3CCLF

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535c. density for anisomycin is visible but not included in model.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 34
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3cclF00
2OTLF 5A2QM 1M90H 3CCLF 2KTUA 1QVGF 1K73H 1GO0A 2QEXF 1GO1A 1XBIA 2OZBA 1VQKF 2VGMA 5IT9M 4C4WC 3IR9A 2LBWA 4X3MA 3G71F 1VQ7F 3CC7F 1YHQF 5G4VC 1KQSF 3LWOC 3V7EA 3CCMF 3MCAB 1VQ4F 5DCVA 1YJ9F 3CC4F 3VI6A 3SIVA 3LWRC 2FC3A 3AGKA 3CCRF 1ZWZA 1Q7YH 3NVKE 3HAXD 1DT9A 3LFOA 3G4SF 3ON1A 3O85A 1YITF 1QVFF 1YJNF 5GINC 3CMEF 3CCQF 1VQPF 2KG4A 3LWVC 3RA5A 3J80M 3NK7A 1YJWF 3I56F 1S72F 1YIJF 1VQ6F 1VQNF 1W42A 1X52A 3CCJF 1Q81H 3PLAC 1X7OA 2OTJF 3CCVF 5GIOC 4TZZA 3CCSF 3GYQA 1SDSA 3J81M 2QI2A 1KC8H 3CD6F 1RLGA 5EWRA 4X3LA 1GZ0A 3PAFA 5EO3A 3CPQA 3LWPC 1JJ2F 4BY9D 3V7QA 1VQ9F 1X7PA 3JCMM 5GAPK 3LWQC 1VQOF 1KD1H 3JAMM 3CXCF 2KTVA 5G4UC 4BW0B 4LCKA 3N4ZA 1VQ5F 3OBWA 1CK2A 1W2BF 3E20B 3FFMA 1M1KH 1H7MA 5FLXM 1Q82H 1K9MH 1NMUB 2QA4F 5GIPC 2VGNA 2OHWA 1N8RH 3HJWC 3RA6A 3OBYA 1PXWA 1K8AH 2CZWA 3CG6A 3CPWF 4NUTA 5GANK 2HVYD 2AIFA 2WALA 3SIUA 3G6EF 1YI2F 1VQLF 3E1YA 3VMFB 2I6DA 3CMAF 3CCEF 3CCUF 3N4YA 1W3EX 1W41A 2BO1A 2LBXA 1IPAA 1VQ8F 3J7AR 3NVIB 1Q86H 3NMUC 1W40A 1E7KA 1NJIH 5FJ4C 1CN7A 3CC2F 2ALEA 1RA4A 3NK6A 3OW2F 3WXMB 3I55F 2JNBA 1VQMF 1T0KB
chains in the Genus database with same CATH superfamily
2KTUA 4TV9A 5LA6B 3WGJA 4BT6A 5LXTB 2RHJA 1K73H 1GO0A 3HKBA 4O4HB 1NQ3A 2LBWA 3N2GB 3G71F 1KQSF 4C8EA 3CCMF 3QTYA 3MCAB 5LP6C 4I4TB 2RB9A 4X1IB 5LOVA 1UI9A 2HRUA 4I50A 3WGLA 3WGKA 2Z1FA 1Q7YH 2I6RA 4G4WA 1ODEA 2Z1TA 1DBFA 5IYZB 2RHOA 1YITF 3HKCA 1OAPA 3JAWB 1YJNF 3D54A 2HX0A 1IV1A 4ZOLB 5EYPA 4DRXA 3VO8A 2G9IA 1FFXA 2PHNA 5JQGB 3DC2A 2B33A 4ZHQA 4NQ3A 3V4DA 5MN6A 3K2XA 1J7HA 3TD4A 1VHAA 3LDTA 2VAMA 3WJQA 3FBAA 4YJ3A 1X7OA 4KWEA 4O4JA 2ZAUA 4TZZA 3K12A 5JCOA 1X25A 5CA0B 3KIZA 1RLGA 3IKEA 5IJ0B 5EB0A 5EWRA 1RQ2A 4X3LA 2UYKA 3E22B 3L7QA 2R751 3PAFA 3P4EA 2L26A 5HXZA 4FFBA 3VYTC 1FSZA 4EI8A 3LWQC 2Z01A 3KE1A 1KD1H 3F6MA 1R1MA 1TUBA 2ZODA 3TD3A 4YJ3B 1H48A 4ZI7A 1VQ5F 2FGYA 1U40A 5GONA 4LNUA 3GHZA 1K9MH 2QTPA 3CYPB 3KJKA 1NMUB 3S0YA 2H8CA 3RYFB 1K8AH 1KNJA 1QU9A 4ZK7A 3QUWA 4F6RA 4I55A 3SIUA 5KMGA 1VQLF 3VMFB 3VYSC 5JH7B 2K1SA 3UT5B 3N4YA 1IV3A 5JVDA 3U0OA 2BO1A 1VQ8F 2BTQB 3S02A 4TUYB 1W59A 5EAZA 5CB4B 3NVIB 3IKFA 1Z5WA 2EWCA 3CB2A 1QD9A 3CC2F 1TVKA 3NK6A 3WGNA 4BT3A 3WXMB 5KMGB 3I55F 3CD6F 1M90H 3WGMA 1IV2A 5ITZB 4PWTA 1UFYA 1QVGF 5JVDB 2QEXF 1GO1A 5EZYB 4X1YA 1XBIA 2OZBA 2VGMA 5IT9M 3CYQA 4C4WC 4X3MA 4B46A 4EI7A 5LA6A 5EIBD 1YHQF 5LXTA 1T0AA 4O4HA 5HWEA 3LWOC 4IIJB 3N2GA 2H8EA 1ONIA 3KHNA 4G4ZA 4ZHYB 5DCVA 5JCOC 1YJ9F 1RQ7A 5CA1B 2FC3A 3CCRF 4B45A 3NVKE 3G4SF 4I4TA 4X1IA 3ON1A 2BTOA 3HWUA 3QHDA 4BT4A 3KJJA 1VQPF 1U43A 5IYZA 3MBMA 4DXDA 3JAWA 3I56F 2R6R1 4ZOLA 1U3LA 3F0GA 5JQGA 2HRYA 1VH8A 5GIOC 3J81M 2PMPA 2QI2A 3B6NA 2RHHA 2UYNB 4C81A 3JASB 2IQQA 2DT4A 5EO3A 2F9ZC 1JJ2F 4BY9D 1VQ9F 5CA0A 3JCMM 4M8IA 5IJ0A 3JAKB 3K0TA 4BW0B 3E22A 3N2KB 4C8GA 2OTMA 4LCKA 3N4ZA 5HY2A 4IHJB 2ZVZA 3C8LA 3F0DA 1XRGA 4B5CA 3C9SA 1H7MA 3MDOA 1XV2A 3ZP4A 1W5AA 4G88A 2VGNA 5HP8A 4O4LB 4EI9A 1N8RH 3RA6A 3OBYA 3ERNA 1GX1A 2CZWA 3RYHB 2HVYD 3FD5A 2AIFA 3D01A 1YI2F 1H47A 3RYFA 2I6DA 3CCEF 3MCQA 1W5EA 2ZF8A 3LYBA 3M84A 3S03A 5JH7A 5AVMA 2YXZA 3RE3A 3UT5A 2CVLA 5HY1A 4X20B 3ESJA 1W40A 3ZP7A 1E7KA 2UYJA 2NMUA 4U3JA 5HY0A 1QAHA 2HP0B 4B62A 3P0ZA 2Q1YA 4TUYA 5CB4A 2N48A 2OTLF 3CCLF 2VAWA 1JD1A 3HKDB 4BVRA 4BVSA 1VQVA 2HP3A 5ITZA 3CC7F 5C8YB 5G4VC 5B8FA 4O2BB 4U3JB 5EZYA 4ERHA 1JY8A 4BT5A 3V7EA 3TD5A 3RYCB 5MN4A 1W581 5LP6A 5KX5B 4R40B 3CC4F 3VI6A 2BTUA 2CWJA 2UYPA 3JATA 4XCQA 5BMVB 3LWRC 1DT9A 2P6YA 4IIJA 2Z1UA 4U39A 3FPIA 3HKEB 1W5BA 3FD6A 3O85A 2DYYA 3C9TA 5HY4A 5CA1A 4WBNB 3I3FA 3CMEF 3M4SA 3S06A 3RA5A 3RYIA 4TV8B 3J80M 5LP6B 1YJWF 1RLUA 2AMTA 3JATB 4X1KB 1YIJF 1VQ6F 1W42A 3LMEA 4NWOB 1Q81H 2OTJF 1KNKA 3CCVF 3JVHA 4O2AB 3C9RA 3GYQA 4EB6B 4C82A 2H6LA 4YJ2A 5J2TB 5J2UB 3OONA 1JN1A 4O4IA 3RYIB 1X7PA 4HNAB 2UYNA 3JALB 3JAMM 3VYUC 3JASA 2HS3A 3OBWA 4BT7A 1W2BF 4YJ2B 3JAKA 3FFMA 5FNVB 1Q82H 5FLXM 1M1KH 2HS4A 3N2KA 2CHSA 4IHJA 4O4IB 3WJRA 3JARB 3GTZA 4ZHWA 2IG8A 2CSLA 3CG6A 4NUTA 1FNKA 5GANK 2LCAA 2WALA 3E1YA 4O4LA 5LYJB 2UZHA 2IAFA 5HXUA 3CCUF 3RYHA 1VK3A 1JFFB 3VIUA 1W41A 2HQSC 2LBXA 3S0WA 5EB1B 2ZVYA 4TV9B 3K14A 3ZO8A 2GLZA 3HKBB 1RA4A 1VQMF 5A2QM 2AIZP 4X20A 2RHLA 2VXYA 2W8BC 3DDNA 3VTIC 5IJ9A 3VOBA 2HP0A 1VQKF 3IR9A 5LOVB 3ELCA 1VQ7F 4RHAA 1OFUA 3M1XA 1YGYA 4I50B 1YQNA 3HKDA 3BYQA 3F0EA 3WJPA 1VQ4F 2KGWA 3HKCB 5C8YA 4ZHVA 1SZQA 3F0FA 4O2BA 4G4YA 3SIVA 4BVTA 3AGKA 5IJ9B 1ZWZA 2Z1EA 1CLIA 5EYPB 4DRXB 2HS0A 4C8IA 1FFXB 2CW4A 3HAXD 3LFOA 3RYCA 4ZHQB 4G4XA 5KX5A 1QVFF 3IMPA 5BMVA 1Z5VA 5GINC 3VCZA 3CCQF 2KG4A 3LWVC 2MQEA 3R0PA 3HKEA 4O4JB 1W55A 3NK7A 1SA0A 1S72F 3Q8HA 4WBNA 4G4VA 1VQNF 1X52A 3CCJF 3PLAC 3C9UA 2VAPA 4TV8A 4FFBB 3CCSF 1SDSA 1KC8H 4X1KA 3ZOPA 2GVIA 1GZ0A 1TUBB 3T80A 3CPQA 4ZI7B 3LWPC 4O2AA 4EB6A 1SA0B 3V7QA 5GONB 1COMA 5J2TA 5GAPK 5J2UA 3IEQA 1VQOF 3CXCF 2KTVA 4LNUB 3HTNA 3S0HA 3VOAA 4E6EA 5G4UC 3V3TA 3P10A 1CK2A 4HNAA 3JALA 2YYEA 3E20B 5EIBC 1W57A 4RQOA 4F6RB 3I7TA 4I55B 3MQWA 3WPWA 1FNJA 1Q8RA 1U3PA 5MN5A 2OHWA 5GIPC 2QA4F 3HJWC 1PXWA 2LBTA 5FNVA 3CPWF 4BT2A 5HP7A 3D00A 3G6EF 4BVQA 3JARA 2Q1XA 3CMAF 2V9YA 1W3EX 2CHTA 2GZLA 3EORA 2ZOVA 1TVKB 5LYJA 1PF5A 1W5FA 1IPAA 3J7AR 1Q86H 3NMUC 1XHOA 3WPXA 1NJIH 5FJ4C 1CN7A 1JFFA 3IEWA 1IV4A 2ALEA 4X1YB 3OW2F 2JNBA 1T0KB
chains in the Genus database with same CATH topology
2OTLF 5A2QM 1M90H 3CCLF 2KTUA 1QVGF 1K73H 1GO0A 2QEXF 1GO1A 1XBIA 2OZBA 1VQKF 2VGMA 5IT9M 4C4WC 3IR9A 2LBWA 4X3MA 4BVRA 4BVSA 4EI7A 3G71F 1VQ7F 3CC7F 1YHQF 5G4VC 1KQSF 5HWEA 3LWOC 3V7EA 3CCMF 3MCAB 1VQ4F 5DCVA 1YJ9F 3CC4F 3VI6A 4XCQA 3SIVA 3LWRC 2FC3A 3AGKA 4BVTA 1ZWZA 3CCRF 1Q7YH 3NVKE 3HAXD 1DT9A 3LFOA 3G4SF 3ON1A 3O85A 1YITF 1QVFF 1YJNF 5HY4A 5GINC 3CMEF 3CCQF 1VQPF 2KG4A 3LWVC 3RA5A 4NQ3A 3J80M 3NK7A 1YJWF 3I56F 1S72F 1YIJF 1VQ6F 1VQNF 1W42A 1X52A 3CCJF 1Q81H 3PLAC 1X7OA 2OTJF 3CCVF 5GIOC 4TZZA 3CCSF 3GYQA 1SDSA 3J81M 2QI2A 1KC8H 3CD6F 1RLGA 5EWRA 4X3LA 1GZ0A 3PAFA 5EO3A 5HXZA 3CPQA 3LWPC 2F9ZC 1JJ2F 4BY9D 3V7QA 1VQ9F 1X7PA 3JCMM 4EI8A 5GAPK 3LWQC 1VQOF 1KD1H 3JAMM 3CXCF 2KTVA 5G4UC 4BW0B 4LCKA 3N4ZA 1VQ5F 3V3TA 5HY2A 3OBWA 2FGYA 1CK2A 1W2BF 3E20B 3FFMA 1M1KH 1H7MA 5FLXM 1Q82H 1K9MH 1NMUB 2QA4F 5GIPC 2VGNA 2OHWA 4EI9A 1N8RH 3RA6A 3HJWC 3OBYA 1PXWA 1K8AH 2CZWA 3CG6A 3CPWF 4NUTA 5GANK 2HVYD 2AIFA 2WALA 3D00A 3SIUA 3G6EF 4BVQA 1YI2F 1VQLF 3E1YA 3VMFB 2I6DA 3CMAF 3CCEF 5HXUA 3CCUF 3N4YA 1W3EX 1W41A 2BO1A 2LBXA 1IPAA 1VQ8F 3J7AR 3NVIB 1Q86H 5HY1A 3NMUC 1W40A 1E7KA 1NJIH 5FJ4C 1CN7A 5HY0A 2GLZA 3CC2F 2ALEA 1RA4A 3NK6A 3OW2F 3WXMB 3I55F 2JNBA 1VQMF 1T0KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTL F;  5A2Q M;  1M90 H;  3CCL F;  2KTU A;  1QVG F;  1K73 H;  1GO0 A;  2QEX F;  1GO1 A;  1XBI A;  2OZB A;  1VQK F;  2VGM A;  5IT9 M;  4C4W C;  3IR9 A;  2LBW A;  4X3M A;  3G71 F;  1VQ7 F;  3CC7 F;  1YHQ F;  5G4V C;  1KQS F;  3LWO C;  3V7E A;  3CCM F;  3MCA B;  1VQ4 F;  5DCV A;  1YJ9 F;  3CC4 F;  3VI6 A;  3SIV A;  3LWR C;  2FC3 A;  3AGK A;  3CCR F;  1ZWZ A;  1Q7Y H;  3NVK E;  3HAX D;  1DT9 A;  3LFO A;  3G4S F;  3ON1 A;  3O85 A;  1YIT F;  1QVF F;  1YJN F;  5GIN C;  3CME F;  3CCQ F;  1VQP F;  2KG4 A;  3LWV C;  3RA5 A;  3J80 M;  3NK7 A;  1YJW F;  3I56 F;  1S72 F;  1YIJ F;  1VQ6 F;  1VQN F;  1W42 A;  1X52 A;  3CCJ F;  1Q81 H;  3PLA C;  1X7O A;  2OTJ F;  3CCV F;  5GIO C;  4TZZ A;  3CCS F;  3GYQ A;  1SDS A;  3J81 M;  2QI2 A;  1KC8 H;  3CD6 F;  1RLG A;  5EWR A;  4X3L A;  1GZ0 A;  3PAF A;  5EO3 A;  3CPQ A;  3LWP C;  1JJ2 F;  4BY9 D;  3V7Q A;  1VQ9 F;  1X7P A;  3JCM M;  5GAP K;  3LWQ C;  1VQO F;  1KD1 H;  3JAM M;  3CXC F;  2KTV A;  5G4U C;  4BW0 B;  4LCK A;  3N4Z A;  1VQ5 F;  3OBW A;  1CK2 A;  1W2B F;  3E20 B;  3FFM A;  1M1K H;  1H7M A;  5FLX M;  1Q82 H;  1K9M H;  1NMU B;  2QA4 F;  5GIP C;  2VGN A;  2OHW A;  1N8R H;  3HJW C;  3RA6 A;  3OBY A;  1PXW A;  1K8A H;  2CZW A;  3CG6 A;  3CPW F;  4NUT A;  5GAN K;  2HVY D;  2AIF A;  2WAL A;  3SIU A;  3G6E F;  1YI2 F;  1VQL F;  3E1Y A;  3VMF B;  2I6D A;  3CMA F;  3CCE F;  3CCU F;  3N4Y A;  1W3E X;  1W41 A;  2BO1 A;  2LBX A;  1IPA A;  1VQ8 F;  3J7A R;  3NVI B;  1Q86 H;  3NMU C;  1W40 A;  1E7K A;  1NJI H;  5FJ4 C;  1CN7 A;  3CC2 F;  2ALE A;  1RA4 A;  3NK6 A;  3OW2 F;  3WXM B;  3I55 F;  2JNB A;  1VQM F;  1T0K B; 
#chains in the Genus database with same CATH topology
 2KTU A;  4TV9 A;  5LA6 B;  3WGJ A;  4BT6 A;  5LXT B;  2RHJ A;  1K73 H;  1GO0 A;  3HKB A;  4O4H B;  1NQ3 A;  2LBW A;  3N2G B;  3G71 F;  1KQS F;  4C8E A;  3CCM F;  3QTY A;  3MCA B;  5LP6 C;  4I4T B;  2RB9 A;  4X1I B;  5LOV A;  1UI9 A;  2HRU A;  4I50 A;  3WGL A;  3WGK A;  2Z1F A;  1Q7Y H;  2I6R A;  4G4W A;  1ODE A;  2Z1T A;  1DBF A;  5IYZ B;  2RHO A;  1YIT F;  3HKC A;  1OAP A;  3JAW B;  1YJN F;  3D54 A;  2HX0 A;  1IV1 A;  4ZOL B;  5EYP A;  4DRX A;  3VO8 A;  2G9I A;  1FFX A;  2PHN A;  5JQG B;  3DC2 A;  2B33 A;  4ZHQ A;  4NQ3 A;  3V4D A;  5MN6 A;  3K2X A;  1J7H A;  3TD4 A;  1VHA A;  3LDT A;  2VAM A;  3WJQ A;  3FBA A;  4YJ3 A;  1X7O A;  4KWE A;  4O4J A;  2ZAU A;  4TZZ A;  3K12 A;  5JCO A;  1X25 A;  5CA0 B;  3KIZ A;  1RLG A;  3IKE A;  5IJ0 B;  5EB0 A;  5EWR A;  1RQ2 A;  4X3L A;  2UYK A;  3E22 B;  3L7Q A;  2R75 1;  3PAF A;  3P4E A;  2L26 A;  5HXZ A;  4FFB A;  3VYT C;  1FSZ A;  4EI8 A;  3LWQ C;  2Z01 A;  3KE1 A;  1KD1 H;  3F6M A;  1R1M A;  1TUB A;  2ZOD A;  3TD3 A;  4YJ3 B;  1H48 A;  4ZI7 A;  1VQ5 F;  2FGY A;  1U40 A;  5GON A;  4LNU A;  3GHZ A;  1K9M H;  2QTP A;  3CYP B;  3KJK A;  1NMU B;  3S0Y A;  2H8C A;  3RYF B;  1K8A H;  1KNJ A;  1QU9 A;  4ZK7 A;  3QUW A;  4F6R A;  4I55 A;  3SIU A;  5KMG A;  1VQL F;  3VMF B;  3VYS C;  5JH7 B;  2K1S A;  3UT5 B;  3N4Y A;  1IV3 A;  5JVD A;  3U0O A;  2BO1 A;  1VQ8 F;  2BTQ B;  3S02 A;  4TUY B;  1W59 A;  5EAZ A;  5CB4 B;  3NVI B;  3IKF A;  1Z5W A;  2EWC A;  3CB2 A;  1QD9 A;  3CC2 F;  1TVK A;  3NK6 A;  3WGN A;  4BT3 A;  3WXM B;  5KMG B;  3I55 F;  3CD6 F;  1M90 H;  3WGM A;  1IV2 A;  5ITZ B;  4PWT A;  1UFY A;  1QVG F;  5JVD B;  2QEX F;  1GO1 A;  5EZY B;  4X1Y A;  1XBI A;  2OZB A;  2VGM A;  5IT9 M;  3CYQ A;  4C4W C;  4X3M A;  4B46 A;  4EI7 A;  5LA6 A;  5EIB D;  1YHQ F;  5LXT A;  1T0A A;  4O4H A;  5HWE A;  3LWO C;  4IIJ B;  3N2G A;  2H8E A;  1ONI A;  3KHN A;  4G4Z A;  4ZHY B;  5DCV A;  5JCO C;  1YJ9 F;  1RQ7 A;  5CA1 B;  2FC3 A;  3CCR F;  4B45 A;  3NVK E;  3G4S F;  4I4T A;  4X1I A;  3ON1 A;  2BTO A;  3HWU A;  3QHD A;  4BT4 A;  3KJJ A;  1VQP F;  1U43 A;  5IYZ A;  3MBM A;  4DXD A;  3JAW A;  3I56 F;  2R6R 1;  4ZOL A;  1U3L A;  3F0G A;  5JQG A;  2HRY A;  1VH8 A;  5GIO C;  3J81 M;  2PMP A;  2QI2 A;  3B6N A;  2RHH A;  2UYN B;  4C81 A;  3JAS B;  2IQQ A;  2DT4 A;  5EO3 A;  2F9Z C;  1JJ2 F;  4BY9 D;  1VQ9 F;  5CA0 A;  3JCM M;  4M8I A;  5IJ0 A;  3JAK B;  3K0T A;  4BW0 B;  3E22 A;  3N2K B;  4C8G A;  2OTM A;  4LCK A;  3N4Z A;  5HY2 A;  4IHJ B;  2ZVZ A;  3C8L A;  3F0D A;  1XRG A;  4B5C A;  3C9S A;  1H7M A;  3MDO A;  1XV2 A;  3ZP4 A;  1W5A A;  4G88 A;  2VGN A;  5HP8 A;  4O4L B;  4EI9 A;  1N8R H;  3RA6 A;  3OBY A;  3ERN A;  1GX1 A;  2CZW A;  3RYH B;  2HVY D;  3FD5 A;  2AIF A;  3D01 A;  1YI2 F;  1H47 A;  3RYF A;  2I6D A;  3CCE F;  3MCQ A;  1W5E A;  2ZF8 A;  3LYB A;  3M84 A;  3S03 A;  5JH7 A;  5AVM A;  2YXZ A;  3RE3 A;  3UT5 A;  2CVL A;  5HY1 A;  4X20 B;  3ESJ A;  1W40 A;  3ZP7 A;  1E7K A;  2UYJ A;  2NMU A;  4U3J A;  5HY0 A;  1QAH A;  2HP0 B;  4B62 A;  3P0Z A;  2Q1Y A;  4TUY A;  5CB4 A;  2N48 A;  2OTL F;  3CCL F;  2VAW A;  1JD1 A;  3HKD B;  4BVR A;  4BVS A;  1VQV A;  2HP3 A;  5ITZ A;  3CC7 F;  5C8Y B;  5G4V C;  5B8F A;  4O2B B;  4U3J B;  5EZY A;  4ERH A;  1JY8 A;  4BT5 A;  3V7E A;  3TD5 A;  3RYC B;  5MN4 A;  1W58 1;  5LP6 A;  5KX5 B;  4R40 B;  3CC4 F;  3VI6 A;  2BTU A;  2CWJ A;  2UYP A;  3JAT A;  4XCQ A;  5BMV B;  3LWR C;  1DT9 A;  2P6Y A;  4IIJ A;  2Z1U A;  4U39 A;  3FPI A;  3HKE B;  1W5B A;  3FD6 A;  3O85 A;  2DYY A;  3C9T A;  5HY4 A;  5CA1 A;  4WBN B;  3I3F A;  3CME F;  3M4S A;  3S06 A;  3RA5 A;  3RYI A;  4TV8 B;  3J80 M;  5LP6 B;  1YJW F;  1RLU A;  2AMT A;  3JAT B;  4X1K B;  1YIJ F;  1VQ6 F;  1W42 A;  3LME A;  4NWO B;  1Q81 H;  2OTJ F;  1KNK A;  3CCV F;  3JVH A;  4O2A B;  3C9R A;  3GYQ A;  4EB6 B;  4C82 A;  2H6L A;  4YJ2 A;  5J2T B;  5J2U B;  3OON A;  1JN1 A;  4O4I A;  3RYI B;  1X7P A;  4HNA B;  2UYN A;  3JAL B;  3JAM M;  3VYU C;  3JAS A;  2HS3 A;  3OBW A;  4BT7 A;  1W2B F;  4YJ2 B;  3JAK A;  3FFM A;  5FNV B;  1Q82 H;  5FLX M;  1M1K H;  2HS4 A;  3N2K A;  2CHS A;  4IHJ A;  4O4I B;  3WJR A;  3JAR B;  3GTZ A;  4ZHW A;  2IG8 A;  2CSL A;  3CG6 A;  4NUT A;  1FNK A;  5GAN K;  2LCA A;  2WAL A;  3E1Y A;  4O4L A;  5LYJ B;  2UZH A;  2IAF A;  5HXU A;  3CCU F;  3RYH A;  1VK3 A;  1JFF B;  3VIU A;  1W41 A;  2HQS C;  2LBX A;  3S0W A;  5EB1 B;  2ZVY A;  4TV9 B;  3K14 A;  3ZO8 A;  2GLZ A;  3HKB B;  1RA4 A;  1VQM F;  5A2Q M;  2AIZ P;  4X20 A;  2RHL A;  2VXY A;  2W8B C;  3DDN A;  3VTI C;  5IJ9 A;  3VOB A;  2HP0 A;  1VQK F;  3IR9 A;  5LOV B;  3ELC A;  1VQ7 F;  4RHA A;  1OFU A;  3M1X A;  1YGY A;  4I50 B;  1YQN A;  3HKD A;  3BYQ A;  3F0E A;  3WJP A;  1VQ4 F;  2KGW A;  3HKC B;  5C8Y A;  4ZHV A;  1SZQ A;  3F0F A;  4O2B A;  4G4Y A;  3SIV A;  4BVT A;  3AGK A;  5IJ9 B;  1ZWZ A;  2Z1E A;  1CLI A;  5EYP B;  4DRX B;  2HS0 A;  4C8I A;  1FFX B;  2CW4 A;  3HAX D;  3LFO A;  3RYC A;  4ZHQ B;  4G4X A;  5KX5 A;  1QVF F;  3IMP A;  5BMV A;  1Z5V A;  5GIN C;  3VCZ A;  3CCQ F;  2KG4 A;  3LWV C;  2MQE A;  3R0P A;  3HKE A;  4O4J B;  1W55 A;  3NK7 A;  1SA0 A;  1S72 F;  3Q8H A;  4WBN A;  4G4V A;  1VQN F;  1X52 A;  3CCJ F;  3PLA C;  3C9U A;  2VAP A;  4TV8 A;  4FFB B;  3CCS F;  1SDS A;  1KC8 H;  4X1K A;  3ZOP A;  2GVI A;  1GZ0 A;  1TUB B;  3T80 A;  3CPQ A;  4ZI7 B;  3LWP C;  4O2A A;  4EB6 A;  1SA0 B;  3V7Q A;  5GON B;  1COM A;  5J2T A;  5GAP K;  5J2U A;  3IEQ A;  1VQO F;  3CXC F;  2KTV A;  4LNU B;  3HTN A;  3S0H A;  3VOA A;  4E6E A;  5G4U C;  3V3T A;  3P10 A;  1CK2 A;  4HNA A;  3JAL A;  2YYE A;  3E20 B;  5EIB C;  1W57 A;  4RQO A;  4F6R B;  3I7T A;  4I55 B;  3MQW A;  3WPW A;  1FNJ A;  1Q8R A;  1U3P A;  5MN5 A;  2OHW A;  5GIP C;  2QA4 F;  3HJW C;  1PXW A;  2LBT A;  5FNV A;  3CPW F;  4BT2 A;  5HP7 A;  3D00 A;  3G6E F;  4BVQ A;  3JAR A;  2Q1X A;  3CMA F;  2V9Y A;  1W3E X;  2CHT A;  2GZL A;  3EOR A;  2ZOV A;  1TVK B;  5LYJ A;  1PF5 A;  1W5F A;  1IPA A;  3J7A R;  1Q86 H;  3NMU C;  1XHO A;  3WPX A;  1NJI H;  5FJ4 C;  1CN7 A;  1JFF A;  3IEW A;  1IV4 A;  2ALE A;  4X1Y B;  3OW2 F;  2JNB A;  1T0K B; 
#chains in the Genus database with same CATH homology
 2OTL F;  5A2Q M;  1M90 H;  3CCL F;  2KTU A;  1QVG F;  1K73 H;  1GO0 A;  2QEX F;  1GO1 A;  1XBI A;  2OZB A;  1VQK F;  2VGM A;  5IT9 M;  4C4W C;  3IR9 A;  2LBW A;  4X3M A;  4BVR A;  4BVS A;  4EI7 A;  3G71 F;  1VQ7 F;  3CC7 F;  1YHQ F;  5G4V C;  1KQS F;  5HWE A;  3LWO C;  3V7E A;  3CCM F;  3MCA B;  1VQ4 F;  5DCV A;  1YJ9 F;  3CC4 F;  3VI6 A;  4XCQ A;  3SIV A;  3LWR C;  2FC3 A;  3AGK A;  4BVT A;  1ZWZ A;  3CCR F;  1Q7Y H;  3NVK E;  3HAX D;  1DT9 A;  3LFO A;  3G4S F;  3ON1 A;  3O85 A;  1YIT F;  1QVF F;  1YJN F;  5HY4 A;  5GIN C;  3CME F;  3CCQ F;  1VQP F;  2KG4 A;  3LWV C;  3RA5 A;  4NQ3 A;  3J80 M;  3NK7 A;  1YJW F;  3I56 F;  1S72 F;  1YIJ F;  1VQ6 F;  1VQN F;  1W42 A;  1X52 A;  3CCJ F;  1Q81 H;  3PLA C;  1X7O A;  2OTJ F;  3CCV F;  5GIO C;  4TZZ A;  3CCS F;  3GYQ A;  1SDS A;  3J81 M;  2QI2 A;  1KC8 H;  3CD6 F;  1RLG A;  5EWR A;  4X3L A;  1GZ0 A;  3PAF A;  5EO3 A;  5HXZ A;  3CPQ A;  3LWP C;  2F9Z C;  1JJ2 F;  4BY9 D;  3V7Q A;  1VQ9 F;  1X7P A;  3JCM M;  4EI8 A;  5GAP K;  3LWQ C;  1VQO F;  1KD1 H;  3JAM M;  3CXC F;  2KTV A;  5G4U C;  4BW0 B;  4LCK A;  3N4Z A;  1VQ5 F;  3V3T A;  5HY2 A;  3OBW A;  2FGY A;  1CK2 A;  1W2B F;  3E20 B;  3FFM A;  1M1K H;  1H7M A;  5FLX M;  1Q82 H;  1K9M H;  1NMU B;  2QA4 F;  5GIP C;  2VGN A;  2OHW A;  4EI9 A;  1N8R H;  3RA6 A;  3HJW C;  3OBY A;  1PXW A;  1K8A H;  2CZW A;  3CG6 A;  3CPW F;  4NUT A;  5GAN K;  2HVY D;  2AIF A;  2WAL A;  3D00 A;  3SIU A;  3G6E F;  4BVQ A;  1YI2 F;  1VQL F;  3E1Y A;  3VMF B;  2I6D A;  3CMA F;  3CCE F;  5HXU A;  3CCU F;  3N4Y A;  1W3E X;  1W41 A;  2BO1 A;  2LBX A;  1IPA A;  1VQ8 F;  3J7A R;  3NVI B;  1Q86 H;  5HY1 A;  3NMU C;  1W40 A;  1E7K A;  1NJI H;  5FJ4 C;  1CN7 A;  5HY0 A;  2GLZ A;  3CC2 F;  2ALE A;  1RA4 A;  3NK6 A;  3OW2 F;  3WXM B;  3I55 F;  2JNB A;  1VQM F;  1T0K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...