3CC7 F;  3N4Z A;  3J80 M;  3CCS F;  3VMF B;  1QVG F;  1M90 H;  2KTV A;  2OTL F;  1M1K H;  3G6E F;  1JJ2 F;  1YIJ F;  5G4V C;  3MCA B;  5FLX M;  3PLA C;  3SIU A;  5GAP K;  2VGM A;  1CK2 A;  5GIN C;  3SIV A;  1E7K A;  1YIT F;  2WAL A;  3AGK A;  4NUT A;  3CC4 F;  3VI6 A;  1X7O A;  4X3L A;  3E20 B;  1Q86 H;  1YJW F;  3JAM M;  1VQN F;  1W3E X;  3I55 F;  3NVK E;  1KD1 H;  3CCQ F;  4X3M A;  3WXM B;  3G71 F;  4TZZ A;  3CCM F;  1GZ0 A;  1W41 A;  3CME F;  3NK7 A;  1VQ6 F;  1W2B F;  3IR9 A;  3LWV C;  1QVF F;  2KG4 A;  3NVI B;  5GAN K;  1VQ4 F;  3V7E A;  1Q82 H;  1K9M H;  3ON1 A;  1Q81 H;  5EO3 A;  3CG6 A;  1NJI H;  3GYQ A;  1SDS A;  1VQP F;  2KTU A;  3CPW F;  2ALE A;  1W42 A;  1X7P A;  1N8R H;  3I56 F;  1VQL F;  1RA4 A;  1CN7 A;  1NMU B;  4C4W C;  2QI2 A;  2AIF A;  3CCU F;  1IPA A;  2LBX A;  3LFO A;  1KQS F;  1XBI A;  3OW2 F;  5IT9 M;  1VQ9 F;  1VQ7 F;  1H7M A;  1YHQ F;  4BY9 D;  2HVY D;  1YJN F;  1W40 A;  1X52 A;  3V7Q A;  2FC3 A;  2OZB A;  2QA4 F;  5GIP C;  3LWP C;  3CXC F;  3JCM M;  1VQM F;  1VQO F;  3CCR F;  1T0K B;  3NK6 A;  3E1Y A;  1ZWZ A;  1Q7Y H;  2CZW A;  3OBY A;  2I6D A;  3PAF A;  1S72 F;  3CD6 F;  3J7A R;  3OBW A;  1K73 H;  3CCJ F;  1K8A H;  3CC2 F;  2VGN A;  1YJ9 F;  3LWO C;  3HAX D;  3CCE F;  3NMU C;  5FJ4 C;  4BW0 B;  2JNB A;  3G4S F;  3N4Y A;  3O85 A;  5GIO C;  1GO0 A;  1PXW A;  3FFM A;  3CMA F;  3CCL F;  1YI2 F;  5DCV A;  3J81 M;  1RLG A;  2QEX F;  1DT9 A;  5EWR A;  3RA5 A;  1KC8 H;  2LBW A;  4LCK A;  5G4U C;  3CCV F;  2BO1 A;  3HJW C;  1VQ8 F;  3LWQ C;  1GO1 A;  3RA6 A; 
#chains in the Genus database with same CATH topology
 3U0O A;  5JQG A;  5EAZ A;  3HKD A;  3QTY A;  3RE3 A;  4G88 A;  3CPQ A;  2UYJ A;  3LWR C;  1KNK A;  4ERH A;  3RYI B;  3CCS F;  3VMF B;  4I55 A;  5AVM A;  1M90 H;  4O2B A;  5IJ9 B;  3VOB A;  3WGK A;  1JJ2 F;  1QU9 A;  2VAP A;  4TV8 A;  4BT7 A;  5FLX M;  4ZOL B;  3SIU A;  3QHD A;  2CWJ A;  3BYQ A;  5HY4 A;  5HY2 A;  3TD5 A;  1YIT F;  1TVK B;  4B62 A;  3VYT C;  3E20 B;  2F9Z C;  1YJW F;  1Q8R A;  1Q86 H;  1VQN F;  2W8B C;  2P6Y A;  3FPI A;  1KD1 H;  2Z1T A;  3CCQ F;  4G4X A;  3DC2 A;  5CB4 A;  3LWV C;  3UT5 A;  4EB6 A;  4LNU B;  5J2T A;  3JAT B;  1VQ4 F;  1JN1 A;  3V7E A;  5HXU A;  1Z5W A;  3DDN A;  1NJI H;  2KTU A;  2UZH A;  3HKE B;  5JH7 B;  5HXZ A;  4BT4 A;  3N2G A;  3HWU A;  3C9U A;  2CHS A;  2FGY A;  3C9T A;  1SA0 B;  2ZVZ A;  4O4I A;  2Z01 A;  4YJ3 B;  3LYB A;  2B33 A;  1NMU B;  2QTP A;  1TUB A;  4C8I A;  2AIF A;  3CCU F;  3ZP7 A;  1X25 A;  4O4L B;  3LME A;  4I50 B;  3WGL A;  3OW2 F;  3MBM A;  2RHO A;  3F0G A;  2HVY D;  2BTU A;  2UYN B;  1Z5V A;  4B46 A;  3S06 A;  1VQO F;  3HKB A;  1VQM F;  3D01 A;  3NK6 A;  4HNA A;  3E1Y A;  3WPW A;  1ZWZ A;  5FNV A;  4BT2 A;  4EI7 A;  1VK3 A;  2I6D A;  1S72 F;  3I7T A;  3CD6 F;  3J7A R;  3KJK A;  4X20 B;  5EZY B;  2EWC A;  5LXT A;  2HRY A;  1W57 A;  3NMU C;  3CCE F;  5FJ4 C;  4YJ2 A;  2JNB A;  4O4H B;  1NQ3 A;  4F6R A;  3KHN A;  3JAK B;  1RQ7 A;  3N4Y A;  1DBF A;  3FFM A;  1T0A A;  5JCO A;  4R40 B;  3E22 B;  2YXZ A;  2GLZ A;  4LCK A;  5G4U C;  2LBW A;  2PHN A;  2ZVY A;  2BO1 A;  1JY8 A;  1FFX B;  3RA6 A;  5GON A;  4XCQ A;  4IHJ A;  3R0P A;  3D00 A;  3K14 A;  5CA0 B;  5CA1 B;  3C8L A;  2CW4 A;  4DRX A;  5EB0 A;  5EYP A;  4BVT A;  3N4Z A;  4O2A B;  4IIJ B;  3RYH A;  1M1K H;  3GTZ A;  2DYY A;  3RYC B;  2G9I A;  5G4V C;  3MCA B;  1W5A A;  3RYF A;  3HKC A;  5GAP K;  2VGM A;  5GIN C;  4X1Y B;  3WJQ A;  4ZI7 A;  1XRG A;  3VI6 A;  4TUY A;  2ZOD A;  3D54 A;  3IEW A;  3NVK E;  2CVL A;  1H48 A;  4X3M A;  2HX0 A;  2IG8 A;  1QAH A;  4U39 A;  3G71 F;  3B6N A;  3F0E A;  3CCM F;  2HS3 A;  1QVF F;  4X1I A;  4I4T A;  2CSL A;  5EIB C;  5HP7 A;  3WGN A;  5MN5 A;  1JFF A;  1Q81 H;  2HP0 B;  4G4V A;  5KMG B;  2ALE A;  2IQQ A;  3I56 F;  4PWT A;  1RA4 A;  3N2K A;  1U43 A;  2HP3 A;  5LOV A;  5JVD B;  3F6M A;  5C8Y A;  1XV2 A;  5HP8 A;  3LFO A;  1YGY A;  3JAS B;  5IJ0 A;  2BTQ B;  3JAW A;  3M84 A;  3JAR B;  4B45 A;  4BY9 D;  3HTN A;  1RQ2 A;  4FFB B;  5LP6 B;  5HY0 A;  5LYJ B;  5EIB D;  1W55 A;  2OZB A;  3ZO8 A;  3IKE A;  5GIP C;  3CXC F;  2VAW A;  5LP6 C;  4O4J A;  1Q7Y H;  2CZW A;  4BVQ A;  3PAF A;  2LCA A;  4U3J A;  5JQG B;  3OBW A;  1K73 H;  3JAL A;  3CCJ F;  1H47 A;  1W5B A;  1YJ9 F;  3HAX D;  4ZHQ B;  2UYP A;  3F0F A;  1GX1 A;  3LDT A;  4I55 B;  3G4S F;  3O85 A;  4O2B B;  3S02 A;  3E22 A;  2H6L A;  3VYU C;  3WPX A;  1IV2 A;  4TV8 B;  3J81 M;  4WBN A;  3ZP4 A;  5BMV A;  1PF5 A;  5EWR A;  1KC8 H;  4E6E A;  5KX5 A;  3CCV F;  1FFX A;  3HJW C;  2DT4 A;  2H8C A;  4TV9 A;  4BT3 A;  1KNJ A;  1YQN A;  1VQ5 F;  1U40 A;  3K2X A;  3FD6 A;  1FNJ A;  1R1M A;  3KJJ A;  3FD5 A;  4IIJ A;  4X1K A;  3KE1 A;  5CB4 B;  2KTV A;  3UT5 B;  4EB6 B;  2OTL F;  3MQW A;  5LA6 A;  4EI8 A;  5ITZ B;  3PLA C;  3VYS C;  1CK2 A;  1VHA A;  2N48 A;  3MCQ A;  1UFY A;  3SIV A;  5J2U B;  2WAL A;  4NUT A;  3CC4 F;  3N2G B;  1X7O A;  2ZF8 A;  3JAM M;  1W3E X;  3I55 F;  4O4I B;  1ODE A;  2KGW A;  4M8I A;  1U3P A;  1TUB B;  3RYI A;  3M4S A;  3CYP B;  1GZ0 A;  3I3F A;  1W2B F;  5IJ9 A;  2KG4 A;  4DXD A;  3CYQ A;  3VTI C;  1FSZ A;  4G4W A;  3WGM A;  3VO8 A;  4C81 A;  3ON1 A;  4ZOL A;  1K9M H;  1SDS A;  2NMU A;  3TD4 A;  2V9Y A;  4G4Z A;  1TVK A;  3CPW F;  5MN4 A;  1X7P A;  3F0D A;  2GVI A;  3HKB B;  3IMP A;  1N8R H;  1VQL F;  1CN7 A;  5EB1 B;  3FBA A;  4HNA B;  5IYZ B;  3ELC A;  5LXT B;  1IPA A;  2LBX A;  3M1X A;  4LNU A;  3JAT A;  4YJ2 B;  3V3T A;  1FNK A;  1XBI A;  4F6R B;  1VQ9 F;  3C9R A;  5IT9 M;  2CHT A;  3Q8H A;  4FFB A;  2IAF A;  1U3L A;  1W40 A;  3V7Q A;  4EI9 A;  3HKE A;  3WGJ A;  2FC3 A;  3P0Z A;  2Q1X A;  3V4D A;  4BT5 A;  5JH7 A;  2QA4 F;  3P10 A;  4ZHW A;  3CCR F;  3MDO A;  1SA0 A;  1OAP A;  5JCO C;  5HY1 A;  2OTM A;  3OBY A;  4YJ3 A;  5GON B;  3VCZ A;  4IHJ B;  2RHL A;  4ZHQ A;  1SZQ A;  3CC2 F;  4DRX B;  4NQ3 A;  4BW0 B;  2RB9 A;  4O4L A;  4I50 A;  5EYP B;  2BTO A;  1IV3 A;  3P4E A;  3EOR A;  4NWO B;  3RYH B;  5GIO C;  2AIZ P;  3CCL F;  4B5C A;  1YI2 F;  1VQV A;  2UYN A;  1RLG A;  3VIU A;  2QEX F;  1DT9 A;  3RYF B;  3HKC B;  3VOA A;  4ZI7 B;  2HS0 A;  1VQ8 F;  3ESJ A;  4TUY B;  1CLI A;  4X20 A;  1UI9 A;  5EZY A;  2OTJ F;  5A2Q M;  2K1S A;  3HKD B;  1ONI A;  2YYE A;  2OHW A;  1VQK F;  3QUW A;  4O4H A;  2Z1F A;  3CC7 F;  1J7H A;  4KWE A;  3J80 M;  1QVG F;  3JAK A;  4BVR A;  4C82 A;  4X1I B;  3GHZ A;  4I4T B;  1RLU A;  3G6E F;  5ITZ A;  1YIJ F;  2HRU A;  2AMT A;  1W5F A;  2VXY A;  2ZOV A;  1JFF B;  5J2U A;  2VAM A;  4ZK7 A;  1E7K A;  2ZAU A;  3AGK A;  4BT6 A;  4RHA A;  4X3L A;  2LBT A;  4ZHY B;  3N2K B;  3IKF A;  5LOV B;  3WXM B;  1VH8 A;  5CA0 A;  5CA1 A;  4TZZ A;  4O2A A;  5C8Y B;  1W41 A;  3CME F;  3NK7 A;  1VQ6 F;  3IR9 A;  2Z1U A;  3NVI B;  3RYC A;  5GAN K;  5HWE A;  5IJ0 B;  5J2T B;  3JAW B;  1Q82 H;  3TD3 A;  1JD1 A;  3S0H A;  5EO3 A;  3CG6 A;  4X1Y A;  3GYQ A;  1VQP F;  3T80 A;  2HQS C;  3KIZ A;  1W42 A;  4BVS A;  3ZOP A;  2Q1Y A;  1IV4 A;  5IYZ A;  3S03 A;  4O4J B;  1W59 A;  4U3J B;  1QD9 A;  4C4W C;  4RQO A;  2H8E A;  2QI2 A;  3JAL B;  3IEQ A;  1COM A;  2GZL A;  1OFU A;  1KQS F;  1VQ7 F;  1H7M A;  2L26 A;  1YHQ F;  1YJN F;  2RHH A;  2UYK A;  3C9S A;  2HP0 A;  1X52 A;  3WJP A;  4WBN B;  2PMP A;  5BMV B;  3S0Y A;  3ERN A;  3K12 A;  5KMG A;  2I6R A;  5KX5 B;  3LWP C;  3JCM M;  1T0K B;  2MQE A;  3JVH A;  4G4Y A;  5JVD A;  4TV9 B;  5FNV B;  2HS4 A;  3L7Q A;  1XHO A;  1K8A H;  2VGN A;  3LWO C;  3JAS A;  4X1K B;  3S0W A;  5B8F A;  3JAR A;  4C8E A;  1GO0 A;  1PXW A;  3OON A;  2R75 1;  3CMA F;  5DCV A;  2RHJ A;  5LP6 A;  5LA6 B;  5LYJ A;  3CB2 A;  2Z1E A;  3RA5 A;  1IV1 A;  1W5E A;  2R6R 1;  5MN6 A;  4ZHV A;  4C8G A;  3LWQ C;  1GO1 A;  3K0T A;  3WJR A;  1W58 1; 
#chains in the Genus database with same CATH homology
 4XCQ A;  1VQ5 F;  3CPQ A;  3D00 A;  2OTJ F;  5A2Q M;  3LWR C;  2OHW A;  1VQK F;  4BVT A;  3CC7 F;  3N4Z A;  3J80 M;  3CCS F;  3VMF B;  1QVG F;  1M90 H;  4BVR A;  2KTV A;  2OTL F;  1M1K H;  3G6E F;  1JJ2 F;  1YIJ F;  5G4V C;  4EI8 A;  3MCA B;  5FLX M;  3PLA C;  3SIU A;  5GAP K;  2VGM A;  1CK2 A;  5GIN C;  5HY4 A;  3SIV A;  1E7K A;  5HY2 A;  1YIT F;  2WAL A;  3AGK A;  4NUT A;  3CC4 F;  3VI6 A;  1X7O A;  4X3L A;  3E20 B;  2F9Z C;  1YJW F;  3JAM M;  1Q86 H;  1VQN F;  1W3E X;  3I55 F;  3NVK E;  1KD1 H;  3CCQ F;  4X3M A;  3WXM B;  3G71 F;  4TZZ A;  3CCM F;  1GZ0 A;  1W41 A;  3CME F;  3NK7 A;  1VQ6 F;  1W2B F;  3IR9 A;  3LWV C;  1QVF F;  2KG4 A;  3NVI B;  5GAN K;  1VQ4 F;  5HWE A;  3V7E A;  5HXU A;  1Q82 H;  1K9M H;  3ON1 A;  1Q81 H;  5EO3 A;  3CG6 A;  1NJI H;  3GYQ A;  1SDS A;  1VQP F;  2KTU A;  3CPW F;  2ALE A;  1W42 A;  5HXZ A;  1X7P A;  4BVS A;  1N8R H;  3I56 F;  1VQL F;  1RA4 A;  1CN7 A;  2FGY A;  1NMU B;  4C4W C;  2QI2 A;  2AIF A;  3CCU F;  1IPA A;  2LBX A;  3LFO A;  3V3T A;  1KQS F;  1XBI A;  3OW2 F;  5IT9 M;  1VQ9 F;  1VQ7 F;  1H7M A;  1YHQ F;  4BY9 D;  2HVY D;  1YJN F;  1W40 A;  1X52 A;  5HY0 A;  3V7Q A;  4EI9 A;  2FC3 A;  2OZB A;  2QA4 F;  5GIP C;  3LWP C;  3CXC F;  3JCM M;  1VQM F;  1VQO F;  3CCR F;  1T0K B;  3NK6 A;  3E1Y A;  1ZWZ A;  5HY1 A;  1Q7Y H;  2CZW A;  3OBY A;  4BVQ A;  4EI7 A;  2I6D A;  3PAF A;  1S72 F;  3CD6 F;  3J7A R;  3OBW A;  1K73 H;  3CCJ F;  1K8A H;  3CC2 F;  2VGN A;  1YJ9 F;  3LWO C;  3HAX D;  3CCE F;  3NMU C;  4NQ3 A;  4BW0 B;  5FJ4 C;  2JNB A;  3G4S F;  3N4Y A;  3O85 A;  5GIO C;  1GO0 A;  1PXW A;  3FFM A;  3CMA F;  3CCL F;  1YI2 F;  5DCV A;  3J81 M;  1RLG A;  2GLZ A;  2QEX F;  1DT9 A;  5EWR A;  3RA5 A;  1KC8 H;  2LBW A;  4LCK A;  5G4U C;  3CCV F;  2BO1 A;  3HJW C;  1VQ8 F;  3LWQ C;  1GO1 A;  3RA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...