3CCLQ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535c. density for anisomycin is visible but not included in model.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 20
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3cclQ00
1VQLQ 3CCUQ 1NJIR 1YJ9Q 3I56Q 1QVGP 3CPWP 1YHQQ 1W2BP 3I55Q 1VQ7Q 3G6EQ 1VQNQ 3CMEQ 1QVFP 3CCVQ 1VQ6Q 3CC7Q 1VQOQ 3CD6Q 3CCMQ 1YJWQ 1KQSP 1KC8R 1Q82R 3CCSQ 3CCQQ 3CCRQ 1Q86R 1Q81R 1YITQ 3CCLQ 3OW2P 1YIJQ 1VQ9Q 1S72Q 2OTLQ 3CXCP 1YJNQ 1N8RR 3CC2Q 3CCEQ 3G71Q 3CCJQ 1VQKQ 2OTJQ 2QA4Q 1K73R 3CC4Q 1Q7YR 1M90R 1KD1R 1M1KR 1K8AR 1YI2Q 1VQMQ 2QEXQ 1K9MR 1VQPQ 3CMAQ 1VQ8Q 3G4SQ 1VQ4Q 1VQ5Q 1JJ2P
chains in the Genus database with same CATH superfamily
1YNZA 1ACMB 4PL6A 4KT0E 1UHCA 2HSPA 4J5YA 4RKUE 1VQ6T 1BBZA 5I2SA 3L2VA 2HCKA 3CCQA 2K7AA 1UFFA 5FU6C 4OMPA 5GANe 3LYIA 2RH2A 3S3MA 2JJ9A 2MWPA 4FW1A 2E6ZA 1PD0A 4LE9A 1K0SA 5I22A 3CCST 4NL2A 3V7RA 4J7IA 2M0OA 2QTVA 1IO6A 3OYIA 1PC0A 1WI7A 2QK0A 3CCEA 3RERA 2DILA 1GXIE 1J3TA 3JSCA 1Y96B 4XU3A 4FM4B 3JB9G 4JS5A 2CUBA 1VQLA 4RTZA 1G3TA 3CCUT 1GFCA 4MDXA 3G6EA 3CCVA 3I55Q 1UGRB 3V7CA 3M0RA 4BE0A 3WVDB 1D0ZA 3H0FA 1NBEB 4PFPA 1E6GA 1PSFA 1XQHA 5HK3A 3GPLA 1ABOA 1KQSA 1I1JA 4XU2A 2C0TA 2EYQA 3IQLA 1D0XA 2FHDA 2QI2A 2Y90A 2IIMA 3QWXX 3OBWA 5LJ5e 3BDLA 2MI6A 4M7DA 4OB2B 2ZZDA 2JW4A 4M77E 3HKSA 2E65A 1SG5A 4RTXA 3G71Q 4D8KA 3JCMd 1M5Q1 1K8AR 3HPWA 2V8JA 3M53A 1A0NB 3CEYA 2G6FX 2HDAA 3ASKA 2X4XA 3OYYA 4M75B 2XU8A 2LT4A 1WXBA 3CCQT 2ATCB 2EIFA 2X4JA 4C5IA 2XDBA 2L3SA 1K73U 1M2VB 4EMKC 1QVFA 3QYHB 5CIUA 1SKUB 4BE1A 2X4WA 3JB9D 1VQ5A 2DD5A 1K73C 2EQUA 1X69A 5CO7A 2DPPB 5CKHA 3SWNA 1IHVA 2QTXA 4RMOA 1LCKA 3MEUA 2FRYA 2Z0WA 2K5FA 4PJOF 3A8OB 4DA4A 1FXXA 1MMNA 1AWWA 4M77D 1VQKA 2QA4A 2EVRA 1KFZA 2BZ8A 3FC3A 3CC4A 1PG5B 2EGEA 2WSCE 5FWBA 2PZ1A 2M16A 2L89A 2QQBA 4PNOA 2YT6A 1UTIA 4QVZA 1FWZA 4XQ3A 5LJ3e 2YSQA 1OZ2A 2R5AA 1KQSP 2YUOA 2MF2A 1QVGS 1I0CA 2OTLA 1SEMA 1YBYA 2LRQA 3CCLQ 2KRNA 5GMKl 3OYCA 2OAUA 2I0NA 1JRIA 2KQWA 1RL2A 3SDZA 5CAIA 4AMCA 3GP8A 4QVCA 2EGCA 2CP2A 4AG2C 2HD0A 5CKFA 1PKTA 4ELZC 3CD6Q 2V8KA 2RJDA 2CZ0B 2IG0A 3A98A 1WNLA 4ANJA 1IXDA 5IH2A 4FT4A 1BB9A 4HCBA 1R8OB 1KIKA 4KUIA 1WPYA 1VA7A 2G3RA 2GTOA 4LDXA 1WQWA 1X2KA 2HEQA 2RQRA 1VQ4A 2AKLA 1ZSGA 1VQNT 1ZUKA 1Y96A 3JB9J 4FYXB 5GAMg 2XG8D 2LJ1A 4OB1B 1YP5A 1OU9A 3CC2Q 1NEGA 4JRKA 4D8DA 4IIOA 2W0ZA 2KRSA 3I35A 1C6VX 3C0CA 1KQ1A 1OPLA 5CKEA 1UJ0A 3OYBA 4Z89A 4DEXA 1I8FA 4KRTA 3MEVA 4ESRA 2A37A 1S72Q 2DO3A 3X28B 1U06A 4PLLA 2HQHA 2L5QA 2WSEE 1H3HA 5GJVB 4C5GA 1BI0A 3CPWP 1IGUA 2CZ1B 4M7DG 3UWNA 1JQQA 3CCRA 4GLMA 2QQAA 4M75F 2A3LA 1YITA 2RNAA 4M75A 3DKMA 3PMIA 2DRKA 1Z9ZA 4JJCA 2KBTA 2NUTB 2GBQA 2F5KA 1MGQA 4C8QB 3OYLA 3CMAQ 4J9DA 1TG0A 2YWWA 1M2VA 3NTHA 2RO0A 2VUBA 4M4ZA 2E64A 3VV0A 2LCCA 3FIFA 4M7AC 4M7DE 2XK0A 2KGTA 1IHWA 3H0HA 2K3BA 1WHGA 4J9GA 3RKYA 3NTIA 1M3AA 3E9FA 3QSUA 1G5VA 1HXDA 2DA9A 4F7UG 5GAMj 5GAN2 1VQMQ 3KUFA 1UEBA 3VKIA 1M1FA 3JCMe 3JB9I 2YLCA 3X20B 4AG1C 1V29B 4DOVA 4PJOC 1Q82U 1YWPA 3UA7A 2FZCB 3CCMQ 2ZGWA 1FYNA 5I11A 2XI9A 4E7IA 4BI3A 1Q82C 1JJ2A 3L2ZA 2P4RA 4EMKB 1PNJA 1OYXA 1HSQA 1NPRA 2RHIA 3M4YA 1VQ8A 4KUDK 1CSKA 3UA6A 2XD0A 2KI7A 2PUOB 1ZUYA 3LGFA 1NJIR 2AK5A 1M1GA 2ED1A 1MV3A 1SHFA 1K0XA 4M7DD 4WCIA 2K9GA 1RLPC 2CH4W 1K1ZA 3DLMA 1C0MA 3REBB 1M90U 1WQ7A 3JCMW 3EG1A 2DXTA 4QW2A 2KROA 1IREB 1W6XA 2F2VA 1K9MU 4L5GA 4NS5A 4R56A 2AZVA 1M90C 4JRPA 2EYXA 3SHWA 3HTRA 5FU7C 4C92C 1K9MC 1U1SA 1ZQ1A 2EW3A 3RMQA 2DERA 3OQ5A 4Y91A 3VS1A 4FIBA 5KYWB 4Z02A 4BY6C 1WJRA 5C0MA 4IURA 1TU0B 1TUGB 1KD1U 1M1KR 2SRCA 1WHMA 5I21A 1KD1C 2J7IA 4A4GA 3MHXA 5A0LA 3CMET 4A63B 4JJDA 4FSSA 1WFWA 1QKXA 4OVAA 3OSSC 2I2LA 1WX6A 3OS5A 4XTYA 3CBMA 3C12A 4B9WA 2X35A 3OY9A 1AWJA 3H6ZA 4EMHA 2AT1B 1O9SA 3JAME 4OB3B 1JXOA 2CUDA 1VIEA 4BD3A 4F17A 4CRIA 3TQ7P 2L3QA 3SD4A 5D6YA 1KSWA 2RMOA 1BCOA 1VQPA 2VVKA 2QEXQ 3T9NA 4ZGEB 1WJQA 4DOWA 1AZGB 2FRWA 2NUTA 1VQ7Q 3HRSA 4QVDA 4N4IA 1VUBA 1V1CA 1UECA 2E3IA 2LX9A 4IUPA 2D6FA 1YJWQ 4C8QA 1ZSZB 2LDMA 4DBFA 1Q81U 4LUEA 4FU6A 2KEAA 2LZ6B 1VQ9Q 2LQNA 3O8VA 1Q81C 2M51A 4RCCA 3VUBA 1BK2A 3HP9A 5CCAA 1YCSB 3WVEB 4RTWA 3PVQA 4AFQC 3ZFJA 2NUPB 2LQ8A 4M75E 1VQ6Q 1ZA2B 4RTVA 4OMFB 4EPCA 2YUNA 2D1XA 1QWFA 1KQSS 2VASA 2JN0A 5KYYB 2J05A 1X75C 3UPUA 2AHJB 1GCPA 1OI1A 3GIBA 1G2BA 2CDTA 2V1QA 1T0JA 3P8BB 4EMKA 5GANj 4M7AB 4XTVA 1WA7A 4GBQA 1QCOA 5GAOq 4EMGA 3CCSQ 1X2QA 3DLLA 2O9VA 3NPFA 1D1BA 2DVJA 4M78C 2PVOB 1JBMA 3QJYA 1K76A 2OTJA 2V8IA 4QKUA 2ROTA 2C06A 3MP6A 1OX9A 3O5ZA 4JLGA 1WXUA 2DD4A 1YI2Q 5D7UA 4RUGA 1AWOA 2KXDA 2QDLA 3EFSA 5CKBA 1RAIB 3CCUQ 2JUFA 4PJOB 2WSFE 4M75D 1BI3A 3PGGA 2K6DA 1OU8A 4P5NA 2MPXC 5GAMf 1R0BG 1XTDA 2ZPFB 1QVPA 2ENMA 3M54A 2MK5A 1QVFS 1DJ7B 1GL5A 4IUQA 2K79A 1N5ZA 2D8JA 2L2PA 2FB7A 1K73R 2RJEA 3CBOA 3H0IA 5KYWA 4Y28E 4E7KA 1YJ9T 2CP5A 2MWOA 3OYEA 3RMSA 5L23A 2RF0A 1N9SA 4XTZA 4F04B 1BI2A 2B86A 1E6HA 4JJBA 2KR3A 4C0ZA 3PNWC 1IGQA 2PU9B 2LP5A 1YJNT 2JM9A 4L6V5 2D0QB 2M02A 2GQIA 1H641 5FU7B 3EAEA 4C92B 5FW9A 4KH0B 3M4GA 2X3XD 2MIOA 3CCQQ 3R6OA 1P92A 1TUCA 5M9OA 4J8OA 4BY6B 3CPWS 4C0GA 1YIJA 3M55A 3A8GB 1W2BA 1PCXA 3A1PA 1JEGA 1B3QA 4FYWB 3NHNA 1YI2T 2F2WA 1H8KA 3X24B 1OEBA 2E12A 2DX1A 3V8KA 3I55A 2VXEA 3L2UA 2DRMA 1G3YA 2YRCA 1VQOT 4NL3A 4JUVA 4A4HA 1X6BA 4TVRA 2PNIA 4M77G 3EG3A 1NYFA 1R77A 3CCJA 3CCEQ 1ZSZA 4HKEA 3EGUA 2FG0A 2HNIA 3BW1A 4VUBA 1PRLC 3G4ST 4C8QG 2RPNA 2RK1A 3I56A 1YHQT 1SF9A 4QQDA 3QWYA 5IT9E 1M8VA 2K3XA 1QMCA 1VOMA 2NUPA 5GAOm 3MPUB 2CS7A 2LX7A 2HQEA 3PT9A 3G71A 4XK8E 3ZL7C 5IHNA 4PFZA 5ECAA 2DAQA 2GTJA 1Y7XA 2BZXA 1U3OA 3EH1A 3DB4A 3LH5A 4ZTJA 2DFUA 4C8QE 2CH4A 1D0YA 4HCKA 5KYYA 2FZKB 1T3SA 2PQWA 2LVMA 4JRIA 2DIQA 1KC8U 1VYUA 3M0SA 3I9QA 1AHJB 4D6WA 2DMOA 1H3ZA 4JRQA 4M7AF 3JCMc 2XIDA 1KC8C 2PVGB 3QXEB 2CZ6B 1OX8A 4M7AA 5L8RE 4A4EA 1G3WA 2QYZA 2QQ9A 2DZCA 3EFRA 3S3NA 1SRMA 4BI4A 4AFSC 4HCCA 7AT1B 1VQNQ 1RABB 3FB9A 4DBQA 3VRZA 3META 2HSEB 4PJOA 1I5LA 1PRMC 2MCNA 1U1TA 3CCET 2P0QA 1M4ZA 4F7UF 4MDWA 2JT4A 1U5SA 1WLPB 4C8QD 1VQLT 4N4HA 3TCJA 1NLPC 3G6ET 2CKKA 3CCVT 3CPFA 3QJ6A 2EQKA 3VS6A 1OV3A 1KHIA 2VGNA 4FYYB 1C1AA 1M27C 2COYA 4M78B 4O6JA 4X9DA 1B34B 2KYMA 5GAN4 1LJOA 5GAOp 4BDZA 3GOXA 5GAMd 3CC4Q 2XMFA 3FLGA 5GMKj 1WJSA 2DYBA 5J39A 1JO8A 1EFNA 5IAYA 4ME7A 2ROLA 3C4SA 4PJNA 1UG1A 3QDRB 3CD6A 3EGXB 2EQJA 4C92F 3QIIA 1Q82R 2DETA 2P0PA 4C92A 1TOVA 3AT1B 1AZEA 1VIFA 1MHNA 4X1VA 2VGMA 1Y07A 1E7OA 3G1JA 3JCMP 1JB0E 4J6YA 4OGEA 4XU0A 4OMMA 1NYGA 5GMKh 2K2MA 1XNIA 1S1NA 4OMNA 3N5BB 5GJWB 4E7HA 2CP7A 1Z9QA 3OMGA 1QVFP 2YUQA 4ZN3A 3LX7A 1RAAB 2DLPA 2GF7A 4KULA 5FU6B 4Z8AA 2RM4A 8ATCB 1GCQC 2DYIA 3CC2A 1FMWA 1QW1A 2DXCA 3I5SA 2MAMA 2RA2A 1M90R 2GGRA 2DL3A 2DL4A 3OSVA 1K9MR 8AT1B 2SEMA 1VQ4Q 1VQ5T 2ED0A 5KYNA 2H8HA 4MMKA 4A53A 3HHTB 2DTOA 3OYNA 4OF1A 5CQXA 1HK9A 3MO8A 1KK7A 1Q86U 4NOYA 2OX7A 2F5TX 1MV0B 1S72A 4CC4B 1Q86C 3A8LB 1K8AU 1K9AA 1VQKT 2QA4T 3RKWA 3LLRA 3RESA 3CC4T 1KD1R 2DK3A 2ZPIB 2NLUA 1TUDA 1K8AC 4AFUC 3NTKA 1KG1A 2RQUA 2VXFA 3PE0A 1GBQA 5FLXE 4HA8A 3OB9A 2RHZA 2PVDB 1QLYA 3E9GA 2OTLT 2FVUA 1BI1A 5CR2A 2R58A 5D6WA 2KNBB 3QZ9B 3CMAA 2AIRB 2EQIA 3H8ZA 2E10A 2E5KA 2DTHA 4IUVA 3VJPA 3INZA 4CC2A 4JS4A 1TS9A 3PTAA 5FRNA 4N0AC 5HCKA 1V76A 1ABQA 5GAOl 2DM1A 3OA6A 5GAOr 1X43A 2EJGA 2D8HA 2QDYB 1U8RA 2QAZA 1VQMA 1ZBJA 2X4YA 1GBRA 1M3BA 2KMTA 1VQ4T 2BE9B 2ZPHB 1RLQC 3CMEQ 3QPHA 3CCMA 3CXCA 5I2MA 2FYKA 2JXBA 4M7AE 4QQ6A 4MZMA 4XTUA 2C0IA 2NUZA 1Q81R 3OYMA 3L2RA 1IRXA 1SRLA 2DL5A 4OMLA 1QVGA 3C95A 2KK4A 2BTTA 4M78F 1N9RA 3TU4K 2DXBA 4JPBW 2KYBA 5GAMh 1HYOA 4M78A 4PJMA 1B34A 5J26A 4B6MA 4PJOE 4OGCA 3WXMB 2BE7D 2O4XB 4OP0A 3SB2A 2MYSA 1NLOC 2DJZA 2KT8A 2RN8A 2EBPA 3EGXA 2LJ0A 3V7SA 4HVVA 3NMZC 2ZPGB 2ZCFB 1QP2A 2O31A 1EIFA 2DBMA 1G3SA 3P8DA 1I81A 2QG9B 3EH2A 5GANd 4B9XA 2DEQA 2Y4YA 4Z88A 2H3JA 3RBBB 3CCRT 4WTOB 1R0CB 3EFOB 1YITT 2LMJA 4J6WA 2KSSA 4KH1B 4LDWA 4JZ4A 1D1CA 3BE3A 4CC3A 3L1AA 3ME9A 1MNDA 3BY7A 2XDPA 5GAMe 2M1HA 4C92E 3KXTA 4PJOD 2KE9A 2P0KA 3L2QA 2HKNA 1UDLA 5KYUB 3JCMV 2K4YA 4QT7A 3CXCP 5KCOA 3VS3A 2CGHA 4RG8A 2XKOC 2CP3A 4C5HA 5DLOA 5GANg 1GRIA 2E70A 1SSFA 2P84A 1JJ2P 2EJ9A 3FDRA 3CC7A 1H92A 2E1HA 3VS2A 1QCNA 3D7SB 1G83A 2BIVA 2X3WD 1RADB 2HKQB 2MMPA 5A0GA 1ZLMA 2QEXA 1UB4A 2GFUA 1VQ8T 3QZ5B 2LT1A 4MMLA 1M9SA 1VQ7A 3JB9F 1QQJA 1CKAA 4C92D 1T0HA 4M75G 1YJWA 3KBGA 4J6XA 4LD6A 4HT8A 3JCMJ 1UHFA 4DQ2A 2O01E 2GNCA 1PD1A 3OYGA 1W2BS 3VS5A 1VQ9A 1IB8A 1ZBXA 2HBWA 5GMKi 5CKDA 4M77F 3FJPA 5DLQE 1D3BB 3SFMA 1YJ9Q 5CK9A 1B07A 1VQ6A 1SPKA 4FW2A 3QBYA 4K11A 2RHXA 2DTIA 1BCMA 3VYHB 1WHJA 5IHIA 3TSWA 3OS2A 2E5QA 1YFNA 1OULA 2V26A 2FZGB 2L3RA 1YJNQ 2LTOA 5IN1A 5LJ5g 2RHUA 4O5VA 3JCMX 3UT1A 1Y57A 1G8XA 3TVTA 1TSFA 1LPLA 5KE3A 2JMAA 3CBPA 1WDXA 3OYHA 1HJDA 1NJIC 3A5ZB 3CCSA 4CI0C 2EYWA 2QXFA 2E3HA 1SSHA 3RKXA 1M3CA 2E6NA 3MP1A 4JJNK 4XAXB 3M0QA 1Y71A 3EHQA 4PFOA 3NFCA 3CCUA 2O88A 4AT1B 1M2OA 2RI3A 3OW2A 4R0KA 1VQOQ 2RQTA 1KC8R 5GANh 2DBKA 1QP3A 1N27A 4F7UB 4M78E 1OQKA 1ZHIA 3TSZA 2VB6A 3EFOA 1VQPT 4BB7A 3G4SQ 2YUPA 2K2VA 4RCBA 1B7TA 3SEMA 4A4FA 1YHQQ 3HRTA 3J7AF 2W10A 4KGZB 5CVIA 2JTMA 4GLKA 5LJ3g 1UGQB 5AYFA 1D09B 5A0DA 5KYUA 5GAN8 5KE2A 1QCFA 4L59A 1I4K1 2KRMA 1SHGA 3LWHA 2JM8A 3MKDA 1EZZB 2GFAA 3X26B 2L0AA 4N4GA 2Y4XA 1OZ3A 2CSQA 5LJ5j 3RDVA 3OMCA 2CZ7B 3OYDA 3LW5E 4RG2A 2EFIA 2KVQG 4J9HA 2RI2A 4M78D 3L42A 4RTTA 1TTHB 2AZSA 2FO0A 1BIBA 2JZ2A 2EAYA 1GCQA 5FRMA 3RR6A 2OJ2A 4E6RA 4OMQA 3PVLA 2CREA 4FSXA 5LJ5h 3H9NA 5LL6S 4RTUA 2DVEA 1GFDA 2HL3A 3M5AA 3J80E 2CP0A 3OW2P 1YIJQ 4LN2A 1MMGA 2OTJT 1Q7YU 2LJ3A 2NYSA 3M0TA 3X25B 1MMDA 4PJJA 5HY6A 1Q7YC 1VQLQ 3RUXA 5GAN5 4ORZA 3ER0A 3UDCA 3G6EQ 1KJWA 3CCVQ 5J3BA 3OS0A 1D3BA 1MNEA 3M58A 2GCXA 1VYVA 1N8RU 2E4HA 4HVUA 4M77C 3JB9H 3CCJQ 3M0PA 1RAGB 1N8RC 5LJ3j 4C8QC 2LC4A 3EG0A 2JNGA 3NGPA 3I56Q 4XTWA 2MOXA 1IZ6A 4LDVA 3FJ5A 4MZTA 3BFMA 3MP8A 4M7DF 2FPDA 1Q86R 3VS7A 1D1AA 4N0AA 4ELYC 2VV5A 4LUDA 2E41A 5IHKA 2ABLA 2DXUA 4A54A 4CC7A 2HZYA 2D9TA 3GNFB 5LJ3h 4C0DC 1VQNA 3GF5A 2RJCA 3HFOA 1W2BP 3E1SA 1EX4A 1LNXA 3UF4A 1FX7A 3JCMQ 5EC7A 4X34A 1KHCA 3M59A 2DL8A 4ZN1A 4J9FA 1YIJT 1Y0MA 2HBPA 3QUIA 2DKGA 1ZX6A 2L3PA 2CYZB 4F7UA 4JLIA 2HL5C 2FPEA 1VQ5Q 3I55T 3TEEA 2PTKA 3PIPA 3JCMg 3GNGA 5KYXB 2ZPBB 5IXFA 3OYAA 2DIGA 3C94A 3CCLA 1WGSA 5GAN7 4OB0B 4FCYA 1VQKQ 3CCJT 2QA4Q 5GAN6 5GANf 3VYGA 2BUDA 2DJQA 3CXCS 3I56T 3LGLA 1M8MA 4PK4A 2RHYA 5C6SA 2R57A 4ZGJB 2EJFA 4AFZC 2EKHA 1JJ2S 2GQVA 3A8MB 1O75A 2YLBA 2OTLQ 3REAB 3ZBDA 3CPWA 3G71T 2ZPEB 1I07A 3M0UA 1TXQA 2BKDN 2LQWA 3S6WA 2M9UA 3VU3C 5GAN3 4J9BA 4A4KA 2K57A 1AT1B 4PKCC 2HQXA 5AT1B 5HK0A 1JU5C 2JS2A 2VWFA 2EQMA 2A0FB 1RAEB 3EG2A 3HRUA 2D0NA 2P4TA 2V1RA 4C5EA 1X01A 2QQSA 1PWTA 4LDYA 1X6GA 5KH6A 5KCHA 4IKFA 3HFNA 4FL6A 2L8DA 2ESWA 5LJ5f 3THKA 3MJXA 4QQGA 1NPPA 3VS4A 1WHLA 1ZUUA 1T3LA 2OAWA 5GMKe 2VC8A 4OMOA 2LNHB 4WF2A 4V2SA 1ZSZC 3OS1A 9ATCB 3AHUA 3RNJA 2KXCA 2VYTA 4E7SA 1XJWB 3CCLT 1UGPB 3EGDB 5EG2A 1QWEA 3UATA 4F14A 3JCMh 3QG1A 1ARKA 5HKCA 2KY9A 5FROA 1NEBA 3CD6T 3MEWA 2DZ9A 4M7DC 4M7AG 3HSBA 4ZGDB 3EG9B 3CCRQ 1WZOA 1YITQ 4M77B 4J9CA 3L2WA 2LCSA 2QGFB 3I5RA 4XTXA 2RB6A 2RD1A 3GBQA 4MZPA 3S3OA 1RI9A 1RI0A 4J9IA 5A2QE 4J7FA 2F69A 3GLXA 3CMEA 2R5MA 4PJOG 4HT9A 2J6FA 3OYFA 1N6AA 2JS0A 1QKWA 5LJ3f 1WHHA 3U23A 5KYXA 3CC2T 2CT3A 3J81E 2AKKA 2EPDA 3F70A 2H3EB 3SWNC 3OYJA 4LNPA 1AOJA 2F1LA 4C0DB 4DBHA 4Q5WA 4X9CA 3MCAB 2K5LA 3LH0A 3LWIA 2CSIA 4HXJA 2RQWA 2O2OA 1AVZC 2YXYA 2QGGA 1W1FA 1M30A 1S72T 3KFVA 3JV3A 4F7UE 1CKBA 2CT4A 1UJYA 2EGAA 1NZ9A 1VQ8Q 4J83A 2QASA 1UGVA 2DNUA 4C92G 2FL7A 2K3YA 4LXCA 1W4SA 1YN8A 2YRVA 3A8HB 2WACA 2J6OA 2ZAEA 1TH7A 4M7AD 3VRYA 4LDUA 5DM7R 2LQKA 4J9EA 2KDSA 4ZTFA 1VYTA 1WHKA 4E2FB 1PSEA 3CMAT 2J6KA 2CP6A 3OW2S 1X6OA 2LNVA 2RQVA 2KAFA 1RAFB 2X51A 3M57A 3QYGB 2LCLA 4IUTA 2XHCA 3PFSA 3JCMb 3H41A 2IVWA 2VKNA 1VQMT 1XOVA 3BDUA 4UC4A 4ZNXA 4BDYA 2BZYA 1JXMA 4ATOA 5D6XA 1MUZA 3G7ZA 2DEUA 2PUKB 4R55A 1QVGP 2A36A 3CCMT 2RJFA 1BU1A 4GY5A 4BE2A 4KBMB 3QKJA 1NG2A 2B8AA 2QQRA 4BACA 2EWNA 2RI5A 4EIKA 3OBYA 3EGDA 1BYMA 5LJ5d 2JTFA 2K5IA 2EYYA 4YTLA 3CC7Q 2ECZA 4KGXB 2X9HA 4BI8B 3HL8A 3RIRA 3FRNA 3V8JA 3M56A 3MEAA 1NE8A 3EG9A 3TREA 4JZ3A 1BKBA 2O9SA 3EHRA 3PMTA 1RUWA 3E2UA 4PLIA 1VQPQ 4M77A 1UE9A 2JOYA 5FWCA 1YJ9A 1YCYA 4C8QF 1WIEA 4M75C 1PHTA 1W70A 2JTEA 4PJLA 4HCZA 3JCMf 1BIAA 2JVVA 4EDUA 1I5OB 1YJNA 2F2XA 3QO3A 4FYVB 1Q7YR 1PKSA 2FPFA 1OOTA 2J06A 2KT1A 3VS0A 1NJIU 2EKOA 2XDDA 2RK2A 3JRZA 2IPOB 4M7DB 4E7JA 2M0YA 4DEYA 4E47A 1LOJA 3CQTA 1AWXA 2A7YA 4C0FA 1TWBA 1FMVA 1X27A 2YDLA 4M78G 4RTYA 4IUUA 6AT1B 1N8RR 2O4XA 3DB3A 2YRDA 2COWA 4XU1A 3P8HA 4HVWA 1YI2A 1KQ2A 1LVKA 2XICA 1UUEA 2NWMA 5CQYA 2HAXA 1ZA1B 5LJ3d 1RAHB 3PIOA 2OI3A 3Q1JA 4DBRA 3URGA 5GAOn 4II1A 1VQOA 1YWOA 4IIMA 3CC7T 2A28A 3E19A 3QDFA 1AD5A 2A08A 1K4US 1FMKA 2HMAA 3V8LA 5IXBA 4JDSA 2FEIA 3ULRB 2OTJQ 1M1KU 2DF6A 3SWNB 1UGSB 5GMKm 3FEOA 2DL7A 2QEXT 3G4SA 2JMCA 4FT2A 1M1KC 1YHQA 1PM3A 1NM7A 1HD3A 3R6NA 3QHSA 1VQ7T 2YHTA 4KGVB 4BUGA 1F1BB 1MMAA 4LD9K 3M9QA 2COZA 1YJWT 1AEYA 4E7ZA 4E7LA 1Q95G 2DE0X 1RACB 1VQ9T 1WYXA 5DY9A 4F16A 3OYKA 2C0OA 3ZEHA 3VUZA 1WXTA 1OPKA 2EYZA 4Y92A
chains in the Genus database with same CATH topology
1VQLQ 3CCUQ 1NJIR 1YJ9Q 3I56Q 1QVGP 3CPWP 1YHQQ 1W2BP 3I55Q 1VQ7Q 3G6EQ 1VQNQ 3CMEQ 1QVFP 3CCVQ 1VQ6Q 3CC7Q 1VQOQ 3CD6Q 3CCMQ 1YJWQ 1KQSP 1KC8R 1Q82R 3CCSQ 3CCQQ 3CCRQ 1Q86R 1Q81R 1YITQ 3CCLQ 3OW2P 1YIJQ 1VQ9Q 1S72Q 2OTLQ 3CXCP 1YJNQ 1N8RR 3CC2Q 3CCEQ 3G71Q 3CCJQ 1VQKQ 2OTJQ 2QA4Q 1K73R 3CC4Q 1Q7YR 1M90R 1KD1R 1M1KR 1K8AR 1YI2Q 1VQMQ 2QEXQ 1K9MR 1VQPQ 3CMAQ 1VQ8Q 3G4SQ 1VQ4Q 1VQ5Q 1JJ2P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQL Q;  3CCU Q;  1NJI R;  1YJ9 Q;  3I56 Q;  1QVG P;  3CPW P;  1YHQ Q;  1W2B P;  3I55 Q;  1VQ7 Q;  3G6E Q;  1VQN Q;  3CME Q;  1QVF P;  3CCV Q;  1VQ6 Q;  3CC7 Q;  1VQO Q;  3CD6 Q;  3CCM Q;  1YJW Q;  1KQS P;  1KC8 R;  1Q82 R;  3CCS Q;  3CCQ Q;  3CCR Q;  1Q86 R;  1Q81 R;  1YIT Q;  3CCL Q;  3OW2 P;  1YIJ Q;  1VQ9 Q;  1S72 Q;  2OTL Q;  3CXC P;  1YJN Q;  1N8R R;  3CC2 Q;  3CCE Q;  3G71 Q;  3CCJ Q;  1VQK Q;  2OTJ Q;  2QA4 Q;  1K73 R;  3CC4 Q;  1Q7Y R;  1M90 R;  1KD1 R;  1M1K R;  1K8A R;  1YI2 Q;  1VQM Q;  2QEX Q;  1K9M R;  1VQP Q;  3CMA Q;  1VQ8 Q;  3G4S Q;  1VQ4 Q;  1VQ5 Q;  1JJ2 P; 
#chains in the Genus database with same CATH topology
 1YNZ A;  1ACM B;  4PL6 A;  4KT0 E;  1UHC A;  2HSP A;  4J5Y A;  4RKU E;  1VQ6 T;  1BBZ A;  5I2S A;  3L2V A;  2HCK A;  3CCQ A;  2K7A A;  1UFF A;  5FU6 C;  4OMP A;  5GAN e;  3LYI A;  2RH2 A;  3S3M A;  2JJ9 A;  2MWP A;  4FW1 A;  2E6Z A;  1PD0 A;  4LE9 A;  1K0S A;  5I22 A;  3CCS T;  4NL2 A;  3V7R A;  4J7I A;  2M0O A;  2QTV A;  1IO6 A;  3OYI A;  1PC0 A;  1WI7 A;  2QK0 A;  3CCE A;  3RER A;  2DIL A;  1GXI E;  1J3T A;  3JSC A;  1Y96 B;  4XU3 A;  4FM4 B;  3JB9 G;  4JS5 A;  2CUB A;  1VQL A;  4RTZ A;  1G3T A;  3CCU T;  1GFC A;  4MDX A;  3G6E A;  3CCV A;  3I55 Q;  1UGR B;  3V7C A;  3M0R A;  4BE0 A;  3WVD B;  1D0Z A;  3H0F A;  1NBE B;  4PFP A;  1E6G A;  1PSF A;  1XQH A;  5HK3 A;  3GPL A;  1ABO A;  1KQS A;  1I1J A;  4XU2 A;  2C0T A;  2EYQ A;  3IQL A;  1D0X A;  2FHD A;  2QI2 A;  2Y90 A;  2IIM A;  3QWX X;  3OBW A;  5LJ5 e;  3BDL A;  2MI6 A;  4M7D A;  4OB2 B;  2ZZD A;  2JW4 A;  4M77 E;  3HKS A;  2E65 A;  1SG5 A;  4RTX A;  3G71 Q;  4D8K A;  3JCM d;  1M5Q 1;  1K8A R;  3HPW A;  2V8J A;  3M53 A;  1A0N B;  3CEY A;  2G6F X;  2HDA A;  3ASK A;  2X4X A;  3OYY A;  4M75 B;  2XU8 A;  2LT4 A;  1WXB A;  3CCQ T;  2ATC B;  2EIF A;  2X4J A;  4C5I A;  2XDB A;  2L3S A;  1K73 U;  1M2V B;  4EMK C;  1QVF A;  3QYH B;  5CIU A;  1SKU B;  4BE1 A;  2X4W A;  3JB9 D;  1VQ5 A;  2DD5 A;  1K73 C;  2EQU A;  1X69 A;  5CO7 A;  2DPP B;  5CKH A;  3SWN A;  1IHV A;  2QTX A;  4RMO A;  1LCK A;  3MEU A;  2FRY A;  2Z0W A;  2K5F A;  4PJO F;  3A8O B;  4DA4 A;  1FXX A;  1MMN A;  1AWW A;  4M77 D;  1VQK A;  2QA4 A;  2EVR A;  1KFZ A;  2BZ8 A;  3FC3 A;  3CC4 A;  1PG5 B;  2EGE A;  2WSC E;  5FWB A;  2PZ1 A;  2M16 A;  2L89 A;  2QQB A;  4PNO A;  2YT6 A;  1UTI A;  4QVZ A;  1FWZ A;  4XQ3 A;  5LJ3 e;  2YSQ A;  1OZ2 A;  2R5A A;  1KQS P;  2YUO A;  2MF2 A;  1QVG S;  1I0C A;  2OTL A;  1SEM A;  1YBY A;  2LRQ A;  3CCL Q;  2KRN A;  5GMK l;  3OYC A;  2OAU A;  2I0N A;  1JRI A;  2KQW A;  1RL2 A;  3SDZ A;  5CAI A;  4AMC A;  3GP8 A;  4QVC A;  2EGC A;  2CP2 A;  4AG2 C;  2HD0 A;  5CKF A;  1PKT A;  4ELZ C;  3CD6 Q;  2V8K A;  2RJD A;  2CZ0 B;  2IG0 A;  3A98 A;  1WNL A;  4ANJ A;  1IXD A;  5IH2 A;  4FT4 A;  1BB9 A;  4HCB A;  1R8O B;  1KIK A;  4KUI A;  1WPY A;  1VA7 A;  2G3R A;  2GTO A;  4LDX A;  1WQW A;  1X2K A;  2HEQ A;  2RQR A;  1VQ4 A;  2AKL A;  1ZSG A;  1VQN T;  1ZUK A;  1Y96 A;  3JB9 J;  4FYX B;  5GAM g;  2XG8 D;  2LJ1 A;  4OB1 B;  1YP5 A;  1OU9 A;  3CC2 Q;  1NEG A;  4JRK A;  4D8D A;  4IIO A;  2W0Z A;  2KRS A;  3I35 A;  1C6V X;  3C0C A;  1KQ1 A;  1OPL A;  5CKE A;  1UJ0 A;  3OYB A;  4Z89 A;  4DEX A;  1I8F A;  4KRT A;  3MEV A;  4ESR A;  2A37 A;  1S72 Q;  2DO3 A;  3X28 B;  1U06 A;  4PLL A;  2HQH A;  2L5Q A;  2WSE E;  1H3H A;  5GJV B;  4C5G A;  1BI0 A;  3CPW P;  1IGU A;  2CZ1 B;  4M7D G;  3UWN A;  1JQQ A;  3CCR A;  4GLM A;  2QQA A;  4M75 F;  2A3L A;  1YIT A;  2RNA A;  4M75 A;  3DKM A;  3PMI A;  2DRK A;  1Z9Z A;  4JJC A;  2KBT A;  2NUT B;  2GBQ A;  2F5K A;  1MGQ A;  4C8Q B;  3OYL A;  3CMA Q;  4J9D A;  1TG0 A;  2YWW A;  1M2V A;  3NTH A;  2RO0 A;  2VUB A;  4M4Z A;  2E64 A;  3VV0 A;  2LCC A;  3FIF A;  4M7A C;  4M7D E;  2XK0 A;  2KGT A;  1IHW A;  3H0H A;  2K3B A;  1WHG A;  4J9G A;  3RKY A;  3NTI A;  1M3A A;  3E9F A;  3QSU A;  1G5V A;  1HXD A;  2DA9 A;  4F7U G;  5GAM j;  5GAN 2;  1VQM Q;  3KUF A;  1UEB A;  3VKI A;  1M1F A;  3JCM e;  3JB9 I;  2YLC A;  3X20 B;  4AG1 C;  1V29 B;  4DOV A;  4PJO C;  1Q82 U;  1YWP A;  3UA7 A;  2FZC B;  3CCM Q;  2ZGW A;  1FYN A;  5I11 A;  2XI9 A;  4E7I A;  4BI3 A;  1Q82 C;  1JJ2 A;  3L2Z A;  2P4R A;  4EMK B;  1PNJ A;  1OYX A;  1HSQ A;  1NPR A;  2RHI A;  3M4Y A;  1VQ8 A;  4KUD K;  1CSK A;  3UA6 A;  2XD0 A;  2KI7 A;  2PUO B;  1ZUY A;  3LGF A;  1NJI R;  2AK5 A;  1M1G A;  2ED1 A;  1MV3 A;  1SHF A;  1K0X A;  4M7D D;  4WCI A;  2K9G A;  1RLP C;  2CH4 W;  1K1Z A;  3DLM A;  1C0M A;  3REB B;  1M90 U;  1WQ7 A;  3JCM W;  3EG1 A;  2DXT A;  4QW2 A;  2KRO A;  1IRE B;  1W6X A;  2F2V A;  1K9M U;  4L5G A;  4NS5 A;  4R56 A;  2AZV A;  1M90 C;  4JRP A;  2EYX A;  3SHW A;  3HTR A;  5FU7 C;  4C92 C;  1K9M C;  1U1S A;  1ZQ1 A;  2EW3 A;  3RMQ A;  2DER A;  3OQ5 A;  4Y91 A;  3VS1 A;  4FIB A;  5KYW B;  4Z02 A;  4BY6 C;  1WJR A;  5C0M A;  4IUR A;  1TU0 B;  1TUG B;  1KD1 U;  1M1K R;  2SRC A;  1WHM A;  5I21 A;  1KD1 C;  2J7I A;  4A4G A;  3MHX A;  5A0L A;  3CME T;  4A63 B;  4JJD A;  4FSS A;  1WFW A;  1QKX A;  4OVA A;  3OSS C;  2I2L A;  1WX6 A;  3OS5 A;  4XTY A;  3CBM A;  3C12 A;  4B9W A;  2X35 A;  3OY9 A;  1AWJ A;  3H6Z A;  4EMH A;  2AT1 B;  1O9S A;  3JAM E;  4OB3 B;  1JXO A;  2CUD A;  1VIE A;  4BD3 A;  4F17 A;  4CRI A;  3TQ7 P;  2L3Q A;  3SD4 A;  5D6Y A;  1KSW A;  2RMO A;  1BCO A;  1VQP A;  2VVK A;  2QEX Q;  3T9N A;  4ZGE B;  1WJQ A;  4DOW A;  1AZG B;  2FRW A;  2NUT A;  1VQ7 Q;  3HRS A;  4QVD A;  4N4I A;  1VUB A;  1V1C A;  1UEC A;  2E3I A;  2LX9 A;  4IUP A;  2D6F A;  1YJW Q;  4C8Q A;  1ZSZ B;  2LDM A;  4DBF A;  1Q81 U;  4LUE A;  4FU6 A;  2KEA A;  2LZ6 B;  1VQ9 Q;  2LQN A;  3O8V A;  1Q81 C;  2M51 A;  4RCC A;  3VUB A;  1BK2 A;  3HP9 A;  5CCA A;  1YCS B;  3WVE B;  4RTW A;  3PVQ A;  4AFQ C;  3ZFJ A;  2NUP B;  2LQ8 A;  4M75 E;  1VQ6 Q;  1ZA2 B;  4RTV A;  4OMF B;  4EPC A;  2YUN A;  2D1X A;  1QWF A;  1KQS S;  2VAS A;  2JN0 A;  5KYY B;  2J05 A;  1X75 C;  3UPU A;  2AHJ B;  1GCP A;  1OI1 A;  3GIB A;  1G2B A;  2CDT A;  2V1Q A;  1T0J A;  3P8B B;  4EMK A;  5GAN j;  4M7A B;  4XTV A;  1WA7 A;  4GBQ A;  1QCO A;  5GAO q;  4EMG A;  3CCS Q;  1X2Q A;  3DLL A;  2O9V A;  3NPF A;  1D1B A;  2DVJ A;  4M78 C;  2PVO B;  1JBM A;  3QJY A;  1K76 A;  2OTJ A;  2V8I A;  4QKU A;  2ROT A;  2C06 A;  3MP6 A;  1OX9 A;  3O5Z A;  4JLG A;  1WXU A;  2DD4 A;  1YI2 Q;  5D7U A;  4RUG A;  1AWO A;  2KXD A;  2QDL A;  3EFS A;  5CKB A;  1RAI B;  3CCU Q;  2JUF A;  4PJO B;  2WSF E;  4M75 D;  1BI3 A;  3PGG A;  2K6D A;  1OU8 A;  4P5N A;  2MPX C;  5GAM f;  1R0B G;  1XTD A;  2ZPF B;  1QVP A;  2ENM A;  3M54 A;  2MK5 A;  1QVF S;  1DJ7 B;  1GL5 A;  4IUQ A;  2K79 A;  1N5Z A;  2D8J A;  2L2P A;  2FB7 A;  1K73 R;  2RJE A;  3CBO A;  3H0I A;  5KYW A;  4Y28 E;  4E7K A;  1YJ9 T;  2CP5 A;  2MWO A;  3OYE A;  3RMS A;  5L23 A;  2RF0 A;  1N9S A;  4XTZ A;  4F04 B;  1BI2 A;  2B86 A;  1E6H A;  4JJB A;  2KR3 A;  4C0Z A;  3PNW C;  1IGQ A;  2PU9 B;  2LP5 A;  1YJN T;  2JM9 A;  4L6V 5;  2D0Q B;  2M02 A;  2GQI A;  1H64 1;  5FU7 B;  3EAE A;  4C92 B;  5FW9 A;  4KH0 B;  3M4G A;  2X3X D;  2MIO A;  3CCQ Q;  3R6O A;  1P92 A;  1TUC A;  5M9O A;  4J8O A;  4BY6 B;  3CPW S;  4C0G A;  1YIJ A;  3M55 A;  3A8G B;  1W2B A;  1PCX A;  3A1P A;  1JEG A;  1B3Q A;  4FYW B;  3NHN A;  1YI2 T;  2F2W A;  1H8K A;  3X24 B;  1OEB A;  2E12 A;  2DX1 A;  3V8K A;  3I55 A;  2VXE A;  3L2U A;  2DRM A;  1G3Y A;  2YRC A;  1VQO T;  4NL3 A;  4JUV A;  4A4H A;  1X6B A;  4TVR A;  2PNI A;  4M77 G;  3EG3 A;  1NYF A;  1R77 A;  3CCJ A;  3CCE Q;  1ZSZ A;  4HKE A;  3EGU A;  2FG0 A;  2HNI A;  3BW1 A;  4VUB A;  1PRL C;  3G4S T;  4C8Q G;  2RPN A;  2RK1 A;  3I56 A;  1YHQ T;  1SF9 A;  4QQD A;  3QWY A;  5IT9 E;  1M8V A;  2K3X A;  1QMC A;  1VOM A;  2NUP A;  5GAO m;  3MPU B;  2CS7 A;  2LX7 A;  2HQE A;  3PT9 A;  3G71 A;  4XK8 E;  3ZL7 C;  5IHN A;  4PFZ A;  5ECA A;  2DAQ A;  2GTJ A;  1Y7X A;  2BZX A;  1U3O A;  3EH1 A;  3DB4 A;  3LH5 A;  4ZTJ A;  2DFU A;  4C8Q E;  2CH4 A;  1D0Y A;  4HCK A;  5KYY A;  2FZK B;  1T3S A;  2PQW A;  2LVM A;  4JRI A;  2DIQ A;  1KC8 U;  1VYU A;  3M0S A;  3I9Q A;  1AHJ B;  4D6W A;  2DMO A;  1H3Z A;  4JRQ A;  4M7A F;  3JCM c;  2XID A;  1KC8 C;  2PVG B;  3QXE B;  2CZ6 B;  1OX8 A;  4M7A A;  5L8R E;  4A4E A;  1G3W A;  2QYZ A;  2QQ9 A;  2DZC A;  3EFR A;  3S3N A;  1SRM A;  4BI4 A;  4AFS C;  4HCC A;  7AT1 B;  1VQN Q;  1RAB B;  3FB9 A;  4DBQ A;  3VRZ A;  3MET A;  2HSE B;  4PJO A;  1I5L A;  1PRM C;  2MCN A;  1U1T A;  3CCE T;  2P0Q A;  1M4Z A;  4F7U F;  4MDW A;  2JT4 A;  1U5S A;  1WLP B;  4C8Q D;  1VQL T;  4N4H A;  3TCJ A;  1NLP C;  3G6E T;  2CKK A;  3CCV T;  3CPF A;  3QJ6 A;  2EQK A;  3VS6 A;  1OV3 A;  1KHI A;  2VGN A;  4FYY B;  1C1A A;  1M27 C;  2COY A;  4M78 B;  4O6J A;  4X9D A;  1B34 B;  2KYM A;  5GAN 4;  1LJO A;  5GAO p;  4BDZ A;  3GOX A;  5GAM d;  3CC4 Q;  2XMF A;  3FLG A;  5GMK j;  1WJS A;  2DYB A;  5J39 A;  1JO8 A;  1EFN A;  5IAY A;  4ME7 A;  2ROL A;  3C4S A;  4PJN A;  1UG1 A;  3QDR B;  3CD6 A;  3EGX B;  2EQJ A;  4C92 F;  3QII A;  1Q82 R;  2DET A;  2P0P A;  4C92 A;  1TOV A;  3AT1 B;  1AZE A;  1VIF A;  1MHN A;  4X1V A;  2VGM A;  1Y07 A;  1E7O A;  3G1J A;  3JCM P;  1JB0 E;  4J6Y A;  4OGE A;  4XU0 A;  4OMM A;  1NYG A;  5GMK h;  2K2M A;  1XNI A;  1S1N A;  4OMN A;  3N5B B;  5GJW B;  4E7H A;  2CP7 A;  1Z9Q A;  3OMG A;  1QVF P;  2YUQ A;  4ZN3 A;  3LX7 A;  1RAA B;  2DLP A;  2GF7 A;  4KUL A;  5FU6 B;  4Z8A A;  2RM4 A;  8ATC B;  1GCQ C;  2DYI A;  3CC2 A;  1FMW A;  1QW1 A;  2DXC A;  3I5S A;  2MAM A;  2RA2 A;  1M90 R;  2GGR A;  2DL3 A;  2DL4 A;  3OSV A;  1K9M R;  8AT1 B;  2SEM A;  1VQ4 Q;  1VQ5 T;  2ED0 A;  5KYN A;  2H8H A;  4MMK A;  4A53 A;  3HHT B;  2DTO A;  3OYN A;  4OF1 A;  5CQX A;  1HK9 A;  3MO8 A;  1KK7 A;  1Q86 U;  4NOY A;  2OX7 A;  2F5T X;  1MV0 B;  1S72 A;  4CC4 B;  1Q86 C;  3A8L B;  1K8A U;  1K9A A;  1VQK T;  2QA4 T;  3RKW A;  3LLR A;  3RES A;  3CC4 T;  1KD1 R;  2DK3 A;  2ZPI B;  2NLU A;  1TUD A;  1K8A C;  4AFU C;  3NTK A;  1KG1 A;  2RQU A;  2VXF A;  3PE0 A;  1GBQ A;  5FLX E;  4HA8 A;  3OB9 A;  2RHZ A;  2PVD B;  1QLY A;  3E9G A;  2OTL T;  2FVU A;  1BI1 A;  5CR2 A;  2R58 A;  5D6W A;  2KNB B;  3QZ9 B;  3CMA A;  2AIR B;  2EQI A;  3H8Z A;  2E10 A;  2E5K A;  2DTH A;  4IUV A;  3VJP A;  3INZ A;  4CC2 A;  4JS4 A;  1TS9 A;  3PTA A;  5FRN A;  4N0A C;  5HCK A;  1V76 A;  1ABQ A;  5GAO l;  2DM1 A;  3OA6 A;  5GAO r;  1X43 A;  2EJG A;  2D8H A;  2QDY B;  1U8R A;  2QAZ A;  1VQM A;  1ZBJ A;  2X4Y A;  1GBR A;  1M3B A;  2KMT A;  1VQ4 T;  2BE9 B;  2ZPH B;  1RLQ C;  3CME Q;  3QPH A;  3CCM A;  3CXC A;  5I2M A;  2FYK A;  2JXB A;  4M7A E;  4QQ6 A;  4MZM A;  4XTU A;  2C0I A;  2NUZ A;  1Q81 R;  3OYM A;  3L2R A;  1IRX A;  1SRL A;  2DL5 A;  4OML A;  1QVG A;  3C95 A;  2KK4 A;  2BTT A;  4M78 F;  1N9R A;  3TU4 K;  2DXB A;  4JPB W;  2KYB A;  5GAM h;  1HYO A;  4M78 A;  4PJM A;  1B34 A;  5J26 A;  4B6M A;  4PJO E;  4OGC A;  3WXM B;  2BE7 D;  2O4X B;  4OP0 A;  3SB2 A;  2MYS A;  1NLO C;  2DJZ A;  2KT8 A;  2RN8 A;  2EBP A;  3EGX A;  2LJ0 A;  3V7S A;  4HVV A;  3NMZ C;  2ZPG B;  2ZCF B;  1QP2 A;  2O31 A;  1EIF A;  2DBM A;  1G3S A;  3P8D A;  1I81 A;  2QG9 B;  3EH2 A;  5GAN d;  4B9X A;  2DEQ A;  2Y4Y A;  4Z88 A;  2H3J A;  3RBB B;  3CCR T;  4WTO B;  1R0C B;  3EFO B;  1YIT T;  2LMJ A;  4J6W A;  2KSS A;  4KH1 B;  4LDW A;  4JZ4 A;  1D1C A;  3BE3 A;  4CC3 A;  3L1A A;  3ME9 A;  1MND A;  3BY7 A;  2XDP A;  5GAM e;  2M1H A;  4C92 E;  3KXT A;  4PJO D;  2KE9 A;  2P0K A;  3L2Q A;  2HKN A;  1UDL A;  5KYU B;  3JCM V;  2K4Y A;  4QT7 A;  3CXC P;  5KCO A;  3VS3 A;  2CGH A;  4RG8 A;  2XKO C;  2CP3 A;  4C5H A;  5DLO A;  5GAN g;  1GRI A;  2E70 A;  1SSF A;  2P84 A;  1JJ2 P;  2EJ9 A;  3FDR A;  3CC7 A;  1H92 A;  2E1H A;  3VS2 A;  1QCN A;  3D7S B;  1G83 A;  2BIV A;  2X3W D;  1RAD B;  2HKQ B;  2MMP A;  5A0G A;  1ZLM A;  2QEX A;  1UB4 A;  2GFU A;  1VQ8 T;  3QZ5 B;  2LT1 A;  4MML A;  1M9S A;  1VQ7 A;  3JB9 F;  1QQJ A;  1CKA A;  4C92 D;  1T0H A;  4M75 G;  1YJW A;  3KBG A;  4J6X A;  4LD6 A;  4HT8 A;  3JCM J;  1UHF A;  4DQ2 A;  2O01 E;  2GNC A;  1PD1 A;  3OYG A;  1W2B S;  3VS5 A;  1VQ9 A;  1IB8 A;  1ZBX A;  2HBW A;  5GMK i;  5CKD A;  4M77 F;  3FJP A;  5DLQ E;  1D3B B;  3SFM A;  1YJ9 Q;  5CK9 A;  1B07 A;  1VQ6 A;  1SPK A;  4FW2 A;  3QBY A;  4K11 A;  2RHX A;  2DTI A;  1BCM A;  3VYH B;  1WHJ A;  5IHI A;  3TSW A;  3OS2 A;  2E5Q A;  1YFN A;  1OUL A;  2V26 A;  2FZG B;  2L3R A;  1YJN Q;  2LTO A;  5IN1 A;  5LJ5 g;  2RHU A;  4O5V A;  3JCM X;  3UT1 A;  1Y57 A;  1G8X A;  3TVT A;  1TSF A;  1LPL A;  5KE3 A;  2JMA A;  3CBP A;  1WDX A;  3OYH A;  1HJD A;  1NJI C;  3A5Z B;  3CCS A;  4CI0 C;  2EYW A;  2QXF A;  2E3H A;  1SSH A;  3RKX A;  1M3C A;  2E6N A;  3MP1 A;  4JJN K;  4XAX B;  3M0Q A;  1Y71 A;  3EHQ A;  4PFO A;  3NFC A;  3CCU A;  2O88 A;  4AT1 B;  1M2O A;  2RI3 A;  3OW2 A;  4R0K A;  1VQO Q;  2RQT A;  1KC8 R;  5GAN h;  2DBK A;  1QP3 A;  1N27 A;  4F7U B;  4M78 E;  1OQK A;  1ZHI A;  3TSZ A;  2VB6 A;  3EFO A;  1VQP T;  4BB7 A;  3G4S Q;  2YUP A;  2K2V A;  4RCB A;  1B7T A;  3SEM A;  4A4F A;  1YHQ Q;  3HRT A;  3J7A F;  2W10 A;  4KGZ B;  5CVI A;  2JTM A;  4GLK A;  5LJ3 g;  1UGQ B;  5AYF A;  1D09 B;  5A0D A;  5KYU A;  5GAN 8;  5KE2 A;  1QCF A;  4L59 A;  1I4K 1;  2KRM A;  1SHG A;  3LWH A;  2JM8 A;  3MKD A;  1EZZ B;  2GFA A;  3X26 B;  2L0A A;  4N4G A;  2Y4X A;  1OZ3 A;  2CSQ A;  5LJ5 j;  3RDV A;  3OMC A;  2CZ7 B;  3OYD A;  3LW5 E;  4RG2 A;  2EFI A;  2KVQ G;  4J9H A;  2RI2 A;  4M78 D;  3L42 A;  4RTT A;  1TTH B;  2AZS A;  2FO0 A;  1BIB A;  2JZ2 A;  2EAY A;  1GCQ A;  5FRM A;  3RR6 A;  2OJ2 A;  4E6R A;  4OMQ A;  3PVL A;  2CRE A;  4FSX A;  5LJ5 h;  3H9N A;  5LL6 S;  4RTU A;  2DVE A;  1GFD A;  2HL3 A;  3M5A A;  3J80 E;  2CP0 A;  3OW2 P;  1YIJ Q;  4LN2 A;  1MMG A;  2OTJ T;  1Q7Y U;  2LJ3 A;  2NYS A;  3M0T A;  3X25 B;  1MMD A;  4PJJ A;  5HY6 A;  1Q7Y C;  1VQL Q;  3RUX A;  5GAN 5;  4ORZ A;  3ER0 A;  3UDC A;  3G6E Q;  1KJW A;  3CCV Q;  5J3B A;  3OS0 A;  1D3B A;  1MNE A;  3M58 A;  2GCX A;  1VYV A;  1N8R U;  2E4H A;  4HVU A;  4M77 C;  3JB9 H;  3CCJ Q;  3M0P A;  1RAG B;  1N8R C;  5LJ3 j;  4C8Q C;  2LC4 A;  3EG0 A;  2JNG A;  3NGP A;  3I56 Q;  4XTW A;  2MOX A;  1IZ6 A;  4LDV A;  3FJ5 A;  4MZT A;  3BFM A;  3MP8 A;  4M7D F;  2FPD A;  1Q86 R;  3VS7 A;  1D1A A;  4N0A A;  4ELY C;  2VV5 A;  4LUD A;  2E41 A;  5IHK A;  2ABL A;  2DXU A;  4A54 A;  4CC7 A;  2HZY A;  2D9T A;  3GNF B;  5LJ3 h;  4C0D C;  1VQN A;  3GF5 A;  2RJC A;  3HFO A;  1W2B P;  3E1S A;  1EX4 A;  1LNX A;  3UF4 A;  1FX7 A;  3JCM Q;  5EC7 A;  4X34 A;  1KHC A;  3M59 A;  2DL8 A;  4ZN1 A;  4J9F A;  1YIJ T;  1Y0M A;  2HBP A;  3QUI A;  2DKG A;  1ZX6 A;  2L3P A;  2CYZ B;  4F7U A;  4JLI A;  2HL5 C;  2FPE A;  1VQ5 Q;  3I55 T;  3TEE A;  2PTK A;  3PIP A;  3JCM g;  3GNG A;  5KYX B;  2ZPB B;  5IXF A;  3OYA A;  2DIG A;  3C94 A;  3CCL A;  1WGS A;  5GAN 7;  4OB0 B;  4FCY A;  1VQK Q;  3CCJ T;  2QA4 Q;  5GAN 6;  5GAN f;  3VYG A;  2BUD A;  2DJQ A;  3CXC S;  3I56 T;  3LGL A;  1M8M A;  4PK4 A;  2RHY A;  5C6S A;  2R57 A;  4ZGJ B;  2EJF A;  4AFZ C;  2EKH A;  1JJ2 S;  2GQV A;  3A8M B;  1O75 A;  2YLB A;  2OTL Q;  3REA B;  3ZBD A;  3CPW A;  3G71 T;  2ZPE B;  1I07 A;  3M0U A;  1TXQ A;  2BKD N;  2LQW A;  3S6W A;  2M9U A;  3VU3 C;  5GAN 3;  4J9B A;  4A4K A;  2K57 A;  1AT1 B;  4PKC C;  2HQX A;  5AT1 B;  5HK0 A;  1JU5 C;  2JS2 A;  2VWF A;  2EQM A;  2A0F B;  1RAE B;  3EG2 A;  3HRU A;  2D0N A;  2P4T A;  2V1R A;  4C5E A;  1X01 A;  2QQS A;  1PWT A;  4LDY A;  1X6G A;  5KH6 A;  5KCH A;  4IKF A;  3HFN A;  4FL6 A;  2L8D A;  2ESW A;  5LJ5 f;  3THK A;  3MJX A;  4QQG A;  1NPP A;  3VS4 A;  1WHL A;  1ZUU A;  1T3L A;  2OAW A;  5GMK e;  2VC8 A;  4OMO A;  2LNH B;  4WF2 A;  4V2S A;  1ZSZ C;  3OS1 A;  9ATC B;  3AHU A;  3RNJ A;  2KXC A;  2VYT A;  4E7S A;  1XJW B;  3CCL T;  1UGP B;  3EGD B;  5EG2 A;  1QWE A;  3UAT A;  4F14 A;  3JCM h;  3QG1 A;  1ARK A;  5HKC A;  2KY9 A;  5FRO A;  1NEB A;  3CD6 T;  3MEW A;  2DZ9 A;  4M7D C;  4M7A G;  3HSB A;  4ZGD B;  3EG9 B;  3CCR Q;  1WZO A;  1YIT Q;  4M77 B;  4J9C A;  3L2W A;  2LCS A;  2QGF B;  3I5R A;  4XTX A;  2RB6 A;  2RD1 A;  3GBQ A;  4MZP A;  3S3O A;  1RI9 A;  1RI0 A;  4J9I A;  5A2Q E;  4J7F A;  2F69 A;  3GLX A;  3CME A;  2R5M A;  4PJO G;  4HT9 A;  2J6F A;  3OYF A;  1N6A A;  2JS0 A;  1QKW A;  5LJ3 f;  1WHH A;  3U23 A;  5KYX A;  3CC2 T;  2CT3 A;  3J81 E;  2AKK A;  2EPD A;  3F70 A;  2H3E B;  3SWN C;  3OYJ A;  4LNP A;  1AOJ A;  2F1L A;  4C0D B;  4DBH A;  4Q5W A;  4X9C A;  3MCA B;  2K5L A;  3LH0 A;  3LWI A;  2CSI A;  4HXJ A;  2RQW A;  2O2O A;  1AVZ C;  2YXY A;  2QGG A;  1W1F A;  1M30 A;  1S72 T;  3KFV A;  3JV3 A;  4F7U E;  1CKB A;  2CT4 A;  1UJY A;  2EGA A;  1NZ9 A;  1VQ8 Q;  4J83 A;  2QAS A;  1UGV A;  2DNU A;  4C92 G;  2FL7 A;  2K3Y A;  4LXC A;  1W4S A;  1YN8 A;  2YRV A;  3A8H B;  2WAC A;  2J6O A;  2ZAE A;  1TH7 A;  4M7A D;  3VRY A;  4LDU A;  5DM7 R;  2LQK A;  4J9E A;  2KDS A;  4ZTF A;  1VYT A;  1WHK A;  4E2F B;  1PSE A;  3CMA T;  2J6K A;  2CP6 A;  3OW2 S;  1X6O A;  2LNV A;  2RQV A;  2KAF A;  1RAF B;  2X51 A;  3M57 A;  3QYG B;  2LCL A;  4IUT A;  2XHC A;  3PFS A;  3JCM b;  3H41 A;  2IVW A;  2VKN A;  1VQM T;  1XOV A;  3BDU A;  4UC4 A;  4ZNX A;  4BDY A;  2BZY A;  1JXM A;  4ATO A;  5D6X A;  1MUZ A;  3G7Z A;  2DEU A;  2PUK B;  4R55 A;  1QVG P;  2A36 A;  3CCM T;  2RJF A;  1BU1 A;  4GY5 A;  4BE2 A;  4KBM B;  3QKJ A;  1NG2 A;  2B8A A;  2QQR A;  4BAC A;  2EWN A;  2RI5 A;  4EIK A;  3OBY A;  3EGD A;  1BYM A;  5LJ5 d;  2JTF A;  2K5I A;  2EYY A;  4YTL A;  3CC7 Q;  2ECZ A;  4KGX B;  2X9H A;  4BI8 B;  3HL8 A;  3RIR A;  3FRN A;  3V8J A;  3M56 A;  3MEA A;  1NE8 A;  3EG9 A;  3TRE A;  4JZ3 A;  1BKB A;  2O9S A;  3EHR A;  3PMT A;  1RUW A;  3E2U A;  4PLI A;  1VQP Q;  4M77 A;  1UE9 A;  2JOY A;  5FWC A;  1YJ9 A;  1YCY A;  4C8Q F;  1WIE A;  4M75 C;  1PHT A;  1W70 A;  2JTE A;  4PJL A;  4HCZ A;  3JCM f;  1BIA A;  2JVV A;  4EDU A;  1I5O B;  1YJN A;  2F2X A;  3QO3 A;  4FYV B;  1Q7Y R;  1PKS A;  2FPF A;  1OOT A;  2J06 A;  2KT1 A;  3VS0 A;  1NJI U;  2EKO A;  2XDD A;  2RK2 A;  3JRZ A;  2IPO B;  4M7D B;  4E7J A;  2M0Y A;  4DEY A;  4E47 A;  1LOJ A;  3CQT A;  1AWX A;  2A7Y A;  4C0F A;  1TWB A;  1FMV A;  1X27 A;  2YDL A;  4M78 G;  4RTY A;  4IUU A;  6AT1 B;  1N8R R;  2O4X A;  3DB3 A;  2YRD A;  2COW A;  4XU1 A;  3P8H A;  4HVW A;  1YI2 A;  1KQ2 A;  1LVK A;  2XIC A;  1UUE A;  2NWM A;  5CQY A;  2HAX A;  1ZA1 B;  5LJ3 d;  1RAH B;  3PIO A;  2OI3 A;  3Q1J A;  4DBR A;  3URG A;  5GAO n;  4II1 A;  1VQO A;  1YWO A;  4IIM A;  3CC7 T;  2A28 A;  3E19 A;  3QDF A;  1AD5 A;  2A08 A;  1K4U S;  1FMK A;  2HMA A;  3V8L A;  5IXB A;  4JDS A;  2FEI A;  3ULR B;  2OTJ Q;  1M1K U;  2DF6 A;  3SWN B;  1UGS B;  5GMK m;  3FEO A;  2DL7 A;  2QEX T;  3G4S A;  2JMC A;  4FT2 A;  1M1K C;  1YHQ A;  1PM3 A;  1NM7 A;  1HD3 A;  3R6N A;  3QHS A;  1VQ7 T;  2YHT A;  4KGV B;  4BUG A;  1F1B B;  1MMA A;  4LD9 K;  3M9Q A;  2COZ A;  1YJW T;  1AEY A;  4E7Z A;  4E7L A;  1Q95 G;  2DE0 X;  1RAC B;  1VQ9 T;  1WYX A;  5DY9 A;  4F16 A;  3OYK A;  2C0O A;  3ZEH A;  3VUZ A;  1WXT A;  1OPK A;  2EYZ A;  4Y92 A; 
#chains in the Genus database with same CATH homology
 1VQL Q;  3CCU Q;  1NJI R;  1YJ9 Q;  3I56 Q;  1QVG P;  3CPW P;  1YHQ Q;  1W2B P;  3I55 Q;  1VQ7 Q;  3G6E Q;  1VQN Q;  3CME Q;  1QVF P;  3CCV Q;  1VQ6 Q;  3CC7 Q;  1VQO Q;  3CD6 Q;  3CCM Q;  1YJW Q;  1KQS P;  1KC8 R;  1Q82 R;  3CCS Q;  3CCQ Q;  3CCR Q;  1Q86 R;  1Q81 R;  1YIT Q;  3CCL Q;  3OW2 P;  1YIJ Q;  1VQ9 Q;  1S72 Q;  2OTL Q;  3CXC P;  1YJN Q;  1N8R R;  3CC2 Q;  3CCE Q;  3G71 Q;  3CCJ Q;  1VQK Q;  2OTJ Q;  2QA4 Q;  1K73 R;  3CC4 Q;  1Q7Y R;  1M90 R;  1KD1 R;  1M1K R;  1K8A R;  1YI2 Q;  1VQM Q;  2QEX Q;  1K9M R;  1VQP Q;  3CMA Q;  1VQ8 Q;  3G4S Q;  1VQ4 Q;  1VQ5 Q;  1JJ2 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...