3CCLQ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535c. density for anisomycin is visible but not included in model.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 20
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3cclQ00
3CCVQ 1KC8R 1VQ4Q 3CCMQ 1K73R 3CC7Q 1Q81R 3CC2Q 1YJNQ 1S72Q 3G4SQ 1YIJQ 3CCRQ 1QVGP 1YI2Q 1Q86R 2QEXQ 1KD1R 3G71Q 2QA4Q 1VQMQ 1VQOQ 1K8AR 2OTLQ 1W2BP 3CCEQ 3CC4Q 1VQLQ 3G6EQ 3CD6Q 3CCQQ 1YHQQ 3I56Q 1YJ9Q 3I55Q 1VQ9Q 1VQ6Q 3CXCP 3CCJQ 1YITQ 1VQ5Q 1QVFP 1VQPQ 1YJWQ 1JJ2P 3CMAQ 1VQ8Q 3CCLQ 3OW2P 1M90R 1Q7YR 3CCSQ 3CCUQ 1NJIR 1VQNQ 2OTJQ 1K9MR 1KQSP 3CMEQ 3CPWP 1Q82R 1VQKQ 1VQ7Q 1M1KR 1N8RR
chains in the Genus database with same CATH superfamily
5IXBA 1AWJA 1TTHB 3OYMA 1Q7YC 2PNIA 1X2QA 4ANJA 1OZ2A 3H6ZA 3I5SA 3M0SA 3BDUA 1VQMQ 4KH0B 2PVGB 2LX7A 3KBGA 1PSEA 4FYXB 3CC7A 3EG0A 1TSFA 2C0OA 2RJEA 1UGPB 2M0OA 1AVZC 1I1JA 2VASA 4PLIA 2LCLA 1M2OA 3QWXX 4X1VA 4C92C 3CCMT 1KQ1A 4C0FA 2NWMA 3SEMA 3EFRA 5CR2A 1U1TA 3JB9H 2KGTA 4A63B 2X35A 1WPYA 1ZA2B 4OB2B 5GAMe 4FT2A 5GAN5 2FRWA 5CCAA 4Y91A 3PVLA 3QO3A 3RESA 4K11A 2MK5A 1X6OA 3CC2A 4M78B 3NGPA 3GP8A 4NOYA 1GBRA 2A28A 2MF2A 5LJ5h 1UGVA 1ZSZB 4C92F 1OU8A 2FZKB 3A8MB 4AFQC 9ATCB 3I56T 3SWNB 3MJXA 3I55T 5FRNA 2RI5A 1D0ZA 1HK9A 4ORZA 3M9QA 2ZPIB 1IHVA 1K73U 4LDYA 3JCMg 1VYTA 1SRLA 1JXOA 2KY9A 5GAMd 1VQNT 1EFNA 2P0PA 3JB9J 3RKYA 3URGA 5GAOn 1DJ7B 3JCMh 1YHQA 2J05A 3TQ7P 2A08A 1YI2Q 3G71Q 1UGSB 3VJPA 2DM1A 1SSHA 1YWOA 2AIRB 2EKHA 2HZYA 4XAXB 4EMKB 1KD1C 2L5QA 3OYNA 3M4YA 1BB9A 1QWFA 1VUBA 2A7YA 2KNBB 4PFOA 4C8QB 2YXYA 4HT9A 2QTXA 3EGUA 4IIOA 4PJNA 1GCQA 3LLRA 2FL7A 1YFNA 2ED0A 3OS1A 5GMKm 3S3NA 1BI1A 3RDVA 5FU7C 2EGEA 2DL5A 4LDVA 2EGAA 4PFPA 3OYHA 2NYSA 5GAN3 1B3QA 4FYYB 2K5FA 1ZUUA 2XD0A 4E7HA 1X27A 3L2QA 2COZA 1YP5A 2CS7A 4OF1A 2X4JA 5M9OA 1VQ6A 2K3BA 3TVTA 4Z89A 1NG2A 2BE9B 5GAMh 1QQJA 2OTJA 3CBOA 4LDWA 1UGRB 3RNJA 3EH2A 1M30A 2RN8A 4DBFA 1HSQA 1HJDA 4XU2A 2LQWA 2DD5A 4KBMB 4MZTA 2SEMA 2E10A 2VGMA 5IN1A 1HD3A 1X75C 3GIBA 1LVKA 1K8AC 4FIBA 4M77C 4AFSC 3VUBA 2JVVA 4BY6C 3LH0A 1WHKA 3PT9A 3UPUA 1RABB 2LNHB 1OEBA 2EWNA 3IQLA 3A8GB 1M8VA 2J6FA 4EDUA 2BIVA 5L8RE 2X3WD 4IKFA 7AT1B 2HEQA 5KYUA 5LL6S 2P0QA 2LNVA 3JV3A 4PKCC 1WXBA 2RQWA 2LZ6B 4M77F 2EQKA 2LCCA 2FRYA 3CCMQ 4BB7A 3FIFA 2LRQA 4N4GA 1YITT 4X34A 2LP5A 1C0MA 2DPPB 1K9AA 4F7UF 4XU3A 2AKLA 1TUGB 2H3JA 5GMKj 8AT1B 1T3SA 2PUKB 2H8HA 1JU5C 2QASA 1QVGA 1VQLT 1C6VX 1QVGP 4EMGA 4PJOE 3UATA 3LX7A 5DM7R 4PLLA 5GANj 3CMAT 3FLGA 3I56Q 3I55Q 4IUVA 3CCUT 4C8QG 2DO3A 2E3IA 3V7RA 1JBMA 3E9FA 2XU8A 3RIRA 2QI2A 5KYXA 5GAOr 2L3RA 1KG1A 2FO0A 2EQUA 2K4YA 3GNGA 5AYFA 4AMCA 1SEMA 1UJ0A 1I8FA 3QKJA 3GLXA 2LCSA 1VQPT 1D0YA 5DY9A 2DL7A 1ZHIA 3KXTA 1FMWA 4M7DA 6AT1B 1IHWA 2DTIA 2QXFA 3M57A 4J7IA 3BFMA 1Q81C 3JB9F 1QVFA 1QVFP 1AHJB 4DEYA 1U3OA 2O01E 1H3HA 1QCFA 4E2FB 2CKKA 1K4US 4J9IA 3CPWA 3CPWP 2KT1A 2ECZA 4DBHA 1BCOA 1ZSGA 2EJFA 4RTYA 3ZBDA 4N4IA 5C6SA 2ESWA 1KD1R 2JM9A 2D6FA 4OVAA 3PVQA 4QW2A 2RA2A 3MO8A 4E7SA 1I81A 2K7AA 4LD9K 3VS5A 2COYA 2YHTA 2KROA 5LJ5j 1M90C 3NFCA 3L2UA 3FJ5A 4M7AD 4F16A 4F04B 1M3AA 2KRSA 2RPNA 3CCLT 3LGFA 2XDDA 1O9SA 3VS1A 1GBQA 4A4KA 2QEXA 1WGSA 1M5Q1 2JTFA 2ATCB 3ASKA 3QJYA 2CP2A 4Z88A 3CC4A 1R77A 2EJ9A 1MGQA 3EFSA 1X2KA 4WCIA 3M59A 3OYIA 3VS7A 4ZNXA 2CSQA 3SB2A 2JMCA 4JLGA 2CP5A 1SKUB 4J83A 5GAOq 3OMGA 4J6YA 3I5RA 2XK0A 1Y07A 1KSWA 1Q86C 4FT4A 4N0AC 1Y57A 3M53A 4R0KA 3CCVT 1N27A 3UF4A 4N4HA 2RI2A 3HPWA 3PIPA 1TOVA 1R0BG 1NJIC 3UDCA 2OJ2A 2BZ8A 4C0DC 3A1PA 2ZPEB 4PJLA 1PHTA 2KYMA 4RCCA 1YITQ 2RHIA 4LUEA 2H3EB 1FX7A 3OW2P 3MEAA 3DB3A 1NYGA 1D3BA 2KDSA 4CC4B 4C92B 2XMFA 3WXMB 1Q95G 2V26A 5GAMj 2JT4A 4L6V5 1M1KC 5A2QE 4CRIA 4QQ6A 2FG0A 1VQLQ 3OYJA 2IPOB 2KT8A 4BUGA 2E70A 5J39A 3OQ5A 5CK9A 1ZBJA 5GMKi 4IUUA 2PU9B 3CMAQ 2EYYA 3VYGA 5FROA 4B9XA 3RBBB 4M75G 4M78D 3CCUQ 3OYEA 3JCMb 4ELYC 2QQRA 1W2BS 1VQ9A 3O8VA 2L3QA 4JJNK 1H3ZA 1YCSB 2R5MA 3HRSA 4PJJA 2IVWA 4J9GA 4JS4A 3X25B 1ZBXA 4QVZA 1JO8A 1NM7A 2KE9A 2MWOA 5C0MA 1AZGB 1VQPQ 1IB8A 1QW1A 1WZOA 2KRMA 1NPPA 2DAQA 1H8KA 2LT1A 1AWXA 4J8OA 3CCQA 1I07A 2GF7A 1VYUA 3M0QA 1YJ9A 4JJDA 1M3CA 2LQKA 2AT1B 2QDLA 3ZEHA 2DRMA 1D0XA 4ZGEB 4PJOF 2ZPHB 5GAOp 4NS5A 1Y96A 1VQ5T 3D7SB 5GANf 5KYUB 2M02A 3X24B 1JRIA 3V8JA 5GANe 2A37A 1ABOA 2DX1A 1WLPB 2CZ1B 1I0CA 2DVJA 3THKA 1W1FA 1OZ3A 3KFVA 1P92A 3JB9I 1N5ZA 1QMCA 2JOYA 2EPDA 4C8QD 1YCYA 3FEOA 3JAME 4F17A 5CQYA 2F2WA 1VQ7A 1WIEA 2KYBA 1RL2A 2KXCA 3M5AA 2RHXA 2CT4A 1TXQA 4QVCA 5CKFA 1G3SA 3LWIA 3NTKA 3CCLQ 1M90R 2DXTA 1GCPA 1AZEA 2YT6A 4QKUA 4XU0A 2BE7D 2EJGA 2MAMA 2O9SA 2OAWA 1K0XA 3G71T 1VOMA 1VQOT 2X4XA 2E64A 2HMAA 2JTEA 3TSZA 2VXFA 4PJOA 2C06A 2CDTA 1MMNA 1O75A 5KYXB 4C92G 1RUWA 3PIOA 5I2MA 1J3TA 2DIGA 2YDLA 4JJCA 3CCEA 3GBQA 1YN8A 2KEAA 2D0NA 2DVEA 3QDRB 5LJ5f 2RJCA 4LDUA 1QP3A 4BY6B 3CCVQ 1Q86R 4M7DB 3DKMA 2ROTA 3VUZA 1UFFA 1WNLA 4ZTFA 1PG5B 2V8KA 2DZCA 2QQAA 1SF9A 2CGHA 3OS0A 5GANg 1KHIA 2VWFA 4E7IA 3OY9A 5D6YA 1BKBA 1OPLA 2JUFA 2WSCE 2RMOA 3G4SA 2QK0A 3CCRA 3INZA 1ABQA 4LNPA 5GAN8 3RERA 2MIOA 1M1KR 3MEWA 2WACA 3G6ET 4M7AE 1WHJA 4P5NA 1RAGB 3MKDA 2DERA 4M75A 2PZ1A 1PC0A 1Y7XA 4GY5A 2IIMA 1OPKA 1TS9A 2M9UA 2XKOC 1YWPA 3HTRA 2Y4YA 5A0GA 3E2UA 4ELZC 3ZL7C 2VV5A 5KYWA 1YIJT 3CD6A 2YUPA 1UEBA 1OYXA 1G3WA 4HXJA 1EIFA 5GAMf 5FU6C 1Q82U 2D9TA 3N5BB 1M1GA 1S1NA 1K73C 2HCKA 1WFWA 4ZN3A 3GOXA 1BBZA 2AZVA 5LJ5g 2Y90A 1VQ5Q 2F69A 4KUIA 3JSCA 4AFUC 2EAYA 3L42A 3P8DA 2RM4A 2CP7A 3OS2A 5GAN7 2R5AA 4E7LA 2EYZA 2LTOA 2X3XD 4ZGJB 3H0IA 1RAFB 2JM8A 4DEXA 2J06A 1XNIA 3F70A 4M77G 3CMET 2DEUA 1D3BB 2CZ7B 4JS5A 2XDBA 2RHYA 1U5SA 4M7DG 3HHTB 3RR6A 2CZ0B 1X69A 2VC8A 2WSFE 4B9WA 2KRNA 2DK3A 1NEBA 2FPEA 3V8LA 1NE8A 1VQOQ 4F7UG 1YJWT 1VQ8T 3V8KA 2EKOA 4ZGDB 4GLMA 1NLOC 2LQ8A 3JRZA 1IO6A 3HFNA 3BDLA 4RKUE 4M78E 2EBPA 2OTLA 3CEYA 1YJNT 5CO7A 5IHNA 2HNIA 1T0JA 1V29B 1ZX6A 2HKQB 4BI4A 2CZ6B 3QPHA 4C92A 2RNAA 2FEIA 1VQKA 2Z0WA 2BKDN 2X9HA 5GMKl 3WVEB 5EG2A 2ZPFB 3MEVA 4HVVA 2PQWA 3M56A 5GJWB 3GPLA 1QVGS 1UG1A 3VS4A 2F2VA 3JCMW 3EH1A 2P0KA 1S72T 3ZFJA 2X4YA 5GAMg 3GNFB 3A8HB 2V1QA 1B34A 1Y96B 1MMDA 4B6MA 3JB9G 1AWOA 2PUOB 4LXCA 4XTUA 5A0DA 3OS5A 3G1JA 3ER0A 3EGDA 2I2LA 2E3HA 2QA4A 4RG8A 4YTLA 4J9FA 5KCHA 2M0YA 3QDFA 1D1BA 2KVQG 4HKEA 4RG2A 1WA7A 2W0ZA 2M1HA 1SRMA 2P4RA 4C92D 1QVFS 4QQGA 3G7ZA 1XQHA 2YUNA 1GL5A 2RQVA 2HSEB 3G6EQ 2K9GA 5IXFA 4KGXB 3CPWS 3CXCA 3CXCP 1F1BB 2QGFB 3META 1OX9A 4Z02A 1VQMA 1IRXA 1VQ4T 4E7ZA 3PMTA 2K57A 5DLOA 5IT9E 1Q82R 4M7AC 2B8AA 2RJFA 4PJOB 1JEGA 4OMFB 2DL4A 2XICA 1YIJQ 2DL8A 4X9DA 2EYXA 1UJYA 3M55A 4KH1B 3FB9A 3PFSA 4Q5WA 3ULRB 5HCKA 2ENMA 2O4XA 4FCYA 1FMKA 3PE0A 3JCMV 1NLPC 2NUPA 1HYOA 4BI3A 2QQ9A 4JZ4A 3PGGA 5CKBA 4M7AF 5LJ3e 1K73R 2QGGA 4D6WA 1PCXA 3H0FA 5FLXE 2OAUA 3C12A 1FXXA 3O5ZA 2A3LA 1RACB 2J6OA 1ZUYA 3M54A 4Z8AA 4IUQA 1KQSA 2GTOA 3OYFA 1KQSP 3CMEQ 2FVUA 2QTVA 1MMGA 2DEQA 4OMPA 2AK5A 2KBTA 2GNCA 3A98A 3EHRA 3S3OA 5I21A 4M77A 2EFIA 1K9MU 3U23A 5LJ3d 2C0TA 5FRMA 1YI2A 1YJWQ 4RTWA 1VQ8Q 2GCXA 3CC7T 4AG1C 2QQBA 3GF5A 1TH7A 4F7UA 4RTUA 2P4TA 4JDSA 1WHGA 1YJNQ 3CD6T 5I11A 4M75B 3V7SA 3RKWA 4HVUA 3CCSA 3OW2S 3JCMc 4M78C 2L0AA 2E1HA 4GBQA 5KE3A 2DNUA 2HDAA 5KYWB 4F14A 5L23A 3H0HA 3CC2T 3C94A 2YRDA 2P84A 2R57A 1ZA1B 4JRQA 3SWNC 1S72Q 1NBEB 2FYKA 1AD5A 2LC4A 4CC2A 1PWTA 1M2VA 1BU1A 4M7DD 2K79A 1V76A 4M78F 5LJ3g 2CH4A 5KYYA 4XTZA 4PJOG 1KJWA 1LCKA 3EAEA 3M58A 1PKTA 4C0ZA 2ZGWA 5CAIA 5A0LA 2HD0A 5LJ3h 1WJSA 2DTOA 2FZGB 3EG3A 4A4EA 1YHQT 3EG9A 1NZ9A 2LJ0A 4EMKC 3E9GA 2E5QA 4FYWB 1WQWA 4FSXA 3QHSA 1U06A 3T9NA 4HVWA 2CYZB 3FDRA 4C8QC 3UA6A 2Y4XA 4C5IA 1OQKA 1FMVA 1OX8A 1K0SA 2VVKA 3LH5A 3CCJA 3A5ZB 2E65A 1VQ4Q 2YRVA 3VS6A 1RI9A 3X26B 1BIBA 4RCBA 4XQ3A 1MV3A 4DQ2A 3S6WA 5J3BA 4CC3A 3CCMA 3M4GA 2JJ9A 2V8IA 2GBQA 3SD4A 3OYLA 4JRPA 3JB9D 3OW2A 2HSPA 4C8QF 4O6JA 1MV0B 4D8DA 5I2SA 2XHCA 2VKNA 1RAEB 4MZMA 2FPDA 3VRZA 1VQ6T 4OMLA 2I0NA 5FU6B 2B86A 2MCNA 3RUXA 2J7IA 1H92A 2OTJT 4OB0B 3JCMQ 2VB6A 1T0HA 1QLYA 2YSQA 1G3YA 2C0IA 2K5IA 3LWHA 1B34B 2QAZA 3I56A 2X51A 3I55A 1KIKA 4NL2A 3QZ5B 5CVIA 4LE9A 2JW4A 1KHCA 2DA9A 2E4HA 1ZUKA 2COWA 4QT7A 2M16A 1VQNA 2MI6A 3EGDB 3SDZA 2DKGA 3LGLA 1KC8U 2YUOA 1X6GA 2DL3A 2AZSA 2EYQA 3QG1A 5ECAA 5FWBA 3OSSC 4L59A 4N0AA 4KUDK 1UHCA 5IHKA 1WYXA 4ME7A 2O31A 3CC7Q 3OMCA 5GAN2 4JJBA 4PNOA 1BI3A 3EFOA 3OA6A 3CD6Q 4ATOA 4J9BA 1BIAA 1B7TA 1WI7A 3UWNA 3VRYA 1XJWB 1UTIA 3MP1A 2JNGA 3CC2Q 1WHHA 4D8KA 4KT0E 2DZ9A 2CH4W 2YLBA 2L3PA 4ZTJA 2O4XB 2V1RA 2QQSA 5FU7B 4OB1B 4RTXA 2LJ1A 2LT4A 2GQIA 2LQNA 2NUPB 2O9VA 1WDXA 3J80E 1WJRA 8ATCB 1BK2A 1W70A 2RF0A 2HQEA 3L1AA 1GFCA 3VS3A 1VA7A 2DXBA 1YHQQ 2NUTA 4A54A 1QWEA 2JXBA 5KH6A 3UT1A 2RQRA 5D6WA 4OMNA 1TG0A 4OB3B 2NUZA 2NLUA 4M77B 4C5HA 4HCCA 1WX6A 2DJZA 4II1A 5HK3A 4HCBA 1N8RU 3R6OA 1N9RA 1IGQA 2K3XA 2EGCA 3HL8A 2XIDA 2O2OA 2XG8D 3L2ZA 4F7UB 5FWCA 1UUEA 1YITA 5GAOm 1G8XA 2AHJB 4DBRA 1UGQB 1Z9QA 4FM4B 3QIIA 3UA7A 1BCMA 4PJOD 3I9QA 2ZPGB 2XDPA 1QP2A 1KK7A 1JB0E 1VQ6Q 2EQIA 3C0CA 4MDWA 1EZZB 4XTWA 2OTJQ 1VQLA 2O88A 1GRIA 2QEXT 5LJ3j 2LX9A 2MPXC 1KC8R 2JMAA 3CC4T 1M2VB 2F5TX 2IG0A 3CCUA 1NEGA 3OYAA 4M7DE 1LNXA 1Q82C 3H41A 5KYYB 2LDMA 5KYNA 3QSUA 4JPBW 2DIQA 2D0QB 3V7CA 2L2PA 1SG5A 4IIMA 1WXTA 3C4SA 2FPFA 2HBWA 1SHGA 3AT1B 3EG9B 3SHWA 3MEUA 5KCOA 1VQPA 4QVDA 2JS0A 3JCMd 4PFZA 4EMHA 3CCJT 5IHIA 2JS2A 4A53A 1M9SA 1H641 2HKNA 3BY7A 1TWBA 3MP8A 1GCQC 2HAXA 2PVOB 5CIUA 3M0TA 1E7OA 3EGXA 4E6RA 2DRKA 4DBQA 5KE2A 1OV3A 1IXDA 4A4HA 1Q7YU 4TVRA 1V1CA 2A0FB 2F2XA 2JN0A 1X01A 1E6GA 5HKCA 4M75D 5CKEA 2X4WA 4XTXA 4AFZC 1EX4A 5IH2A 1UB4A 4WTOB 1QCNA 4XK8E 2KI7A 3CCLA 3CXCS 2HL5C 3DLMA 1YNZA 1VQ9T 1IZ6A 4ZN1A 2HQXA 1MUZA 4JRKA 2RH2A 2EQJA 2QYZA 2RD1A 2DTHA 3DLLA 1B07A 1K1ZA 4XTVA 5CKHA 2E12A 1JJ2A 1JJ2P 3VS0A 3HFOA 4J9DA 4M7AG 2DETA 3H8ZA 1N8RR 2DXCA 2M51A 3HP9A 1G5VA 1D09B 2RQTA 1SPKA 3CCQT 1YJ9T 4KGVB 1QKXA 1RADB 2QG9B 1D1CA 4RUGA 2RB6A 3CCVA 2ROLA 3CQTA 4IUTA 3QBYA 3OYYA 3REAB 3TCJA 2E6ZA 3CCSQ 4L5GA 1OI1A 2SRCA 5AT1B 2PTKA 2ZCFB 1QCOA 3EFOB 1OULA 5D6XA 1PD1A 1ZQ1A 3QUIA 5CKDA 1KQSS 4RTTA 2YRCA 1KD1U 4C0DB 2FHDA 3VV0A 1VQ7T 1WHLA 3RKXA 2GFAA 3A8LB 1JXMA 1U8RA 4AT1B 5EC7A 4RMOA 2GTJA 4C8QE 2RK1A 3PNWC 2QEXQ 1ZLMA 1GFDA 4J9HA 1C1AA 3CC4Q 3QWYA 1K76A 5I22A 4OMMA 3C95A 1U1SA 1N6AA 4J6WA 3E19A 3M0UA 4PJMA 1R0CB 4M7DC 1PD0A 3CCET 1CSKA 1W6XA 4M78G 1X6BA 1PM3A 2NUTB 2E6NA 2ZZDA 1ACMB 3CCJQ 4AG2C 2K2VA 1M8MA 2DD4A 2LMJA 4BE1A 1JQQA 1Q7YR 1K8AU 2KXDA 2EQMA 2D8JA 2LVMA 2DE0X 4R55A 2XI9A 5LJ3f 1VQ5A 4MZPA 3FC3A 4M7DF 1K9MC 3EHQA 4DOVA 1TUDA 1NPRA 1I5OB 3QXEB 1QKWA 1PRLC 1SSFA 4LN2A 1WHMA 2F5KA 4Y28E 4MDXA 3VS2A 4JZ3A 3DB4A 2DJQA 4V2SA 4MMLA 2BZYA 2DYBA 2L89A 2L8DA 4FW2A 3G4ST 3CCRT 4A4FA 1WJQA 5D7UA 1CKAA 2K6DA 1FYNA 2ZPBB 4KRTA 3CBMA 1A0NB 3J81E 1AT1B 2BUDA 2MMPA 1VQ9Q 4ESRA 3MHXA 3G71A 4J5YA 1VQOA 3OYBA 1W4SA 1VQNQ 3VYHB 2CP3A 2MWPA 4BI8B 2EIFA 3R6NA 3FRNA 1YBYA 5GAN4 2K2MA 4E7JA 3A8OB 3HKSA 2RK2A 4M7AA 3KUFA 4VUBA 2EW3A 2L3SA 4LDXA 3AHUA 2DBKA 5HY6A 1OU9A 3CCQQ 1YJ9Q 2ED1A 2GFUA 1I5LA 3OYDA 1E6HA 2DFUA 2D1XA 2VGNA 4RTVA 2KMTA 2VXEA 4DA4A 1ZSZC 3TEEA 4CC7A 1NYFA 3P8HA 3NTHA 2RQUA 3REBB 2VYTA 1MHNA 4C5GA 2QDYB 4J7FA 4M77D 2CP6A 3BW1A 1G83A 4PK4A 2ABLA 3TU4K 4UC4A 1TUCA 1Q81U 3EGXB 2CT3A 1BI0A 2RO0A 2R58A 3MCAB 1VIEA 5FW9A 1RAIB 2CP0A 2LJ3A 2DILA 3JCMJ 1ARKA 1VQ7Q 1AOJA 3LYIA 1M3BA 2KK4A 3Q1JA 4O5VA 2RI3A 4EIKA 3NPFA 4FW1A 4M75E 2V8JA 3JCMX 3OYGA 3M0PA 2J6KA 2G6FX 3J7AF 4BACA 4LD6A 3L2VA 1M4ZA 2A36A 4BD3A 2JTMA 2CSIA 3NMZC 1Y71A 2OI3A 1VYVA 2KR3A 3G6EA 4WF2A 3PMIA 3H9NA 5HK0A 1PRMC 4OP0A 1XTDA 4C5EA 1MMAA 3OYKA 2OTLT 4NL3A 2BZXA 1M90U 4IUPA 3HRUA 1N9SA 1K8AR 2K5LA 3CCEQ 3I35A 2CUBA 1GXIE 2KSSA 4OGCA 1MNDA 4BDZA 1YIJA 1VQKT 4J9EA 3EG1A 2AKKA 3BE3A 1Y0MA 4M78A 3VKIA 3LW5E 4MMKA 4M4ZA 5DLQE 4X9CA 1RLPC 1G3TA 1D1AA 2F1LA 2VUBA 1ZSZA 3TSWA 2CREA 2DLPA 3RMSA 3SWNA 1M27C 1KC8C 1Q86U 2DF6A 2KQWA 3CPFA 1LOJA 1IREB 2DBMA 3HSBA 1RI0A 3OSVA 1R8OB 2CUDA 1K9MR 2GQVA 4HCZA 2QA4T 2DXUA 3PTAA 2E41A 4EPCA 1TU0B 3QYHB 3QYGB 4DOWA 1BI2A 3G4SQ 2K3YA 3CCRQ 4J9CA 1NJIU 3CMEA 1I4K1 5J26A 1VIFA 2KAFA 4GLKA 4EMKA 1RAAB 3NHNA 3EG2A 1UE9A 4PJOC 5GAN6 2YLCA 3S3MA 3FJPA 1VQMT 2EYWA 2FZCB 4C92E 1YJWA 1VQ8A 2EVRA 4C8QA 4FSSA 3WVDB 3E1SA 1FWZA 1M1KU 2MYSA 2OX7A 4JUVA 2DYIA 3QJ6A 1SHFA 1YJNA 2JZ2A 1WXUA 2G3RA 2W10A 5GMKe 4C0GA 1KFZA 1UECA 1Q81R 4BDYA 2HL3A 4FL6A 1T3LA 3OBWA 4FYVB 3CBPA 3VU3C 1S72A 4XTYA 3QZ9B 4FU6A 2ZAEA 4PL6A 1RAHB 4E7KA 5IAYA 4JLIA 4BE2A 1UDLA 2RHUA 4KULA 2WSEE 4OMQA 1N8RC 3P8BB 4OMOA 4LUDA 4OGEA 3TREA 2GGRA 3MPUB 4Y92A 1QVPA 5GANd 3ME9A 5CQXA 1YI2T 4M75C 3RMQA 2FB7A 1AWWA 3HRTA 1UHFA 1X43A 2OTLQ 1W2BA 1W2BP 1KQ2A 4JRIA 1VQ4A 3CCST 1RLQC 3OYCA 2RJDA 4R56A 2YWWA 4HT8A 1G2BA 1OOTA 1CKBA 2MOXA 3SFMA 1VQKQ 4QQDA 3L2RA 1AEYA 5LJ5e 4HA8A 4M7AB 2DMOA 1Z9ZA 4M75F 5GAOl 2BTTA 1BYMA 3MP6A 4HCKA 1XOVA 2YUQA 5GJVB 1PSFA 3M0RA 2D8HA 1LJOA 2HQHA 3NTIA 3X28B 3JCMf 1NJIR 5GMKh 2PVDB 1PKSA 3JCMe 4CI0C 3JCMP 4KGZB 4M77E 4BE0A 1PNJA 4J6XA 2HBPA 1MNEA 3CMAA 4IURA 1JJ2S 2QA4Q 5LJ5d 3L2WA 1WQ7A 3OBYA 5GANh 1M1FA 3X20B 4XU1A 4RTZA 4A4GA 1HXDA 3OB9A 4F7UE 1LPLA 1IGUA 2RHZA 2E5KA 4E47A
chains in the Genus database with same CATH topology
3CCVQ 1KC8R 1VQ4Q 3CCMQ 1K73R 3CC7Q 1Q81R 3CC2Q 1YJNQ 1S72Q 3G4SQ 1YIJQ 3CCRQ 1QVGP 1YI2Q 1Q86R 2QEXQ 1KD1R 3G71Q 2QA4Q 1VQMQ 1VQOQ 1K8AR 2OTLQ 1W2BP 3CCEQ 3CC4Q 1VQLQ 3G6EQ 3CD6Q 3CCQQ 1YHQQ 3I56Q 1YJ9Q 3I55Q 1VQ9Q 1VQ6Q 3CXCP 3CCJQ 1YITQ 1VQ5Q 1QVFP 1VQPQ 1YJWQ 1JJ2P 3CMAQ 1VQ8Q 3CCLQ 3OW2P 1M90R 1Q7YR 3CCSQ 3CCUQ 1NJIR 1VQNQ 2OTJQ 1K9MR 1KQSP 3CMEQ 3CPWP 1Q82R 1VQKQ 1VQ7Q 1M1KR 1N8RR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCV Q;  1KC8 R;  1VQ4 Q;  3CCM Q;  1K73 R;  3CC7 Q;  1Q81 R;  3CC2 Q;  1YJN Q;  1S72 Q;  3G4S Q;  1YIJ Q;  3CCR Q;  1QVG P;  1YI2 Q;  1Q86 R;  2QEX Q;  1KD1 R;  3G71 Q;  2QA4 Q;  1VQM Q;  1VQO Q;  1K8A R;  2OTL Q;  1W2B P;  3CCE Q;  3CC4 Q;  1VQL Q;  3G6E Q;  3CD6 Q;  3CCQ Q;  1YHQ Q;  3I56 Q;  1YJ9 Q;  3I55 Q;  1VQ9 Q;  1VQ6 Q;  3CXC P;  3CCJ Q;  1YIT Q;  1VQ5 Q;  1QVF P;  1VQP Q;  1YJW Q;  1JJ2 P;  3CMA Q;  1VQ8 Q;  3CCL Q;  3OW2 P;  1M90 R;  1Q7Y R;  3CCS Q;  3CCU Q;  1NJI R;  1VQN Q;  2OTJ Q;  1K9M R;  1KQS P;  3CME Q;  3CPW P;  1Q82 R;  1VQK Q;  1VQ7 Q;  1M1K R;  1N8R R; 
#chains in the Genus database with same CATH topology
 5IXB A;  1AWJ A;  1TTH B;  3OYM A;  1Q7Y C;  2PNI A;  1X2Q A;  4ANJ A;  1OZ2 A;  3H6Z A;  3I5S A;  3M0S A;  3BDU A;  1VQM Q;  4KH0 B;  2PVG B;  2LX7 A;  3KBG A;  1PSE A;  4FYX B;  3CC7 A;  3EG0 A;  1TSF A;  2C0O A;  2RJE A;  1UGP B;  2M0O A;  1AVZ C;  1I1J A;  2VAS A;  4PLI A;  2LCL A;  1M2O A;  3QWX X;  4X1V A;  4C92 C;  3CCM T;  1KQ1 A;  4C0F A;  2NWM A;  3SEM A;  3EFR A;  5CR2 A;  1U1T A;  3JB9 H;  2KGT A;  4A63 B;  2X35 A;  1WPY A;  1ZA2 B;  4OB2 B;  5GAM e;  4FT2 A;  5GAN 5;  2FRW A;  5CCA A;  4Y91 A;  3PVL A;  3QO3 A;  3RES A;  4K11 A;  2MK5 A;  1X6O A;  3CC2 A;  4M78 B;  3NGP A;  3GP8 A;  4NOY A;  1GBR A;  2A28 A;  2MF2 A;  5LJ5 h;  1UGV A;  1ZSZ B;  4C92 F;  1OU8 A;  2FZK B;  3A8M B;  4AFQ C;  9ATC B;  3I56 T;  3SWN B;  3MJX A;  3I55 T;  5FRN A;  2RI5 A;  1D0Z A;  1HK9 A;  4ORZ A;  3M9Q A;  2ZPI B;  1IHV A;  1K73 U;  4LDY A;  3JCM g;  1VYT A;  1SRL A;  1JXO A;  2KY9 A;  5GAM d;  1VQN T;  1EFN A;  2P0P A;  3JB9 J;  3RKY A;  3URG A;  5GAO n;  1DJ7 B;  3JCM h;  1YHQ A;  2J05 A;  3TQ7 P;  2A08 A;  1YI2 Q;  3G71 Q;  1UGS B;  3VJP A;  2DM1 A;  1SSH A;  1YWO A;  2AIR B;  2EKH A;  2HZY A;  4XAX B;  4EMK B;  1KD1 C;  2L5Q A;  3OYN A;  3M4Y A;  1BB9 A;  1QWF A;  1VUB A;  2A7Y A;  2KNB B;  4PFO A;  4C8Q B;  2YXY A;  4HT9 A;  2QTX A;  3EGU A;  4IIO A;  4PJN A;  1GCQ A;  3LLR A;  2FL7 A;  1YFN A;  2ED0 A;  3OS1 A;  5GMK m;  3S3N A;  1BI1 A;  3RDV A;  5FU7 C;  2EGE A;  2DL5 A;  4LDV A;  2EGA A;  4PFP A;  3OYH A;  2NYS A;  5GAN 3;  1B3Q A;  4FYY B;  2K5F A;  1ZUU A;  2XD0 A;  4E7H A;  1X27 A;  3L2Q A;  2COZ A;  1YP5 A;  2CS7 A;  4OF1 A;  2X4J A;  5M9O A;  1VQ6 A;  2K3B A;  3TVT A;  4Z89 A;  1NG2 A;  2BE9 B;  5GAM h;  1QQJ A;  2OTJ A;  3CBO A;  4LDW A;  1UGR B;  3RNJ A;  3EH2 A;  1M30 A;  2RN8 A;  4DBF A;  1HSQ A;  1HJD A;  4XU2 A;  2LQW A;  2DD5 A;  4KBM B;  4MZT A;  2SEM A;  2E10 A;  2VGM A;  5IN1 A;  1HD3 A;  1X75 C;  3GIB A;  1LVK A;  1K8A C;  4FIB A;  4M77 C;  4AFS C;  3VUB A;  2JVV A;  4BY6 C;  3LH0 A;  1WHK A;  3PT9 A;  3UPU A;  1RAB B;  2LNH B;  1OEB A;  2EWN A;  3IQL A;  3A8G B;  1M8V A;  2J6F A;  4EDU A;  2BIV A;  5L8R E;  2X3W D;  4IKF A;  7AT1 B;  2HEQ A;  5KYU A;  5LL6 S;  2P0Q A;  2LNV A;  3JV3 A;  4PKC C;  1WXB A;  2RQW A;  2LZ6 B;  4M77 F;  2EQK A;  2LCC A;  2FRY A;  3CCM Q;  4BB7 A;  3FIF A;  2LRQ A;  4N4G A;  1YIT T;  4X34 A;  2LP5 A;  1C0M A;  2DPP B;  1K9A A;  4F7U F;  4XU3 A;  2AKL A;  1TUG B;  2H3J A;  5GMK j;  8AT1 B;  1T3S A;  2PUK B;  2H8H A;  1JU5 C;  2QAS A;  1QVG A;  1VQL T;  1C6V X;  1QVG P;  4EMG A;  4PJO E;  3UAT A;  3LX7 A;  5DM7 R;  4PLL A;  5GAN j;  3CMA T;  3FLG A;  3I56 Q;  3I55 Q;  4IUV A;  3CCU T;  4C8Q G;  2DO3 A;  2E3I A;  3V7R A;  1JBM A;  3E9F A;  2XU8 A;  3RIR A;  2QI2 A;  5KYX A;  5GAO r;  2L3R A;  1KG1 A;  2FO0 A;  2EQU A;  2K4Y A;  3GNG A;  5AYF A;  4AMC A;  1SEM A;  1UJ0 A;  1I8F A;  3QKJ A;  3GLX A;  2LCS A;  1VQP T;  1D0Y A;  5DY9 A;  2DL7 A;  1ZHI A;  3KXT A;  1FMW A;  4M7D A;  6AT1 B;  1IHW A;  2DTI A;  2QXF A;  3M57 A;  4J7I A;  3BFM A;  1Q81 C;  3JB9 F;  1QVF A;  1QVF P;  1AHJ B;  4DEY A;  1U3O A;  2O01 E;  1H3H A;  1QCF A;  4E2F B;  2CKK A;  1K4U S;  4J9I A;  3CPW A;  3CPW P;  2KT1 A;  2ECZ A;  4DBH A;  1BCO A;  1ZSG A;  2EJF A;  4RTY A;  3ZBD A;  4N4I A;  5C6S A;  2ESW A;  1KD1 R;  2JM9 A;  2D6F A;  4OVA A;  3PVQ A;  4QW2 A;  2RA2 A;  3MO8 A;  4E7S A;  1I81 A;  2K7A A;  4LD9 K;  3VS5 A;  2COY A;  2YHT A;  2KRO A;  5LJ5 j;  1M90 C;  3NFC A;  3L2U A;  3FJ5 A;  4M7A D;  4F16 A;  4F04 B;  1M3A A;  2KRS A;  2RPN A;  3CCL T;  3LGF A;  2XDD A;  1O9S A;  3VS1 A;  1GBQ A;  4A4K A;  2QEX A;  1WGS A;  1M5Q 1;  2JTF A;  2ATC B;  3ASK A;  3QJY A;  2CP2 A;  4Z88 A;  3CC4 A;  1R77 A;  2EJ9 A;  1MGQ A;  3EFS A;  1X2K A;  4WCI A;  3M59 A;  3OYI A;  3VS7 A;  4ZNX A;  2CSQ A;  3SB2 A;  2JMC A;  4JLG A;  2CP5 A;  1SKU B;  4J83 A;  5GAO q;  3OMG A;  4J6Y A;  3I5R A;  2XK0 A;  1Y07 A;  1KSW A;  1Q86 C;  4FT4 A;  4N0A C;  1Y57 A;  3M53 A;  4R0K A;  3CCV T;  1N27 A;  3UF4 A;  4N4H A;  2RI2 A;  3HPW A;  3PIP A;  1TOV A;  1R0B G;  1NJI C;  3UDC A;  2OJ2 A;  2BZ8 A;  4C0D C;  3A1P A;  2ZPE B;  4PJL A;  1PHT A;  2KYM A;  4RCC A;  1YIT Q;  2RHI A;  4LUE A;  2H3E B;  1FX7 A;  3OW2 P;  3MEA A;  3DB3 A;  1NYG A;  1D3B A;  2KDS A;  4CC4 B;  4C92 B;  2XMF A;  3WXM B;  1Q95 G;  2V26 A;  5GAM j;  2JT4 A;  4L6V 5;  1M1K C;  5A2Q E;  4CRI A;  4QQ6 A;  2FG0 A;  1VQL Q;  3OYJ A;  2IPO B;  2KT8 A;  4BUG A;  2E70 A;  5J39 A;  3OQ5 A;  5CK9 A;  1ZBJ A;  5GMK i;  4IUU A;  2PU9 B;  3CMA Q;  2EYY A;  3VYG A;  5FRO A;  4B9X A;  3RBB B;  4M75 G;  4M78 D;  3CCU Q;  3OYE A;  3JCM b;  4ELY C;  2QQR A;  1W2B S;  1VQ9 A;  3O8V A;  2L3Q A;  4JJN K;  1H3Z A;  1YCS B;  2R5M A;  3HRS A;  4PJJ A;  2IVW A;  4J9G A;  4JS4 A;  3X25 B;  1ZBX A;  4QVZ A;  1JO8 A;  1NM7 A;  2KE9 A;  2MWO A;  5C0M A;  1AZG B;  1VQP Q;  1IB8 A;  1QW1 A;  1WZO A;  2KRM A;  1NPP A;  2DAQ A;  1H8K A;  2LT1 A;  1AWX A;  4J8O A;  3CCQ A;  1I07 A;  2GF7 A;  1VYU A;  3M0Q A;  1YJ9 A;  4JJD A;  1M3C A;  2LQK A;  2AT1 B;  2QDL A;  3ZEH A;  2DRM A;  1D0X A;  4ZGE B;  4PJO F;  2ZPH B;  5GAO p;  4NS5 A;  1Y96 A;  1VQ5 T;  3D7S B;  5GAN f;  5KYU B;  2M02 A;  3X24 B;  1JRI A;  3V8J A;  5GAN e;  2A37 A;  1ABO A;  2DX1 A;  1WLP B;  2CZ1 B;  1I0C A;  2DVJ A;  3THK A;  1W1F A;  1OZ3 A;  3KFV A;  1P92 A;  3JB9 I;  1N5Z A;  1QMC A;  2JOY A;  2EPD A;  4C8Q D;  1YCY A;  3FEO A;  3JAM E;  4F17 A;  5CQY A;  2F2W A;  1VQ7 A;  1WIE A;  2KYB A;  1RL2 A;  2KXC A;  3M5A A;  2RHX A;  2CT4 A;  1TXQ A;  4QVC A;  5CKF A;  1G3S A;  3LWI A;  3NTK A;  3CCL Q;  1M90 R;  2DXT A;  1GCP A;  1AZE A;  2YT6 A;  4QKU A;  4XU0 A;  2BE7 D;  2EJG A;  2MAM A;  2O9S A;  2OAW A;  1K0X A;  3G71 T;  1VOM A;  1VQO T;  2X4X A;  2E64 A;  2HMA A;  2JTE A;  3TSZ A;  2VXF A;  4PJO A;  2C06 A;  2CDT A;  1MMN A;  1O75 A;  5KYX B;  4C92 G;  1RUW A;  3PIO A;  5I2M A;  1J3T A;  2DIG A;  2YDL A;  4JJC A;  3CCE A;  3GBQ A;  1YN8 A;  2KEA A;  2D0N A;  2DVE A;  3QDR B;  5LJ5 f;  2RJC A;  4LDU A;  1QP3 A;  4BY6 B;  3CCV Q;  1Q86 R;  4M7D B;  3DKM A;  2ROT A;  3VUZ A;  1UFF A;  1WNL A;  4ZTF A;  1PG5 B;  2V8K A;  2DZC A;  2QQA A;  1SF9 A;  2CGH A;  3OS0 A;  5GAN g;  1KHI A;  2VWF A;  4E7I A;  3OY9 A;  5D6Y A;  1BKB A;  1OPL A;  2JUF A;  2WSC E;  2RMO A;  3G4S A;  2QK0 A;  3CCR A;  3INZ A;  1ABQ A;  4LNP A;  5GAN 8;  3RER A;  2MIO A;  1M1K R;  3MEW A;  2WAC A;  3G6E T;  4M7A E;  1WHJ A;  4P5N A;  1RAG B;  3MKD A;  2DER A;  4M75 A;  2PZ1 A;  1PC0 A;  1Y7X A;  4GY5 A;  2IIM A;  1OPK A;  1TS9 A;  2M9U A;  2XKO C;  1YWP A;  3HTR A;  2Y4Y A;  5A0G A;  3E2U A;  4ELZ C;  3ZL7 C;  2VV5 A;  5KYW A;  1YIJ T;  3CD6 A;  2YUP A;  1UEB A;  1OYX A;  1G3W A;  4HXJ A;  1EIF A;  5GAM f;  5FU6 C;  1Q82 U;  2D9T A;  3N5B B;  1M1G A;  1S1N A;  1K73 C;  2HCK A;  1WFW A;  4ZN3 A;  3GOX A;  1BBZ A;  2AZV A;  5LJ5 g;  2Y90 A;  1VQ5 Q;  2F69 A;  4KUI A;  3JSC A;  4AFU C;  2EAY A;  3L42 A;  3P8D A;  2RM4 A;  2CP7 A;  3OS2 A;  5GAN 7;  2R5A A;  4E7L A;  2EYZ A;  2LTO A;  2X3X D;  4ZGJ B;  3H0I A;  1RAF B;  2JM8 A;  4DEX A;  2J06 A;  1XNI A;  3F70 A;  4M77 G;  3CME T;  2DEU A;  1D3B B;  2CZ7 B;  4JS5 A;  2XDB A;  2RHY A;  1U5S A;  4M7D G;  3HHT B;  3RR6 A;  2CZ0 B;  1X69 A;  2VC8 A;  2WSF E;  4B9W A;  2KRN A;  2DK3 A;  1NEB A;  2FPE A;  3V8L A;  1NE8 A;  1VQO Q;  4F7U G;  1YJW T;  1VQ8 T;  3V8K A;  2EKO A;  4ZGD B;  4GLM A;  1NLO C;  2LQ8 A;  3JRZ A;  1IO6 A;  3HFN A;  3BDL A;  4RKU E;  4M78 E;  2EBP A;  2OTL A;  3CEY A;  1YJN T;  5CO7 A;  5IHN A;  2HNI A;  1T0J A;  1V29 B;  1ZX6 A;  2HKQ B;  4BI4 A;  2CZ6 B;  3QPH A;  4C92 A;  2RNA A;  2FEI A;  1VQK A;  2Z0W A;  2BKD N;  2X9H A;  5GMK l;  3WVE B;  5EG2 A;  2ZPF B;  3MEV A;  4HVV A;  2PQW A;  3M56 A;  5GJW B;  3GPL A;  1QVG S;  1UG1 A;  3VS4 A;  2F2V A;  3JCM W;  3EH1 A;  2P0K A;  1S72 T;  3ZFJ A;  2X4Y A;  5GAM g;  3GNF B;  3A8H B;  2V1Q A;  1B34 A;  1Y96 B;  1MMD A;  4B6M A;  3JB9 G;  1AWO A;  2PUO B;  4LXC A;  4XTU A;  5A0D A;  3OS5 A;  3G1J A;  3ER0 A;  3EGD A;  2I2L A;  2E3H A;  2QA4 A;  4RG8 A;  4YTL A;  4J9F A;  5KCH A;  2M0Y A;  3QDF A;  1D1B A;  2KVQ G;  4HKE A;  4RG2 A;  1WA7 A;  2W0Z A;  2M1H A;  1SRM A;  2P4R A;  4C92 D;  1QVF S;  4QQG A;  3G7Z A;  1XQH A;  2YUN A;  1GL5 A;  2RQV A;  2HSE B;  3G6E Q;  2K9G A;  5IXF A;  4KGX B;  3CPW S;  3CXC A;  3CXC P;  1F1B B;  2QGF B;  3MET A;  1OX9 A;  4Z02 A;  1VQM A;  1IRX A;  1VQ4 T;  4E7Z A;  3PMT A;  2K57 A;  5DLO A;  5IT9 E;  1Q82 R;  4M7A C;  2B8A A;  2RJF A;  4PJO B;  1JEG A;  4OMF B;  2DL4 A;  2XIC A;  1YIJ Q;  2DL8 A;  4X9D A;  2EYX A;  1UJY A;  3M55 A;  4KH1 B;  3FB9 A;  3PFS A;  4Q5W A;  3ULR B;  5HCK A;  2ENM A;  2O4X A;  4FCY A;  1FMK A;  3PE0 A;  3JCM V;  1NLP C;  2NUP A;  1HYO A;  4BI3 A;  2QQ9 A;  4JZ4 A;  3PGG A;  5CKB A;  4M7A F;  5LJ3 e;  1K73 R;  2QGG A;  4D6W A;  1PCX A;  3H0F A;  5FLX E;  2OAU A;  3C12 A;  1FXX A;  3O5Z A;  2A3L A;  1RAC B;  2J6O A;  1ZUY A;  3M54 A;  4Z8A A;  4IUQ A;  1KQS A;  2GTO A;  3OYF A;  1KQS P;  3CME Q;  2FVU A;  2QTV A;  1MMG A;  2DEQ A;  4OMP A;  2AK5 A;  2KBT A;  2GNC A;  3A98 A;  3EHR A;  3S3O A;  5I21 A;  4M77 A;  2EFI A;  1K9M U;  3U23 A;  5LJ3 d;  2C0T A;  5FRM A;  1YI2 A;  1YJW Q;  4RTW A;  1VQ8 Q;  2GCX A;  3CC7 T;  4AG1 C;  2QQB A;  3GF5 A;  1TH7 A;  4F7U A;  4RTU A;  2P4T A;  4JDS A;  1WHG A;  1YJN Q;  3CD6 T;  5I11 A;  4M75 B;  3V7S A;  3RKW A;  4HVU A;  3CCS A;  3OW2 S;  3JCM c;  4M78 C;  2L0A A;  2E1H A;  4GBQ A;  5KE3 A;  2DNU A;  2HDA A;  5KYW B;  4F14 A;  5L23 A;  3H0H A;  3CC2 T;  3C94 A;  2YRD A;  2P84 A;  2R57 A;  1ZA1 B;  4JRQ A;  3SWN C;  1S72 Q;  1NBE B;  2FYK A;  1AD5 A;  2LC4 A;  4CC2 A;  1PWT A;  1M2V A;  1BU1 A;  4M7D D;  2K79 A;  1V76 A;  4M78 F;  5LJ3 g;  2CH4 A;  5KYY A;  4XTZ A;  4PJO G;  1KJW A;  1LCK A;  3EAE A;  3M58 A;  1PKT A;  4C0Z A;  2ZGW A;  5CAI A;  5A0L A;  2HD0 A;  5LJ3 h;  1WJS A;  2DTO A;  2FZG B;  3EG3 A;  4A4E A;  1YHQ T;  3EG9 A;  1NZ9 A;  2LJ0 A;  4EMK C;  3E9G A;  2E5Q A;  4FYW B;  1WQW A;  4FSX A;  3QHS A;  1U06 A;  3T9N A;  4HVW A;  2CYZ B;  3FDR A;  4C8Q C;  3UA6 A;  2Y4X A;  4C5I A;  1OQK A;  1FMV A;  1OX8 A;  1K0S A;  2VVK A;  3LH5 A;  3CCJ A;  3A5Z B;  2E65 A;  1VQ4 Q;  2YRV A;  3VS6 A;  1RI9 A;  3X26 B;  1BIB A;  4RCB A;  4XQ3 A;  1MV3 A;  4DQ2 A;  3S6W A;  5J3B A;  4CC3 A;  3CCM A;  3M4G A;  2JJ9 A;  2V8I A;  2GBQ A;  3SD4 A;  3OYL A;  4JRP A;  3JB9 D;  3OW2 A;  2HSP A;  4C8Q F;  4O6J A;  1MV0 B;  4D8D A;  5I2S A;  2XHC A;  2VKN A;  1RAE B;  4MZM A;  2FPD A;  3VRZ A;  1VQ6 T;  4OML A;  2I0N A;  5FU6 B;  2B86 A;  2MCN A;  3RUX A;  2J7I A;  1H92 A;  2OTJ T;  4OB0 B;  3JCM Q;  2VB6 A;  1T0H A;  1QLY A;  2YSQ A;  1G3Y A;  2C0I A;  2K5I A;  3LWH A;  1B34 B;  2QAZ A;  3I56 A;  2X51 A;  3I55 A;  1KIK A;  4NL2 A;  3QZ5 B;  5CVI A;  4LE9 A;  2JW4 A;  1KHC A;  2DA9 A;  2E4H A;  1ZUK A;  2COW A;  4QT7 A;  2M16 A;  1VQN A;  2MI6 A;  3EGD B;  3SDZ A;  2DKG A;  3LGL A;  1KC8 U;  2YUO A;  1X6G A;  2DL3 A;  2AZS A;  2EYQ A;  3QG1 A;  5ECA A;  5FWB A;  3OSS C;  4L59 A;  4N0A A;  4KUD K;  1UHC A;  5IHK A;  1WYX A;  4ME7 A;  2O31 A;  3CC7 Q;  3OMC A;  5GAN 2;  4JJB A;  4PNO A;  1BI3 A;  3EFO A;  3OA6 A;  3CD6 Q;  4ATO A;  4J9B A;  1BIA A;  1B7T A;  1WI7 A;  3UWN A;  3VRY A;  1XJW B;  1UTI A;  3MP1 A;  2JNG A;  3CC2 Q;  1WHH A;  4D8K A;  4KT0 E;  2DZ9 A;  2CH4 W;  2YLB A;  2L3P A;  4ZTJ A;  2O4X B;  2V1R A;  2QQS A;  5FU7 B;  4OB1 B;  4RTX A;  2LJ1 A;  2LT4 A;  2GQI A;  2LQN A;  2NUP B;  2O9V A;  1WDX A;  3J80 E;  1WJR A;  8ATC B;  1BK2 A;  1W70 A;  2RF0 A;  2HQE A;  3L1A A;  1GFC A;  3VS3 A;  1VA7 A;  2DXB A;  1YHQ Q;  2NUT A;  4A54 A;  1QWE A;  2JXB A;  5KH6 A;  3UT1 A;  2RQR A;  5D6W A;  4OMN A;  1TG0 A;  4OB3 B;  2NUZ A;  2NLU A;  4M77 B;  4C5H A;  4HCC A;  1WX6 A;  2DJZ A;  4II1 A;  5HK3 A;  4HCB A;  1N8R U;  3R6O A;  1N9R A;  1IGQ A;  2K3X A;  2EGC A;  3HL8 A;  2XID A;  2O2O A;  2XG8 D;  3L2Z A;  4F7U B;  5FWC A;  1UUE A;  1YIT A;  5GAO m;  1G8X A;  2AHJ B;  4DBR A;  1UGQ B;  1Z9Q A;  4FM4 B;  3QII A;  3UA7 A;  1BCM A;  4PJO D;  3I9Q A;  2ZPG B;  2XDP A;  1QP2 A;  1KK7 A;  1JB0 E;  1VQ6 Q;  2EQI A;  3C0C A;  4MDW A;  1EZZ B;  4XTW A;  2OTJ Q;  1VQL A;  2O88 A;  1GRI A;  2QEX T;  5LJ3 j;  2LX9 A;  2MPX C;  1KC8 R;  2JMA A;  3CC4 T;  1M2V B;  2F5T X;  2IG0 A;  3CCU A;  1NEG A;  3OYA A;  4M7D E;  1LNX A;  1Q82 C;  3H41 A;  5KYY B;  2LDM A;  5KYN A;  3QSU A;  4JPB W;  2DIQ A;  2D0Q B;  3V7C A;  2L2P A;  1SG5 A;  4IIM A;  1WXT A;  3C4S A;  2FPF A;  2HBW A;  1SHG A;  3AT1 B;  3EG9 B;  3SHW A;  3MEU A;  5KCO A;  1VQP A;  4QVD A;  2JS0 A;  3JCM d;  4PFZ A;  4EMH A;  3CCJ T;  5IHI A;  2JS2 A;  4A53 A;  1M9S A;  1H64 1;  2HKN A;  3BY7 A;  1TWB A;  3MP8 A;  1GCQ C;  2HAX A;  2PVO B;  5CIU A;  3M0T A;  1E7O A;  3EGX A;  4E6R A;  2DRK A;  4DBQ A;  5KE2 A;  1OV3 A;  1IXD A;  4A4H A;  1Q7Y U;  4TVR A;  1V1C A;  2A0F B;  2F2X A;  2JN0 A;  1X01 A;  1E6G A;  5HKC A;  4M75 D;  5CKE A;  2X4W A;  4XTX A;  4AFZ C;  1EX4 A;  5IH2 A;  1UB4 A;  4WTO B;  1QCN A;  4XK8 E;  2KI7 A;  3CCL A;  3CXC S;  2HL5 C;  3DLM A;  1YNZ A;  1VQ9 T;  1IZ6 A;  4ZN1 A;  2HQX A;  1MUZ A;  4JRK A;  2RH2 A;  2EQJ A;  2QYZ A;  2RD1 A;  2DTH A;  3DLL A;  1B07 A;  1K1Z A;  4XTV A;  5CKH A;  2E12 A;  1JJ2 A;  1JJ2 P;  3VS0 A;  3HFO A;  4J9D A;  4M7A G;  2DET A;  3H8Z A;  1N8R R;  2DXC A;  2M51 A;  3HP9 A;  1G5V A;  1D09 B;  2RQT A;  1SPK A;  3CCQ T;  1YJ9 T;  4KGV B;  1QKX A;  1RAD B;  2QG9 B;  1D1C A;  4RUG A;  2RB6 A;  3CCV A;  2ROL A;  3CQT A;  4IUT A;  3QBY A;  3OYY A;  3REA B;  3TCJ A;  2E6Z A;  3CCS Q;  4L5G A;  1OI1 A;  2SRC A;  5AT1 B;  2PTK A;  2ZCF B;  1QCO A;  3EFO B;  1OUL A;  5D6X A;  1PD1 A;  1ZQ1 A;  3QUI A;  5CKD A;  1KQS S;  4RTT A;  2YRC A;  1KD1 U;  4C0D B;  2FHD A;  3VV0 A;  1VQ7 T;  1WHL A;  3RKX A;  2GFA A;  3A8L B;  1JXM A;  1U8R A;  4AT1 B;  5EC7 A;  4RMO A;  2GTJ A;  4C8Q E;  2RK1 A;  3PNW C;  2QEX Q;  1ZLM A;  1GFD A;  4J9H A;  1C1A A;  3CC4 Q;  3QWY A;  1K76 A;  5I22 A;  4OMM A;  3C95 A;  1U1S A;  1N6A A;  4J6W A;  3E19 A;  3M0U A;  4PJM A;  1R0C B;  4M7D C;  1PD0 A;  3CCE T;  1CSK A;  1W6X A;  4M78 G;  1X6B A;  1PM3 A;  2NUT B;  2E6N A;  2ZZD A;  1ACM B;  3CCJ Q;  4AG2 C;  2K2V A;  1M8M A;  2DD4 A;  2LMJ A;  4BE1 A;  1JQQ A;  1Q7Y R;  1K8A U;  2KXD A;  2EQM A;  2D8J A;  2LVM A;  2DE0 X;  4R55 A;  2XI9 A;  5LJ3 f;  1VQ5 A;  4MZP A;  3FC3 A;  4M7D F;  1K9M C;  3EHQ A;  4DOV A;  1TUD A;  1NPR A;  1I5O B;  3QXE B;  1QKW A;  1PRL C;  1SSF A;  4LN2 A;  1WHM A;  2F5K A;  4Y28 E;  4MDX A;  3VS2 A;  4JZ3 A;  3DB4 A;  2DJQ A;  4V2S A;  4MML A;  2BZY A;  2DYB A;  2L89 A;  2L8D A;  4FW2 A;  3G4S T;  3CCR T;  4A4F A;  1WJQ A;  5D7U A;  1CKA A;  2K6D A;  1FYN A;  2ZPB B;  4KRT A;  3CBM A;  1A0N B;  3J81 E;  1AT1 B;  2BUD A;  2MMP A;  1VQ9 Q;  4ESR A;  3MHX A;  3G71 A;  4J5Y A;  1VQO A;  3OYB A;  1W4S A;  1VQN Q;  3VYH B;  2CP3 A;  2MWP A;  4BI8 B;  2EIF A;  3R6N A;  3FRN A;  1YBY A;  5GAN 4;  2K2M A;  4E7J A;  3A8O B;  3HKS A;  2RK2 A;  4M7A A;  3KUF A;  4VUB A;  2EW3 A;  2L3S A;  4LDX A;  3AHU A;  2DBK A;  5HY6 A;  1OU9 A;  3CCQ Q;  1YJ9 Q;  2ED1 A;  2GFU A;  1I5L A;  3OYD A;  1E6H A;  2DFU A;  2D1X A;  2VGN A;  4RTV A;  2KMT A;  2VXE A;  4DA4 A;  1ZSZ C;  3TEE A;  4CC7 A;  1NYF A;  3P8H A;  3NTH A;  2RQU A;  3REB B;  2VYT A;  1MHN A;  4C5G A;  2QDY B;  4J7F A;  4M77 D;  2CP6 A;  3BW1 A;  1G83 A;  4PK4 A;  2ABL A;  3TU4 K;  4UC4 A;  1TUC A;  1Q81 U;  3EGX B;  2CT3 A;  1BI0 A;  2RO0 A;  2R58 A;  3MCA B;  1VIE A;  5FW9 A;  1RAI B;  2CP0 A;  2LJ3 A;  2DIL A;  3JCM J;  1ARK A;  1VQ7 Q;  1AOJ A;  3LYI A;  1M3B A;  2KK4 A;  3Q1J A;  4O5V A;  2RI3 A;  4EIK A;  3NPF A;  4FW1 A;  4M75 E;  2V8J A;  3JCM X;  3OYG A;  3M0P A;  2J6K A;  2G6F X;  3J7A F;  4BAC A;  4LD6 A;  3L2V A;  1M4Z A;  2A36 A;  4BD3 A;  2JTM A;  2CSI A;  3NMZ C;  1Y71 A;  2OI3 A;  1VYV A;  2KR3 A;  3G6E A;  4WF2 A;  3PMI A;  3H9N A;  5HK0 A;  1PRM C;  4OP0 A;  1XTD A;  4C5E A;  1MMA A;  3OYK A;  2OTL T;  4NL3 A;  2BZX A;  1M90 U;  4IUP A;  3HRU A;  1N9S A;  1K8A R;  2K5L A;  3CCE Q;  3I35 A;  2CUB A;  1GXI E;  2KSS A;  4OGC A;  1MND A;  4BDZ A;  1YIJ A;  1VQK T;  4J9E A;  3EG1 A;  2AKK A;  3BE3 A;  1Y0M A;  4M78 A;  3VKI A;  3LW5 E;  4MMK A;  4M4Z A;  5DLQ E;  4X9C A;  1RLP C;  1G3T A;  1D1A A;  2F1L A;  2VUB A;  1ZSZ A;  3TSW A;  2CRE A;  2DLP A;  3RMS A;  3SWN A;  1M27 C;  1KC8 C;  1Q86 U;  2DF6 A;  2KQW A;  3CPF A;  1LOJ A;  1IRE B;  2DBM A;  3HSB A;  1RI0 A;  3OSV A;  1R8O B;  2CUD A;  1K9M R;  2GQV A;  4HCZ A;  2QA4 T;  2DXU A;  3PTA A;  2E41 A;  4EPC A;  1TU0 B;  3QYH B;  3QYG B;  4DOW A;  1BI2 A;  3G4S Q;  2K3Y A;  3CCR Q;  4J9C A;  1NJI U;  3CME A;  1I4K 1;  5J26 A;  1VIF A;  2KAF A;  4GLK A;  4EMK A;  1RAA B;  3NHN A;  3EG2 A;  1UE9 A;  4PJO C;  5GAN 6;  2YLC A;  3S3M A;  3FJP A;  1VQM T;  2EYW A;  2FZC B;  4C92 E;  1YJW A;  1VQ8 A;  2EVR A;  4C8Q A;  4FSS A;  3WVD B;  3E1S A;  1FWZ A;  1M1K U;  2MYS A;  2OX7 A;  4JUV A;  2DYI A;  3QJ6 A;  1SHF A;  1YJN A;  2JZ2 A;  1WXU A;  2G3R A;  2W10 A;  5GMK e;  4C0G A;  1KFZ A;  1UEC A;  1Q81 R;  4BDY A;  2HL3 A;  4FL6 A;  1T3L A;  3OBW A;  4FYV B;  3CBP A;  3VU3 C;  1S72 A;  4XTY A;  3QZ9 B;  4FU6 A;  2ZAE A;  4PL6 A;  1RAH B;  4E7K A;  5IAY A;  4JLI A;  4BE2 A;  1UDL A;  2RHU A;  4KUL A;  2WSE E;  4OMQ A;  1N8R C;  3P8B B;  4OMO A;  4LUD A;  4OGE A;  3TRE A;  2GGR A;  3MPU B;  4Y92 A;  1QVP A;  5GAN d;  3ME9 A;  5CQX A;  1YI2 T;  4M75 C;  3RMQ A;  2FB7 A;  1AWW A;  3HRT A;  1UHF A;  1X43 A;  2OTL Q;  1W2B A;  1W2B P;  1KQ2 A;  4JRI A;  1VQ4 A;  3CCS T;  1RLQ C;  3OYC A;  2RJD A;  4R56 A;  2YWW A;  4HT8 A;  1G2B A;  1OOT A;  1CKB A;  2MOX A;  3SFM A;  1VQK Q;  4QQD A;  3L2R A;  1AEY A;  5LJ5 e;  4HA8 A;  4M7A B;  2DMO A;  1Z9Z A;  4M75 F;  5GAO l;  2BTT A;  1BYM A;  3MP6 A;  4HCK A;  1XOV A;  2YUQ A;  5GJV B;  1PSF A;  3M0R A;  2D8H A;  1LJO A;  2HQH A;  3NTI A;  3X28 B;  3JCM f;  1NJI R;  5GMK h;  2PVD B;  1PKS A;  3JCM e;  4CI0 C;  3JCM P;  4KGZ B;  4M77 E;  4BE0 A;  1PNJ A;  4J6X A;  2HBP A;  1MNE A;  3CMA A;  4IUR A;  1JJ2 S;  2QA4 Q;  5LJ5 d;  3L2W A;  1WQ7 A;  3OBY A;  5GAN h;  1M1F A;  3X20 B;  4XU1 A;  4RTZ A;  4A4G A;  1HXD A;  3OB9 A;  4F7U E;  1LPL A;  1IGU A;  2RHZ A;  2E5K A;  4E47 A; 
#chains in the Genus database with same CATH homology
 3CCV Q;  1KC8 R;  1VQ4 Q;  3CCM Q;  1K73 R;  3CC7 Q;  1Q81 R;  3CC2 Q;  1YJN Q;  1S72 Q;  3G4S Q;  1YIJ Q;  3CCR Q;  1QVG P;  1YI2 Q;  1Q86 R;  2QEX Q;  1KD1 R;  3G71 Q;  2QA4 Q;  1VQM Q;  1VQO Q;  1K8A R;  2OTL Q;  1W2B P;  3CCE Q;  3CC4 Q;  1VQL Q;  3G6E Q;  3CD6 Q;  3CCQ Q;  1YHQ Q;  3I56 Q;  1YJ9 Q;  3I55 Q;  1VQ9 Q;  1VQ6 Q;  3CXC P;  3CCJ Q;  1YIT Q;  1VQ5 Q;  1QVF P;  1VQP Q;  1YJW Q;  1JJ2 P;  3CMA Q;  1VQ8 Q;  3CCL Q;  3OW2 P;  1M90 R;  1Q7Y R;  3CCS Q;  3CCU Q;  1NJI R;  1VQN Q;  2OTJ Q;  1K9M R;  1KQS P;  3CME Q;  3CPW P;  1Q82 R;  1VQK Q;  1VQ7 Q;  1M1K R;  1N8R R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...