3CCLL

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535c. density for anisomycin is visible but not included in model.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
150
structure length
145
Chain Sequence
b'TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 145
sequence length 150
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 3cclL02
4.10.990.10 Few Secondary Structures Irregular Molecule: Ribosomal Protein L15; Chain: K; domain 1 Molecule: Ribosomal Protein L15; Chain: K; domain 1 3cclL01
1VQ4L 3I55L 3CXCN 3OW2N 1KD1M 3CPWN 3CCML 3CCQL 2OTLO 2QEXO 1M1KM 1KQSN 1YJNO 1VQ5O 3CCSL 1QVFN 1VQMO 3CCVO 3G71L 3CMAL 1VQLO 3CCJL 3CC4L 1VQ6O 1W2BN 1YHQO 1YJ9O 1Q81M 3CCLO 1VQ8L 1QVGK 1Q86P 3CC7O 1VQ7O 1Q7YM 1VQOO 1KC8P 1N8RP 1S72L 1NJIM 1M90P 3CMEO 3G4SO 2OTLL 1VQPO 2QEXL 1K9MP 3CCEL 2OTJO 1K73P 1K8AP 3I56L 1YJNL 1YJWL 1VQ5L 1VQML 3G6EO 1JJ2K 1K9MM 1VQKL 3CCUO 3CC7L 1VQNL 1VQ9O 1VQ7L 3CC2L 3I55O 1YI2O 1Q82P 1W2BK 1Q86M 3CXCK 1Q82M 1KC8M 3OW2K 1N8RM 3CCRO 3CCVL 3G71O 3CMAO 1M90M 1VQLL 3CPWK 1KD1P 1YIJO 3CD6O 3CC4O 1K73M 1K8AM 1VQ6L 3CCUL 1YHQL 1YJ9L 3CCLL 1KQSK 1M1KP 1YITO 1QVFK 1YI2L 1VQOL 2QA4O 1VQ4O 1S72O 1JJ2N 3CMEL 3G4SL 3CCMO 3CCQO 1VQPL 3CCEO 2OTJL 3I56O 1YJWO 1Q81P 1QVGN 3CCSO 3CCRL 1Q7YP 3G6EL 1YIJL 3CD6L 1NJIP 3CCJO 1VQKO 1YITL 1VQNO 1VQ9L 1VQ8O 3CC2O 2QA4L
chains in the Genus database with same CATH superfamily
1VQ4L 3I55L 3CXCN 3OW2N 1KD1M 3CPWN 3GODA 3CCML 3CCQL 2OTLO 2QEXO 1M1KM 1KQSN 4N06A 1YJNO 1VQ5O 3CCSL 1QVFN 1VQMO 3CCVO 3G71L 3CMAL 1VQLO 5DLJA 3CCJL 3CC4L 1VQ6O 1W2BN 1YHQO 1YJ9O 1Q81M 3CCLO 1VQ8L 4P6IC 1QVGK 1Q86P 3CC7O 1VQ7O 1Q7YM 1VQOO 1KC8P 1N8RP 1S72L 5DQTA 1NJIM 3NKDA 3CMEO 1M90P 3G4SO 2OTLL 1VQPO 5DS5A 2QEXL 1K9MP 3CCEL 5DS4A 1K73P 2OTJO 1K8AP 3I56L 1YJNL 1YJWL 1VQ5L 1VQML 3G6EO 1JJ2K 1K9MM 1VQKL 3CCUO 3CC7L 1VQNL 1VQ9O 1VQ7L 4QDLA 3CC2L 3I55O 1YI2O 1Q82P 1W2BK 1Q86M 5FCLA 3CXCK 1Q82M 1KC8M 4XTKA 3OW2K 1N8RM 3CCRO 3CCVL 3G71O 3CMAO 1M90M 1VQLL 3CPWK 1KD1P 1YIJO 3CD6O 3CC4O 1K73M 1K8AM 1VQ6L 3CCUL 1YHQL 1YJ9L 2YZSA 3CCLL 1KQSK 5DS6A 1M1KP 1YITO 1QVFK 1YI2L 1VQOL 2QA4O 1VQ4O 1S72O 1JJ2N 3CMEL 4WJ0A 3G4SL 3CCMO 3CCQO 1VQPL 3CCEO 2OTJL 3I56O 1YJWO 1Q81P 1QVGN 3CCSO 3CCRL 1Q7YP 3G6EL 5DQZA 1YIJL 3CD6L 1NJIP 3CCJO 1VQKO 4W8KA 1YITL 1VQNO 1VQ9L 1VQ8O 3CC2O 2QA4L
chains in the Genus database with same CATH topology
1VQ4L 3I55L 3CXCN 3OW2N 1KD1M 3CPWN 3GODA 3CCML 3CCQL 2OTLO 2QEXO 1M1KM 1KQSN 4N06A 1YJNO 1VQ5O 3CCSL 1QVFN 1VQMO 3CCVO 3G71L 3CMAL 1VQLO 5DLJA 3CCJL 3CC4L 1VQ6O 1W2BN 1YHQO 1YJ9O 1Q81M 3CCLO 1VQ8L 4P6IC 1QVGK 1Q86P 3CC7O 1VQ7O 1Q7YM 1VQOO 1KC8P 1N8RP 1S72L 5DQTA 1NJIM 3NKDA 3CMEO 1M90P 3G4SO 2OTLL 1VQPO 5DS5A 2QEXL 1K9MP 3CCEL 5DS4A 1K73P 2OTJO 1K8AP 3I56L 1YJNL 1YJWL 1VQ5L 1VQML 3G6EO 1JJ2K 1K9MM 1VQKL 3CCUO 3CC7L 1VQNL 1VQ9O 1VQ7L 4QDLA 3CC2L 3I55O 1YI2O 1Q82P 1W2BK 1Q86M 5FCLA 3CXCK 1Q82M 1KC8M 4XTKA 3OW2K 1N8RM 3CCRO 3CCVL 3G71O 3CMAO 1M90M 1VQLL 3CPWK 1KD1P 1YIJO 3CD6O 3CC4O 1K73M 1K8AM 1VQ6L 3CCUL 1YHQL 1YJ9L 2YZSA 3CCLL 1KQSK 5DS6A 1M1KP 1YITO 1QVFK 1YI2L 1VQOL 2QA4O 1VQ4O 1S72O 1JJ2N 3CMEL 4WJ0A 3G4SL 3CCMO 3CCQO 1VQPL 3CCEO 2OTJL 3I56O 1YJWO 1Q81P 1QVGN 3CCSO 3CCRL 1Q7YP 3G6EL 5DQZA 1YIJL 3CD6L 1NJIP 3CCJO 1VQKO 4W8KA 1YITL 1VQNO 1VQ9L 1VQ8O 3CC2O 2QA4L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ4 L;  3I55 L;  3CXC N;  3OW2 N;  1KD1 M;  3CPW N;  3CCM L;  3CCQ L;  2OTL O;  2QEX O;  1M1K M;  1KQS N;  1YJN O;  1VQ5 O;  3CCS L;  1QVF N;  1VQM O;  3CCV O;  3G71 L;  3CMA L;  1VQL O;  3CCJ L;  3CC4 L;  1VQ6 O;  1W2B N;  1YHQ O;  1YJ9 O;  1Q81 M;  3CCL O;  1VQ8 L;  1QVG K;  1Q86 P;  3CC7 O;  1VQ7 O;  1Q7Y M;  1VQO O;  1KC8 P;  1N8R P;  1S72 L;  1NJI M;  1M90 P;  3CME O;  3G4S O;  2OTL L;  1VQP O;  2QEX L;  1K9M P;  3CCE L;  2OTJ O;  1K73 P;  1K8A P;  3I56 L;  1YJN L;  1YJW L;  1VQ5 L;  1VQM L;  3G6E O;  1JJ2 K;  1K9M M;  1VQK L;  3CCU O;  3CC7 L;  1VQN L;  1VQ9 O;  1VQ7 L;  3CC2 L;  3I55 O;  1YI2 O;  1Q82 P;  1W2B K;  1Q86 M;  3CXC K;  1Q82 M;  1KC8 M;  3OW2 K;  1N8R M;  3CCR O;  3CCV L;  3G71 O;  3CMA O;  1M90 M;  1VQL L;  3CPW K;  1KD1 P;  1YIJ O;  3CD6 O;  3CC4 O;  1K73 M;  1K8A M;  1VQ6 L;  3CCU L;  1YHQ L;  1YJ9 L;  3CCL L;  1KQS K;  1M1K P;  1YIT O;  1QVF K;  1YI2 L;  1VQO L;  2QA4 O;  1VQ4 O;  1S72 O;  1JJ2 N;  3CME L;  3G4S L;  3CCM O;  3CCQ O;  1VQP L;  3CCE O;  2OTJ L;  3I56 O;  1YJW O;  1Q81 P;  1QVG N;  3CCS O;  3CCR L;  1Q7Y P;  3G6E L;  1YIJ L;  3CD6 L;  1NJI P;  3CCJ O;  1VQK O;  1YIT L;  1VQN O;  1VQ9 L;  1VQ8 O;  3CC2 O;  2QA4 L; 
#chains in the Genus database with same CATH topology
 1VQ4 L;  3I55 L;  3CXC N;  3OW2 N;  1KD1 M;  3CPW N;  3GOD A;  3CCM L;  3CCQ L;  2OTL O;  2QEX O;  1M1K M;  1KQS N;  4N06 A;  1YJN O;  1VQ5 O;  3CCS L;  1QVF N;  1VQM O;  3CCV O;  3G71 L;  3CMA L;  1VQL O;  5DLJ A;  3CCJ L;  3CC4 L;  1VQ6 O;  1W2B N;  1YHQ O;  1YJ9 O;  1Q81 M;  3CCL O;  1VQ8 L;  4P6I C;  1QVG K;  1Q86 P;  3CC7 O;  1VQ7 O;  1Q7Y M;  1VQO O;  1KC8 P;  1N8R P;  1S72 L;  5DQT A;  1NJI M;  3NKD A;  3CME O;  1M90 P;  3G4S O;  2OTL L;  1VQP O;  5DS5 A;  2QEX L;  1K9M P;  3CCE L;  5DS4 A;  1K73 P;  2OTJ O;  1K8A P;  3I56 L;  1YJN L;  1YJW L;  1VQ5 L;  1VQM L;  3G6E O;  1JJ2 K;  1K9M M;  1VQK L;  3CCU O;  3CC7 L;  1VQN L;  1VQ9 O;  1VQ7 L;  4QDL A;  3CC2 L;  3I55 O;  1YI2 O;  1Q82 P;  1W2B K;  1Q86 M;  5FCL A;  3CXC K;  1Q82 M;  1KC8 M;  4XTK A;  3OW2 K;  1N8R M;  3CCR O;  3CCV L;  3G71 O;  3CMA O;  1M90 M;  1VQL L;  3CPW K;  1KD1 P;  1YIJ O;  3CD6 O;  3CC4 O;  1K73 M;  1K8A M;  1VQ6 L;  3CCU L;  1YHQ L;  1YJ9 L;  2YZS A;  3CCL L;  1KQS K;  5DS6 A;  1M1K P;  1YIT O;  1QVF K;  1YI2 L;  1VQO L;  2QA4 O;  1VQ4 O;  1S72 O;  1JJ2 N;  3CME L;  4WJ0 A;  3G4S L;  3CCM O;  3CCQ O;  1VQP L;  3CCE O;  2OTJ L;  3I56 O;  1YJW O;  1Q81 P;  1QVG N;  3CCS O;  3CCR L;  1Q7Y P;  3G6E L;  5DQZ A;  1YIJ L;  3CD6 L;  1NJI P;  3CCJ O;  1VQK O;  4W8K A;  1YIT L;  1VQN O;  1VQ9 L;  1VQ8 O;  3CC2 O;  2QA4 L; 
#chains in the Genus database with same CATH homology
 1VQ4 L;  3I55 L;  3CXC N;  3OW2 N;  1KD1 M;  3CPW N;  3GOD A;  3CCM L;  3CCQ L;  2OTL O;  2QEX O;  1M1K M;  1KQS N;  4N06 A;  1YJN O;  1VQ5 O;  3CCS L;  1QVF N;  1VQM O;  3CCV O;  3G71 L;  3CMA L;  1VQL O;  5DLJ A;  3CCJ L;  3CC4 L;  1VQ6 O;  1W2B N;  1YHQ O;  1YJ9 O;  1Q81 M;  3CCL O;  1VQ8 L;  4P6I C;  1QVG K;  1Q86 P;  3CC7 O;  1VQ7 O;  1Q7Y M;  1VQO O;  1KC8 P;  1N8R P;  1S72 L;  5DQT A;  1NJI M;  3NKD A;  3CME O;  1M90 P;  3G4S O;  2OTL L;  1VQP O;  5DS5 A;  2QEX L;  1K9M P;  3CCE L;  5DS4 A;  1K73 P;  2OTJ O;  1K8A P;  3I56 L;  1YJN L;  1YJW L;  1VQ5 L;  1VQM L;  3G6E O;  1JJ2 K;  1K9M M;  1VQK L;  3CCU O;  3CC7 L;  1VQN L;  1VQ9 O;  1VQ7 L;  4QDL A;  3CC2 L;  3I55 O;  1YI2 O;  1Q82 P;  1W2B K;  1Q86 M;  5FCL A;  3CXC K;  1Q82 M;  1KC8 M;  4XTK A;  3OW2 K;  1N8R M;  3CCR O;  3CCV L;  3G71 O;  3CMA O;  1M90 M;  1VQL L;  3CPW K;  1KD1 P;  1YIJ O;  3CD6 O;  3CC4 O;  1K73 M;  1K8A M;  1VQ6 L;  3CCU L;  1YHQ L;  1YJ9 L;  2YZS A;  3CCL L;  1KQS K;  5DS6 A;  1M1K P;  1YIT O;  1QVF K;  1YI2 L;  1VQO L;  2QA4 O;  1VQ4 O;  1S72 O;  1JJ2 N;  3CME L;  4WJ0 A;  3G4S L;  3CCM O;  3CCQ O;  1VQP L;  3CCE O;  2OTJ L;  3I56 O;  1YJW O;  1Q81 P;  1QVG N;  3CCS O;  3CCR L;  1Q7Y P;  3G6E L;  5DQZ A;  1YIJ L;  3CD6 L;  1NJI P;  3CCJ O;  1VQK O;  4W8K A;  1YIT L;  1VQN O;  1VQ9 L;  1VQ8 O;  3CC2 O;  2QA4 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...