3CCMI

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3ccmI00
1HC8A 3CJTB 2E36A 1VQ9I 1VQ5I 1VQLI 3CCMI 1VQ8I 2FOWA 2ZJQF 5GAHJ 3G4SI 2ZJRF 1YIJI 1QA6A 3CCEI 5DM7F 3G6EI 1VQKI 1YJWI 1VQ7I 1VQOI 2OTLI 3CCQI 2E35A 1YJ9I 3J7ZI 4IO9F 1MMSA 5JVGF 1YHQI 5DM6F 3CMEI 3CMAI 3I55I 2OTJI 1YJNI 3CCJI 2QEXI 2K3FA 3J7YJ 2ZJPF 2NXNB 5GAEJ 3CCSI 5GADJ 1FOWA 1S72I 3DLLF 4IOCF 3G71I 4UY8I 1YITI 3CC7I 1ACIA 1VQ6I 2JQ7A 1FOXA 3CCUI 3PIOF 3I56I 3CCRI 1VQ4I 2E34A 4V19K 3PIPF 1YI2I 5GAGJ 1VQPI 3CC2I 3CCVI 2QA4I 1VQMI 1VQNI 3CD6I 3CC4I 3CCLI 1FOYA 4IOAF 3CF5F 1Y39A 2H8WA
chains in the Genus database with same CATH superfamily
3CJTB 4CCKA 3C2GA 2WAEA 2Q2EA 2YX4A 2FRHA 4IHYA 3V8JA 2BHZA 5D6EA 5DUKA 3LQRA 3JRFA 1QHGA 4RB0A 2B9SA 2WAQN 4PFPA 4BKXA 2OV7A 2V9VA 3BWGA 4BHCA 4F92B 3O6BB 1IXCA 2GA1A 3JTHA 4BEHA 1XSVA 2RGVA 1VQOI 3TEDA 1VFCA 4RB2C 3LOCA 4C2MJ 2FXAA 2X9DA 4EGYA 3GTGJ 1YJ9I 3FX3A 1XSXA 2KIUA 3GTMJ 2IA0A 1K4TA 4C30A 2KKOA 5FFXA 1FMVA 5A2QK 1GHCA 1XD7A 3GTKJ 3D1NI 2ZCWA 4IQJA 2VKDA 2EK5A 3VYSB 4X1EA 3P9CA 3GZ5A 3I55I 5C4JJ 2DCEA 3TO9A 4G7ZF 3FXRA 2ZJ2A 4M6YA 4DGWB 1KU9A 1QZYA 4G6DA 3S16J 2P6SA 2EFQA 3ISPA 4ZC3A 4KIFA 3SZTA 2P7CB 2PN6A 3KP4A 1UFMA 2DDAA 1OR7A 5FROA 5EZGA 1V5FA 2XF5A 2BZTA 4XNFA 2FUG2 5DCMA 2HDCA 5EG0A 2QENA 4HRIA 3CLOA 1FOWA 2DPUA 1DP3A 5E8GA 1JGGA 4EM2A 2HKXA 2DFHA 4XLPF 2EILH 1LDDA 2JA8J 3K6GA 4EATA 1MJAA 1G4DA 5FO5A 1LE8B 3BTCA 3GEZA 3HUGB 5B5EC 4I2OA 4G7HF 4O6JA 2KLOA 1KONA 3GZ6A 5L3EA 2LD5A 3LSHA 3E0JB 3B6CA 3CESA 1MMGA 3JRBA 3HB9A 4BYYA 3L00A 2ELHA 1K83J 1WWXA 3DKYA 5M5XJ 1LPQA 1JUMA 1NG6A 4H4KC 2DPDA 2HVSA 2EV0A 5BPIA 4EM1A 1DPRA 1TT0A 2RN7A 3V7CA 1K7AA 2JWTA 1IZ1A 1U5TC 4I09A 3BPVA 2YX7A 5FLXZ 2QA4I 4BXFA 4BY1J 4BE1A 3RJPA 2WBMA 1IXSB 5F0FA 2X51A 1CF7B 3OS1A 1SVLA 3KP7A 1BI0A 2LKSA 3KZZA 4LLNA 2VONA 3NQOA 2DMUA 1A35A 5JVTA 3LSGA 1FTZA 2F4OB 3WHCA 3OL3A 2E5ZA 2ZXHA 4MO7A 4HQMA 2E1MB 2CWEA 2FBHA 4E7IA 1E3OC 3MKWB 2CUFA 3BJOA 2YU9J 2LC2A 1M1EB 2M0CA 1R6RA 2HPIA 2XUBA 3FMRA 3Q0UA 2VKHA 1X4PA 2LYCA 2NVYJ 2ZJRF 1YTYA 5F27A 3REOA 3WU2C 2VQHA 3I71A 3M8FA 4CCMA 2VLAA 5D5VB 1B1BA 1XGOA 2KFDA 1YS6A 2C6YA 5M3MJ 2NS0A 1XPXA 1SC7A 1G2HA 2CV0A 2UV1A 3PQJA 3ZMUA 4BU2A 3OYHA 5HLHA 2QM3A 3BG6A 3K4MA 4PK4A 2MC3A 1TQPA 3BTLA 1HCRA 1QPMA 3I58A 2D45A 2FMLA 1NK3P 2LR8A 1EH7A 1QGPA 2WAFA 2X1EA 2WWYA 3HPHA 3CCJI 2WC2A 1YJNI 1BC8C 5F0HA 4LIVA 4F91B 1KU7A 4IQ4A 5IP6A 4AC0A 2IS1A 5BQTA 3FMSA 1EH8A 1MD0A 3DKXA 4K2EA 4KICA 4XLHA 2Z3YA 4BGDA 5HNFA 2OUMA 5FKMA 1Z6RA 1P7JA 4G6QA 3CLQA 1GV5A 5M3FJ 2F48A 4UUSA 3AAFA 4AU7A 3CCSI 3JAMK 1MBFA 1Z7UA 2PMUA 4ZZLA 3TQNA 4D1QA 1IGNA 3ASOH 3R4KA 2AHQA 4B4CA 4AYBA 1GT0C 2EZLA 1PP7U 5DD8A 2DFIA 1OR7C 3RDIA 2XDVA 1GXPA 3M4OJ 1B8IA 1UZCA 3MZYA 4V2FA 1PUFA 3EDPA 2FOKA 1DUXC 3ONQA 2QUFA 4XKVA 2KZVA 3WODF 4RA2A 1ZR2A 4GXOA 4V19K 2OCCH 5D5WB 1I6HJ 4FE7A 4DQ2A 3WGHA 2XF7A 1X1BA 1H89C 1ZK8A 2HVQA 3A1YA 4E7LA 3OWTA 3CD6I 1NH3A 4JK1X 3KP6A 1KZHA 3V42A 5FRMA 3OYKA 4XOTA 1D1CA 2VJJA 1T0FC 3R60A 4A3EJ 2HU9A 3I3LA 2E1NA 5JHFA 4G12A 2P8TA 3L09A 4E6KG 2XC7A 1HC8A 4I98B 2W1OA 3DU5A 4JX5A 4RM3A 3JTGA 1FIAA 1USSA 2E2JJ 1ZG5A 4A3BJ 1F36A 1A5JA 3AL0C 2V1UA 3JRAA 3F9KA 3Q0VA 3G4SI 3FXKA 1YIJI 1SFXA 4CCOA 3DXJF 2PG4A 2VPLA 1XX5A 4IHSA 5JR3A 1S7OA 1SD6A 2R7WA 1VQ7I 2R7RA 4UUVA 3OIQA 4LFUA 4LMYA 1QRYA 1E0EA 3U21A 2QQ9A 2XROA 2BVMA 4KISA 3L2WA 1V55H 3KCCA 1F43A 3ZMZA 5L3BA 5A2QZ 2CSOA 1FC3A 1WVRA 2GQQA 3CJRB 2CRGA 3NAUA 3TO7A 2Y9ZA 4LK1F 2R5YA 3K4JA 2OAZA 4MFEA 2RQQA 4Y15A 3CMEI 2NVXJ 3HL2A 2RVCA 1U2WA 5H6QA 2VN2A 4M3DA 4WCGA 2K85A 4GGGA 1Z3XA 3KFWX 2JSCA 3DTEA 4A3IJ 3H36A 3ZPLA 3A01B 2ID6A 3ABKH 5EYRA 2PI0A 2E1CA 2HDDA 1LVAA 2MSYA 1R49A 1GVJA 2NYXA 3S3MA 4I01A 4OMYA 3HEFA 1Y56A 2FE3A 2CUEA 2Y0SA 3GFJA 1A04A 4GDFA 1FYLA 2MFZA 2DK5A 1B59A 3QYBA 2CH0A 3OYFA 2O8XA 1QBJA 2IGNA 5B66C 2O9LA 1G3SA 2HNHA 2KDZA 2O61A 1TWFJ 5ILVA 4U88A 1DPUA 1XB4A 2L0KA 1K79A 3K69A 1K78A 4HF1A 1LQ1A 1IUFA 4IJAA 4C9YA 2R7VA 1O3TA 2D2WA 3M9AA 2BGCA 1RR8C 2TCTA 2ZNYA 5CVJA 4XSXF 3DEWA 4ITVA 4M9SA 2M2EA 2DXIA 4OU0A 4Y17A 2EZIA 3L2CA 5DV5A 4FASD 5IYCJ 3I59A 3RZOJ 2BXYA 4B48A 1SD4A 2CS3A 2PMHA 3C1DA 4UVAA 2L9NA 1ETOA 4S0HB 1J09A 4XKCA 3G1MA 3S2HJ 3KLOA 3F22A 1CQTA 3HPGA 3FKIJ 2P7VB 2ZXIA 5CVRA 3RI4A 1FEXA 2I5UA 2EINH 3K4KA 4GCVA 3CF5F 2R0QC 3BG7A 4BHPA 5ILUA 1WJ5A 2GOXB 3OYIA 2ZKZA 3M8JA 1I5ZA 2VKVA 3HTUA 2E1MC 2KIQA 3QP6A 3ERED 1SEUA 1ORKA 2L9SA 1GV2A 4GFBA 2A5YB 4P1WA 1R00A 1FWZA 5HDGA 3DLAA 4C3HJ 2Q1ZB 3E1SA 3HKZA 4A0YA 4PDKA 3TO6A 2EPFA 1XGSA 2E5NA 5TGTA 1F5TA 1ETYA 5KK1A 3CCEI 1MBJA 2E2HJ 3LAPA 2R7DA 1YIOA 2XAFA 1ZLJA 2FJ1A 2ME6A 3ZQGA 1IRXA 5FKNA 5K7HA 3PSIA 4EEFG 2A69F 2ZMEB 1ONVA 2DI3A 4I0BA 5E79C 1TBXA 2F6CA 4HYEA 2W7NA 3KEOA 3S1MJ 3DBHB 1FBSA 1YHQI 3NRVA 2DA3A 3CMAI 4ON0A 1UELB 2XAGA 3L7WA 4IRIA 2DA5A 5FB2A 3F8FA 1N78A 2EIKH 1WJDA 2EBIA 2AXTC 4QLCU 4XK4A 1IV8A 2A6EF 3FMQA 3H5AA 3H9QA 1ZYRF 4YFXF 1I1GA 3JREA 3EETA 4UXNA 3DFGA 3M3YJ 3RZDJ 1LEAA 3A03A 1XS9A 3FM3A 4B47A 2EFPA 2CW0F 2BOLA 5EZHA 4CYCB 4BH9A 2OD5A 4YFNF 3IL2A 2DO7A 5GPAA 2DK8A 2KRHA 1ETQA 2VXDA 5FJ8J 4A6EA 1MDMA 3WU0A 2L9VA 4G9YA 3HTSB 3DPLC 2ESHA 5J4VA 2I8DA 1VQ6I 1MH3A 3L2RA 1WJAA 3F0CA 3FF5A 2XPUA 1WKMA 3DP7A 4AIJA 4DBQA 2DT6A 4PJ0C 4ENKA 2DA2A 2LF7A 1JKRC 2RREA 3GFMA 2KPMA 3C2HA 4GYGA 3GF2A 3QOEA 5EGOB 3OS0A 3BPXA 2BW3B 2K02A 2M4GA 1R1UA 4A3GJ 2G9WA 2XSJC 1T56A 1T2KA 5CJ9A 1T8IA 1ZH5A 2GM4A 2IGMA 3ELKA 2KZGA 5CVVA 4DOZA 2JRMA 1ITYA 3WTUC 2W82A 4OIQF 4A2UA 2DOEA 4FCYA 2HTSA 2DDBA 1QPIA 1R5GA 1GXQA 2EA4A 2XB5A 1YG2A 2P4WA 4XLEA 3U1KA 3E6DA 2QLZA 5J8CA 2UXXA 4XR6A 2M34A 3JRCA 3O8HA 1ETWA 3RQIA 2L3DA 2HGCA 4NQWA 1HW1A 3QP5A 4KYWA 1IDYA 4CHUA 4RB3C 2ZXJA 3AKZA 2KL4A 1MNEA 2ZJQF 3FIWA 5AIPA 2KDOA 1ZGAA 2V9KA 2PLYA 4CICA 2BE5F 2STWA 4HPQA 3S2WA 1MMNA 4CCJA 2E1OA 5BNGA 2X48A 1QZEA 4A93J 5CQEA 4AIDA 5E17F 1OISA 1SFEA 5CVIA 4U7BA 3VB2A 2X6YA 5J3LA 5D8KB 5FFZA 4GRIA 1L0OC 4I02A 2R7FA 1REPC 2ZC2A 4AIKA 2FMYA 4HDVA 1BI2A 3TMOA 3VYUB 3K4LA 2Z5UA 2R4GA 3CO6C 1UJ8A 3FXJA 4U0WA 1X2NA 4L5EA 1A6QA 2O7OA 1LJ9A 5CQGA 4BHBA 2O5RA 1S8NA 4Y52J 2RDPA 4QTRA 2LTPA 2XPWA 4PJMA 1E2XA 1FP2A 1U78A 3CMMA 1F4KA 1N75A 3WTTC 2VKEA 3W6KB 1NK2P 4U7DA 4U0VA 2BY0A 2ACJA 2HQAA 1Z21A 1H9GA 2LP0A 2XGDA 1FLIA 1SFOJ 5F04A 4I0AA 5LLQA 2MG4A 4C3JJ 4A3FJ 4M3EA 4UY8I 2XAUA 2V6EA 4UB6C 1S3JA 3GO5A 2JA5J 3FISA 3CDLA 3QPLA 2WY7Q 5HS8A 1D3YA 1FSEA 3BQZA 3IRRA 4I99C 4BUPA 5B3SH 1XMXA 2QQBA 2VQCA 5J47A 2Z16A 3I9V2 3I56I 3OL4A 4XM3A 2IRFG 4ASNA 2JRTA 5E3NA 4YFKF 4HAMA 2E7XA 2M45A 3CP2A 3HGGA 3T0YA 3QPTA 1VQPI 1WH5A 3E6MA 4EJUA 1I27A 3NEUA 3KETA 4ESBA 1TTYA 1POGA 5D8LB 4HX8A 1O3QA 3CC4I 1PDNC 4DYCA 3ABUA 1JTYA 2R7TA 3L9FA 1EKEA 3F72A 2VXZA 3KIOA 3BDDA 3MMYB 1AU7A 3KEQA 2ZSIB 1CGPA 1VZ0A 1R5HA 2WY8Q 1G3YA 1FZPB 1NG7A 1UHSA 3MKLA 3U2RA 4F93B 4KDPA 3GTLJ 1OCZH 3CUQA 1WH7A 3CCMI 3GVAA 2PJRA 4M71A 4A3JJ 2L2OA 5DS9A 2JA2A 5EEAA 2A07F 2EB7A 2LSOA 3RKWA 3MKYB 2VPRA 5F6FA 1WI3A 3FBIB 5FD6A 2Y31A 2GIZA 3K1NA 4DYRA 5K5RA 3HDDA 1P4WA 4X0GA 1PVEA 3K0LA 1BM9A 3IH4A 2X1DA 3DU6A 1PUEE 1TZLA 2Y75A 1T38A 2ZMEC 3A2KA 1W5CC 1D0ZA 3K1PA 3QU3A 2NNYA 3GTOJ 2R7OA 4FTHA 3GZNB 3JW4A 3QAHA 3DKWA 2EFOA 3ECOA 1TQMA 2I10A 1UHMA 4JOMA 1R71A 1JGSA 3KP2A 2QVOA 4LG0B 1SD7A 1FT9A 4EJOA 4CH7A 3VEPA 1HLVA 2LRDA 3COAC 3F6VA 2HYFA 4LLLA 2OZUA 5C44J 2MH9A 3ZQHA 3R0AA 3B02A 5B1AH 5JI6A 4PCQA 4RAYA 3ECHA 2CFOA 4R8HA 2Y69H 3ABMH 3TOBA 1W36D 1LUJB 3EPZA 2BBYA 1RPWA 4ZDPA 2IVMA 4A5NA 3O8GA 3BR2A 4O5VA 3HZJA 1WGXA 2BY1A 2ZXWH 2AXLA 5JFRA 2VE9A 3CC7I 2PQ8A 1P92A 1QHHD 5FGMA 3HG9A 4MEYF 5J1YA 1APLC 4ABZA 4RGXA 2R5ZA 3D5RC 2JQ7A 1SFKA 4EJVA 1G6NA 3OIOA 4IHTA 4AYBN 3ZQLA 3K70C 3FXQA 4EJTA 3A4CA 1MMAA 3FK7A 4XKBA 5KHDA 2PMZA 2OZ6A 2PBIA 1FP1D 2E34A 3KPHA 1HKTA 3PO2J 2H6CA 3NARA 2ZO4A 4LG3A 1B72B 2CO5A 2OQGA 4MLOA 2EFNA 5LGTA 4C2TA 2CGPA 3CO7C 4RAZA 3OYEA 3LL7A 3O2PE 1TP4A 1RZ4A 2ZNZA 4YIIA 3IKTA 3G1LA 2V7FA 4PZJA 2CUZA 3TP0A 2LY9A 2HTJA 5E1WA 1RR7A 3HRUA 5LFAA 2K9LA 2L5QA 1QZZA 3TOAA 4BY7J 1TWCJ 3BR1A 1BR2A 1JHFA 2K40A 3S2DJ 1T0FA 2A6TA 2FD5A 2X6WA 1OMIA 2IEKA 3MD2A 2TDXA 2WB1A 1MJBA 2H1KA 4JQFA 2MW8A 1HW2A 3D5LA 1MNMC 1SVMA 1YW7A 2IPQX 2FX0A 2P0WA 5EDNA 2OBPA 5LHGA 1R5ID 2O8KA 5FKLA 4LD5A 1YJWI 4LJZF 1BI3A 2IT0A 1HW5A 2NS7A 2CQKA 5ILSA 2HVRA 1J75A 4IHVA 3CUQC 5LRSA 3M07A 1V5GA 2J5PA 2H27A 4LIUA 1UMQA 3GFLA 3U9GA 4D5FA 1U8RA 1MMSA 4CSWA 1E3HA 3H3VK 3CP8A 2NAZA 1RNLA 3ZQ7A 5J8FA 4TV7A 5DM6F 3BC8A 3PQKA 4KT6A 1OCCH 4ZDOA 1PUFB 3I64A 1P4XA 5E1ZB 3JR9A 4B3AA 2L4MA 2E2IJ 1OYIA 2Z2SB 3HSRA 3RIRA 4XL9A 3ZR8X 3E3VA 2JA7J 2QYOA 1QQIA 1WJCA 2K9NA 4OMZA 1FY7A 4KA4A 4Q4ZF 1AWCA 2RQPA 2NXNB 4M72A 1U8BA 3HIFA 4NUBA 2P5LC 4V2GA 1X3UA 4WX9A 3LA7A 3WTZA 2IAIA 3WTYC 3F3XA 2R92J 2IP2A 2QZ8A 4GO1A 1IAWA 2VBWA 3BJ6A 4XMYA 4IOCF 3KE2A 1W4MA 2JT1A 3J81K 3JSOA 2F5FA 1E17A 2HS5A 3I5UA 5LEKA 1HQCA 4HDUA 2DMNA 1YRNB 5FD5A 3RSNA 5HS7A 1IDZA 1J9IA 1SAXA 2Y0SN 5KVRA 2A68F 4KMUX 3A0HC 2BY2A 2EIMH 4B44A 1JT6A 3OR2C 2Y30A 3BZKA 3OYLA 3LQQA 2VQLA 4FETA 3JRDA 1LE8A 3HGYA 3HUGA 4ESJA 3LSTA 3HHHA 1W5TA 2EFWA 3M1CA 3SYTA 3H3ZA 1TNTA 1BR4A 4NC7A 4W97A 2PX9A 1X4OA 2HOEA 4KITB 5FKOA 3PUBA 2QKMB 4YEJA 4C3IJ 1MKMA 5DTDA 3K4NA 4E4HA 4IOAF 3AG2H 3K1MA 1T33A 2FNPA 4F52A 2WV1A 2GXGA 4JX6A 2MBFA 2P5VA 3ZMVA 1CF7A 1Z91A 1HXDA 1JKQC 1ZQ3P 3S93A 1VQ9I 3HXLA 5L3GA 2V6CA 3S32A 1QVUA 1H88C 1FBUA 1WJEA 4A69C 3ZOBA 5JHUA 3IH3A 1JJ6C 4XN0A 3LFUA 4HOBA 2IS2A 2ISYA 3MWMA 3IP4B 2LF8A 1OJLA 2XIGA 2ZB9A 2LBFB 3SFZA 1P6RA 1S9HA 3P9KA 5IT9K 2JMWA 3SZGA 4RAFA 3HKZN 2QGUA 2HXIA 3JRIA 1ON2A 4J00A 3MFKA 5M5YJ 1RKWA 2ID3A 3OV8A 1B9NA 3M7GA 5F0CA 2W24A 2KMUA 4XLAA 4MFDA 4OIPF 3Q0WA 1W5SA 2OU2A 3FBNB 1XTAA 3PL8A 4U0YA 1RIOH 4ENMA 4RLQA 3VDXA 1HSTA 1Z1DA 3QOPA 2FF4A 4RS8A 4F7ZA 1BC7C 3IHUA 3A0BC 4I6ZA 1ETXA 9ANTA 2R7QA 1EJ9A 2JSPA 2YSRA 5D4SA 5LEJA 4OIOF 4XOPA 1I39A 3I59B 2E7WA 5HODA 1IUYA 2UWMA 1LDJA 5IYBJ 2HQRA 3HOVJ 2AO9A 2DT5A 3OYJA 1GDTA 4OWRB 2D5VA 2GBYA 3EUHA 2XAJA 3PSFA 3IWFA 3I4NJ 4DZJA 3I53A 3DPTA 3RPQA 5JLXA 4YIFA 5B1BH 1RI7A 4IHWA 2K5CA 3KZIC 3W6JB 1BW5A 4JBAA 3BR6A 3WTSC 4CA0A 1AKHB 4FX0A 4L9JA 3FK6A 4RGUA 1LFBA 2IS4A 1Z3YA 3S8PA 3CCUI 3BJAA 4NB5A 3OYMA 1JKPC 2M3AA 3TGNA 2L7FP 3OSGA 1WI9A 3HOXJ 1TWGJ 4R1HA 3PIPF 4P55A 2ZFUA 3BG9A 1U3EM 1IG7A 2CV1A 2E60A 1WRJA 4R79A 1TLHB 5F1JA 2HEOA 5HOOA 4JX4A 1UG2A 3JSPA 5KCMA 1O57A 1IF1A 3ZQFA 2B63J 4LB5A 5L3DA 2DLLA 4XRFA 2F5VA 2MA3A 1SVOA 3OYAA 4KN4X 3NWTA 1LFPA 4PJJA 4L9VA 2HZTA 2E36A 5HDKA 3DPUA 4G8XA 3W2WA 1ZRDA 2R93J 3SJMA 1HA8A 1FOKA 5TJJA 3KYCB 5KNLA 3SDGA 2R7XA 3K10A 2A3SA 2EQRA 4A3MJ 2LNBA 4J01A 1V54H 2XGCA 5TISC 3UKGA 2VQGA 1GUUA 2E19A 4A0ZA 2W84A 4XLFA 1G3TA 3TW7A 1UB9A 3BY6A 4BBSJ 2JVGA 4EQQA 3CJQB 1WHUA 5CPRB 5F1RA 2HYJA 4M9XA 2V79A 3ULQB 2QBYB 1ZELA 5HLTA 3F6OA 1IRFA 3LFKA 1BOAA 3ZQCA 3LSMA 1RETA 1D1AA 1WQ2A 2M7AA 2P5KA 2QSHX 2LY2A 2LVSA 2F5CA 3WU1B 1TC3C 1RUNA 3DTIA 4A6DA 4ANJA 2RV8A 5FKKA 4B3XA 4P9UA 2W25A 1YQAA 2DQLA 4IX7A 4NDLA 5E18F 2HKOA 4HSTA 2JVHA 2CQ7A 1WCMJ 1WFXA 2ME0A 3A01A 5GTHC 1DQUA 2IXSA 2BXZA 3J81Z 4Y3OA 3VPRA 2XV4S 1ETKA 5L3CA 4CZCA 3OYBA 2HR3A 1BN5A 1AA7A 4Z2YA 2JPBA 1H0MA 2HQ5A 3RKXA 4BXXJ 2B0LA 3OYCA 2K27A 1VTNC 1MW7A 3EUHC 4B8XA 4NQWB 4HG2A 2JN6A 3PFIA 3MN2A 4DJAA 3JAMZ 2COBA 1O3SA 3OIPA 1IRZA 3IC7A 2UXNA 1MBEA 1VQ4I 3EYYA 1X3WB 1WPKA 1YW9A 2VBZA 3CC2I 2VUMJ 3TKYA 3P7NA 4HLYA 3PUFA 3EQLF 1VQMI 2CQNA 4MTEA 1EA3A 5ICGA 3IV5A 3QODA 1XG1A 5FLMJ 5BOXA 2LH9A 4G6TB 1BJAA 1Z0XA 4ZDLA 3BOQA 4RAGA 3ROUA 4XRSG 2XRLA 4OAYA 2ICWG 2EJRA 1U0JA 3H5RA 1FJLA 2O3FA 1WJBA 2DQRA 4HNVA 1MH4A 2PJPA 3AFHA 2IGKA 2GA2A 5DCFA 2EIJH 3DQVC 3LWFA 3E5XA 4M9ZA 1VQ8I 5LGUA 3MQ0A 1K61A 3ZCOA 3G2BA 2F4MB 1YX5A 3IKVA 4MNUA 3IAM2 3DEEA 2HYGD 3DEUA 1T39A 2KHMA 3HOTA 2VASA 5IT9Z 1JI8A 1MBHA 3DBLB 5DM7F 1VQKI 2YR2A 4FISA 2ADUA 1BOBA 3ZP5A 4P5OA 3KEYA 2QCOA 4N0BA 3K4BA 4CUGA 3C18A 5K1YA 5IYDJ 2X4HA 3Q5FA 2BY3A 3RKYA 3MKZA 1Y6IA 4M3GA 4IO9F 3QU6A 5D6FA 5IOYA 3Q9SA 1OKRA 4BDZA 2DN0A 4BQOA 2V4JC 3GTJJ 3QYFA 3F8NA 3HRSA 4ZTFA 2ZMEA 1XCBA 4ENJA 1AOYA 4DYQA 4Q47A 3R0JA 4B09A 1FPQA 4HEA2 1R1TA 2W48A 1W7PA 3E97A 4D9JA 2K3FA 4AVZA 2EV5A 2DBBA 3J7YJ 2X6XA 1KQ8A 5HNHA 4AD9A 2EV6A 2AQFA 1HF0A 1BIBA 1X2MA 4EGZA 1U5TB 2BHYA 1TWAJ 3JRGA 1A6IA 1UAAA 2RNJA 2L7ZA 5FLXK 3DBRB 4MEXF 2VE8A 3T8TA 3TBIA 3DCFA 4BQNA 4ZYGA 3M1EA 1R4MB 4CYCA 2CV2A 5GP9A 1FMWA 1NTCA 1YS7A 1YW8A 2ISZA 5J1RA 1HBXG 4IRHA 3W3CA 4P96A 3S3NA 3DWLE 5ICFA 5M5WJ 3K2AA 2K9SA 1BL0A 1X19A 4LOCA 3LSIA 4L9TA 2V1DA 4A3KJ 1R9TJ 3QWLA 1YI2I 2GXBA 2FNAA 3SZPA 5CLSA 2ZSHB 1Z05A 2CFXA 1V5EA 2M87A 3FXUA 3K4CA 1SFUA 2K4JA 3FKJA 1RC9A 3CTAA 4M3FA 3H9GA 2L7MP 5EGOA 1X1CA 2WTEA 2BW3A 4CCLA 5LD2C 1JXSA 2STTA 2Q2EB 5AIQA 1O4XA 4M6XA 2VOPA 5E1XA 4UB8C 1KQ0A 2V9PA 3HOSA 2W4SA 1SAUA 4N9IA 4LLGF 3U1DA 2R7ZJ 3SQNA 3E6BA 3S15J 4A12A 2O0YA 2X1CA 3CMYA 3VWBA 1MNDA 4PJLA 1Z67A 1VQLI 1TNSA 4E7HA 4E7KA 1ZREA 4EMSA 1D5VA 4BEHB 3MVPA 2MGQA 4AUXA 2CJJA 3OYGA 3H0GJ 2VJ5A 3LAJA 2Y9YA 4M3BA 2IBDA 3E6CC 4S04A 4HX7A 1D8KA 2Y2ZA 2W57A 1Z9CA 2WB1N 1LEBA 5J1UA 2OTLI 1I6XA 4OAZA 4ZYHA 4PFOA 4F3QA 3CCQI 5C4XJ 5LHIA 3RYPA 4YG2F 3MZ8A 3RCOA 4BJ6C 3J7ZI 3RPUD 2M8GX 5JVGF 5F64A 1ZG3A 2DT7B 3R61A 1Z7LA 3OY9A 2R5ZB 2OCEA 3JCUC 3NWSA 2HZDA 3CF2A 4E7ZA 4ZH4F 2OTJI 1IV6A 3VODA 1DU6A 2G7UA 1R7JA 4BQQA 5DCMB 5EG0B 2MD5A 2QEXI 4XLCA 5BPDA 2RAEA 2X0LA 5DYMA 4L0YB 3BTJA 2HOTA 1FSHA 4QPQA 1YFHA 1JUSA 2X85A 4G94A 1ODDA 5GADJ 1I3QJ 1W0TA 5EEGA 4UUTA 2QSFX 4MHGA 5J4YA 2LK2A 2HFHA 2CUJA 1FYKA 1OPCA 2CW8A 5ICEA 1WJFA 3G71I 2DODA 4NC8A 2K7LA 2HPMA 4HF0A 2WA0A 4PGGA 4FE4A 1KU3A 3AG1H 3LSJA 3KP5A 1T08B 3E5UA 2Q0OA 2L9RA 1X3ZB 2NOGA 1UG0A 5IPAA 5ED4A 1XDSA 4DW6A 1JHHA 1OCOH 2LG4A 4BBRJ 3IUOA 4XLNF 1YOVB 3G73A 1R58A 4S05A 4BACA 1K6OA 3CJNA 3AL0B 2FQ3A 3PM1A 2VC1A 3CCVI 1PYVA 3H92A 1U9NA 3OOUA 3SXYA 1R22A 3SHFA 1HDPA 1MMDA 4MIMA 4L9NA 1XC5A 5CVUA 2RKHA 4AWXB 3DV8A 4M73A 3HJEA 1SD5A 2CW7A 1RRJA 3CCLI 2H8WA 1EH6A 3FDYA 4L18B 4AIHA 2VT2A 1BJZA 4D7NA 1LKXA 3M8EA 4QSHA 3WE3A 2M7BA 2XPVA 4LITA 1T98A 2JPCA 2F4IA 1K4SA 3FXOA 2IS6A 2FOWA 4E7SA 2WADA 4O3MA 3ASNH 4RB1A 3PJRA 1P7IA 2ELJA 3UNGC 3ZQIA 4BJTA 4HZFA 4XN3A 4JYKA 2OPTA 3H9JA 2GLOA 2JUCA 3D0SA 1D8JA 2MD0A 2G7HA 2IJLA 2QWWA 4CZZA 3HOUJ 2DJNA 3C3WA 2M4KA 3N4MA 2E35A 2VC0A 3BQYA 3WG7H 1ERDA 2VB6A 2ELKA 4HX4A 1L3LA 1DDNA 3IH2A 2LDUA 1VI0A 2JUGA 3BT9A 2L4AA 5KAFC 3SDBA 5LGNA 3WHBA 4DZPA 4ENNA 4BL0B 2KQRA 1ZKGA 2A05A 3FWEA 3KLNA 4Q48A 1YLFA 4N4OB 2JJ7A 4B43A 4UUSB 1Y8QB 3GYHX 1MSFC 1USTA 4QWQA 4YIRX 2KP6A 1G8XA 2FBIA 2VBYA 4RGRA 3VYRB 4LG0A 2YPRA 3GFIA 3PO3J 3S17J 1J7KA 1XN7A 1LVKA 1G3WA 1X1AA 3OSFA 1LB2A 3F8MA 5D5XB 4BE0A 3QRFF 1R1VA 2X6OA 1PJRA 2H94A 2K4BA 1B8IB 1ZRCA 1V4RA 3R6SA 1I1SA 4CYDA 2M8EA 1I50J 4XKWA 1S7EA 3GWZA 3RTRA 2L02A 4D5CA 3LSPA 4G7OF 3FXMA 2E71A 2LMDA 3LSKA 1BI1A 3GMEA 5E8IA 1JT0A 2KRFA 1U6GA 2VI6A 1OCTC 2OC6A 1XMAA 2A6HF 2DMPA 5EJCA 4RBOA 4RMNA 2CQQA 3QYEA 3GLXA 3A02A 3KX2A 3P5JA 2IGOA 2QF7A 3CCRI 1PP8F 4WXDA 3H0DA 4HNTA 4ESFA 5H2FC 2VIXA 2ECCA 2K9MA 3GTQJ 2F2EA 4FQGA 1KYZA 1S5LC 5HS9A 1W36C 1KGSA 2MABA 1OCRH 1B72A 1ZARA 2H1LA 3WE2A 2KRCA 2IA1A 3HSFA 2WAQA 2O6GE 2MLKA 4RM2A 4BE2A 3W6VA 3S1QJ 1BR1A 3T1BA 2DTZA 4OIRF 4E70A 3S3OA 4PJNA 2Y0MA 4XSZF 2NRAC 5ICCA 2NVQJ 2BEOA 4MQ9F 2EH3A 1OCPA 3F23A 3MCZA 2XKOA 2DYRH 1MSEC 2XVCA 2CU7A 4A0XA 2V26A 3BP8A 1Y1VJ 3DTKA 1S6LA 1Y1WJ 1QA6A 4FHTA 2EA2A 3SFIA 3OR1C 2AQEA 1SANA 2K86A 1ULYA 3ZMTA 2PEXA 4P9FA 3W2VA 3AG3H 3BCAA 2R5YB 2XGXA 1SMYF 4AVPA 3ML6A 5BMZA 2V1NA 4PUSA 1ZRFA 4UVBA 2A61A 1IN4A 3VFZA 2KT0A 1OYWA 3WTWC 3TP3A 2L7KA 4Q5SF 2Z99A 2JK3A 3MEXA 3HM5A 1MJ9A 2XASA 4WF2A 5K7ZA 2KISA 5ERIA 3WG9A 2VJIA 1B6AA 1I3AA 4UNOA 5EF6A 2H09A 1ZR4A 5D5UB 2ZJPF 2LREA 1BBYA 5CKTA 2LLKA 4H0EA 4XORA 1RKTA 2MH2A 4IEJA 1Y8RB 1MIJA 3GTPJ 4II3A 1A36A 2Z9OA 3S14J 4UVCA 2QSGX 2P6TA 3AG4H 1K78B 3HBLA 1O3RA 1YITI 4KMFA 4A5MA 2KIMA 1LNWA 2PFBA 1FBQA 2DW4A 1A31A 1J2XA 2O03A 4WXHA 3V8LA 3F8BA 3QPHA 2YUSA 5FRNA 2NOJB 2OQRA 1YRNA 4XIDA 4OINF 1OFCX 3PIOF 2OA4A 3FM5A 3C2BA 1FIPA 1XGNA 3BROA 3BZ6A 4ZYAA 4YRVA 3PNVA 2VL8A 4HBLA 1O7LA 5CYVA 2NNNA 3EUAA 2D1HA 1B4AA 5E3MA 4XRSA 3K2ZA 3SEQA 3LMMA 4CO8A 1HKQA 1QVTA 2V1XA 4QPOA 3ABLH 3RYRA 1Z6TA 4RLFA 1J59A 2F5EA 1FOYA 3IAS2 4FT8A 2KJCA 2DA7A 3FZVA 1D0XA 3I4MJ 4KIBA 4W1UA 3UR3C 2R3SA 2K9QA 3ZN0A 5J6XA 2ZFWA 2AS5F 2UZKA 3J7AY 4DBRA 3LSRA 2LKXA 3S1RJ 5GPCA 5IY5H 2XGEA 3Q9VA 3OOPA 1GVDA 1VF9A 5IP9J 4WWCA 5LBQA 3PFYA 1C0WA 3KYLA 1KYWA 2D1VA 1IN8A 2JTVA 4YELA 1X1DA 5IOZA 5J40A 1KA8A 2GWRA 4BQAA 3J80K 1HOMA 3I4PA 3DF8A 2A5WA 2IW5A 4EJWA 2HI3A 5JLWA 1ETVA 5LHHA 2LBFA 3V7RA 3V4GA 1BW6A 3B6AA 2DOFA 1JJ8C 4DIQA 2XF6A 3T5XA 3LA3A 4MQVA 3F8CA 4NNJA 1IW7F 3GUDA 2DU9A 4XBFA 2DOAA 2FU4A 1X1PA 2QQAA 2L01A 3W2AA 2BVLA 4KIGA 2NVTJ 2R7UA 4KN7X 2FEZA 2LY1A 4UV9A 3BG5A 4ZYEA 1Y0NA 3LNQA 1RESA 5DUIA 3BCBA 3ABTA 2LFBA 4BDYA 1YO5C 1YE9A 1ZGJA 1UHWA 5H6RA 1T95A 3WTXC 1MDMB 2OJED 1F1ZA 1N25A 2FQ4A 4D0PA 2DA1A 2M0MA 1IN6A 2VOOA 4MGRA 1JTXA 3HHGA 4GYIA 2M5WA 4BXUA 1TT5B 1D1BA 4E7JA 2QKLB 3BR3A 1V3FA 3ZRGA 6PAXA 1KU2A 1QO0D 1ACIA 5BS6A 1S29A 3ZMDA 4EVIA 4PSXA 2DA6A 2WV0A 2Z1DA 2RC4A 2VJ4A 2GOMA 3FHNA 4J19A 1JE8A 3RQ4A 1AKHA 1XDUA 5HDNA 3HRMA 4M74A 4XRMA 3L2UA 5DD4A 1D0YA 1XGMA 3H3UA 1H9TA 3VYTB 1VQNI 3HOYJ 4EV0A 4Z6YA 1MGTA 2XB0X 3QQAA 3OYDA 3B73A 1ENHA 2M30A 1ON1A 4N9HA 1AHDP 2ETHA 2Y48A 5GTIC 3GLLA 4HLXA 5DEQA 2H6BA 3BR5A 3ZQQA 2FBKA 2M9HA 3X2QH 4HQEA 1XCVA 5K7FA 1VQ5I 2CYYA 3V7SA 2OF7A 1W7PB 4HSRA 1X58A 3E7LA 1Q1HA 3GW2A 2DTRA 3RKQA 4IVNA 4RGSA 5IT3A 1BA5A 1ZHFA 1R36A 4CCNA 3G6EI 4L0ZB 1MBGA 3ZXSA 2RNGA 1IXRC 3BG3A 3D5SC 1JKOC 1FX7A 2MLGA 4BNCA 1IRGA 3FXLA 3OMYA 1J5YA 1STZA 1FTTA 1BIAA 2M1BA 1R4NB 1TL8A 1N77A 4IRGA 1ZG1A 3JRHA 3N97A 1WSUA 3FHZA 1DGWY 4OOIA 5TRDA 2DMTA 2TRTA 3GXOA 1GLNA 1Z77A 2LKPA 2GXAA 5HLIA 2QBYA 1ZN2A 2W85A 3G1OA 2BYVE 4KNYA 4NC6A 4L5JA 1ZGWA 1U9OA 3ZMSA 2LOOA 4IF4A 1OQYA 4DNCA 4I7HA 4RDUA 2VODA 1IN5A 3K9TA 4D7MA 1ZAOA 1DGRM 2EZHA 2DMQA 3KP3A 2DFEA 3DLLF 3CQZJ 2DAOA 1S7AA 3CCYA 4LGWA 1VNDA 4HNUA 4BAYA 2H8RA 4WK8F 1JUPA 5E20A 3BLYA 4HV5A 3QPSA 2MC4A 4I76A 5K5OA 3EYIA 1EF4A 3HYIA 3H35A 4Y33A 3S1NJ 1K6YA 3ZGKA 3J7AO 3TDZC 3HC7A 4L5IA 1LDKB 2MYSA 3CUOA 4CXFA 1G59A 1FOXA 2CQXA 4WXCA 2JZYA 2NS8A 1EV7A 3GBGA 3GX4X 3F21A 1OYYA 3CDIA 2JA6J 1Y0UA 3Q3SA 4F55A 1R23A 2GAUA 4JP0A 5GAGJ 4UV8A 2GZWA 5H20A 3ESWB 2FSWA 3I54A 4HF2A 2ESNA 4XICA 1IC8A 1MBKA 4ZZDA 4A3LJ 2DJIA 2BV6A 2B7EA 2G0EA 5AONA 2Q8KA 4ZJZA 5F08A 4BJ5C 1J0RA 1TQIA 1TW2A 3CUQB 2DA4A 1Y39A 1TWHJ 5HLGA 1Q1VA 2HQNA 1W7PD 2UUZA 2XAHA 1DU0A 2PJRB 4N4NB 1RUOA 5L3FA 4HA8A 3HOWJ 5D4RA 2N8GA 4QIWN 4M6VA 1H8AC 3HOZJ 2DYSH 2NVUB 1TW3A 4IL6C 4ZTJA 5GAHJ 2XKPA 4PSWA 4II2A 3L1PA 1IJWC 4Y13A 3J80Z 3SEZA 1D5YA 4IKFA 3K7AJ 4X6AJ 4AM3A 4Y4RA 2PMZN 3MAJA 2VBXA 3PNYA 4XONA 3IRQA 3P9IA 3WGGA 4LK0F 1FYMA 3CDHA 1P4AA 1KQ9A 1YYVA 5IP7J 2XSDC 4U87A 2XRNA 4C2UA 2IA2A 3EUKL 2HXOA 2XHKA 3T8RA 3HRTA 4LB6B 2P81A 3WTVC 3G3ZA 1NHAA 5C3EJ 5LRRA 4B1RA 3L2VA 3K70D 2COMA 2CMPA 1QNTA 4IZZA 4A3CJ 4KUMA 4KT5C 2HOAA 2YS9A 2J5OA 1MZBA 3ERMA 4CDGA 1E3PA 1QU3A 1P2FA 3H1CA 2ECBA 3RPUA 4CGZA 2F5DA 1B9MA 3BZCA 3I0TA 5GAEJ 1XSDA 5FLVA 2R7SA 3ZN1A 2XAQA 1IN7A 4Y7NJ 2Z33A 1W0UA 2HOSA 2EWNA 2DFFA 2HDWA 3H5NA 1S72I 3TW6A 4IPAA 4ETSA 1P9QC 4EM0B 3BR0A 5KAIC 3VOEA 1T6SA 5E3LA 2GIVA 4ZYDA 4PGHA 3BTIA 1UCRA 3CZ6A 3KZYA 3N05A 1U5TA 1DP7P 2L54A 1IO2A 2K3PA 2W00A 1XMKA 2KIFA 4HV6A 3VSLA 4IXAA 3PNTA 3KYDB 5EEHA 3TDUC 4BS9A 3IWZA 3O3KA 1W1WE 4KFCA 4XQFA 4MTDA 2YU3A 3L2QA 3LA2A 1HKSA 4HW0A 1HDDC 3E5QA 5DDGA 2QQ8A 5K5QA 3TL4X 3C7JA 1WZ2A 2KJBA 1LFUP 1OLTA 2VT3A 5E3OA 4FX4A 1F9NA 3VSKA 4UHTA 3HSEA 5HVQC 4NHJA 1ZTRA 1YX3A 4A3DJ 2CG4A 3OS2A 2FA5A 1HSJA 4KJZA 3OYNA 4IHXA 3MZHA 1FNNA 1SMTA 1ZLKA 2HWVA 3V8KA 2ZBKA 3WGIA 1O7FA 3GCMA 4NBQA 2EZKA
chains in the Genus database with same CATH topology
1HC8A 3CJTB 2E36A 1VQ9I 1VQ5I 1VQLI 3CCMI 1VQ8I 2FOWA 2ZJQF 5GAHJ 3G4SI 2ZJRF 1YIJI 1QA6A 3CCEI 5DM7F 3G6EI 1VQKI 1YJWI 1VQ7I 1VQOI 2OTLI 3CCQI 2E35A 1YJ9I 3J7ZI 4IO9F 1MMSA 5JVGF 1YHQI 5DM6F 3CMEI 3CMAI 3I55I 2OTJI 1YJNI 3CCJI 2QEXI 2K3FA 3J7YJ 2ZJPF 2NXNB 5GAEJ 3CCSI 5GADJ 1FOWA 1S72I 3DLLF 4IOCF 3G71I 4UY8I 1YITI 3CC7I 1ACIA 1VQ6I 2JQ7A 1FOXA 3CCUI 3PIOF 3I56I 3CCRI 1VQ4I 2E34A 4V19K 3PIPF 1YI2I 5GAGJ 1VQPI 3CC2I 3CCVI 2QA4I 1VQMI 1VQNI 3CD6I 3CC4I 3CCLI 1FOYA 4IOAF 3CF5F 1Y39A 2H8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HC8 A;  3CJT B;  2E36 A;  1VQ9 I;  1VQ5 I;  1VQL I;  3CCM I;  1VQ8 I;  2FOW A;  2ZJQ F;  5GAH J;  3G4S I;  2ZJR F;  1YIJ I;  1QA6 A;  3CCE I;  5DM7 F;  3G6E I;  1VQK I;  1YJW I;  1VQ7 I;  1VQO I;  2OTL I;  3CCQ I;  2E35 A;  1YJ9 I;  3J7Z I;  4IO9 F;  1MMS A;  5JVG F;  1YHQ I;  5DM6 F;  3CME I;  3CMA I;  3I55 I;  2OTJ I;  1YJN I;  3CCJ I;  2QEX I;  2K3F A;  3J7Y J;  2ZJP F;  2NXN B;  5GAE J;  3CCS I;  5GAD J;  1FOW A;  1S72 I;  3DLL F;  4IOC F;  3G71 I;  4UY8 I;  1YIT I;  3CC7 I;  1ACI A;  1VQ6 I;  2JQ7 A;  1FOX A;  3CCU I;  3PIO F;  3I56 I;  3CCR I;  1VQ4 I;  2E34 A;  4V19 K;  3PIP F;  1YI2 I;  5GAG J;  1VQP I;  3CC2 I;  3CCV I;  2QA4 I;  1VQM I;  1VQN I;  3CD6 I;  3CC4 I;  3CCL I;  1FOY A;  4IOA F;  3CF5 F;  1Y39 A;  2H8W A; 
#chains in the Genus database with same CATH topology
 3CJT B;  4CCK A;  3C2G A;  2WAE A;  2Q2E A;  2YX4 A;  2FRH A;  4IHY A;  3V8J A;  2BHZ A;  5D6E A;  5DUK A;  3LQR A;  3JRF A;  1QHG A;  4RB0 A;  2B9S A;  2WAQ N;  4PFP A;  4BKX A;  2OV7 A;  2V9V A;  3BWG A;  4BHC A;  4F92 B;  3O6B B;  1IXC A;  2GA1 A;  3JTH A;  4BEH A;  1XSV A;  2RGV A;  1VQO I;  3TED A;  1VFC A;  4RB2 C;  3LOC A;  4C2M J;  2FXA A;  2X9D A;  4EGY A;  3GTG J;  1YJ9 I;  3FX3 A;  1XSX A;  2KIU A;  3GTM J;  2IA0 A;  1K4T A;  4C30 A;  2KKO A;  5FFX A;  1FMV A;  5A2Q K;  1GHC A;  1XD7 A;  3GTK J;  3D1N I;  2ZCW A;  4IQJ A;  2VKD A;  2EK5 A;  3VYS B;  4X1E A;  3P9C A;  3GZ5 A;  3I55 I;  5C4J J;  2DCE A;  3TO9 A;  4G7Z F;  3FXR A;  2ZJ2 A;  4M6Y A;  4DGW B;  1KU9 A;  1QZY A;  4G6D A;  3S16 J;  2P6S A;  2EFQ A;  3ISP A;  4ZC3 A;  4KIF A;  3SZT A;  2P7C B;  2PN6 A;  3KP4 A;  1UFM A;  2DDA A;  1OR7 A;  5FRO A;  5EZG A;  1V5F A;  2XF5 A;  2BZT A;  4XNF A;  2FUG 2;  5DCM A;  2HDC A;  5EG0 A;  2QEN A;  4HRI A;  3CLO A;  1FOW A;  2DPU A;  1DP3 A;  5E8G A;  1JGG A;  4EM2 A;  2HKX A;  2DFH A;  4XLP F;  2EIL H;  1LDD A;  2JA8 J;  3K6G A;  4EAT A;  1MJA A;  1G4D A;  5FO5 A;  1LE8 B;  3BTC A;  3GEZ A;  3HUG B;  5B5E C;  4I2O A;  4G7H F;  4O6J A;  2KLO A;  1KON A;  3GZ6 A;  5L3E A;  2LD5 A;  3LSH A;  3E0J B;  3B6C A;  3CES A;  1MMG A;  3JRB A;  3HB9 A;  4BYY A;  3L00 A;  2ELH A;  1K83 J;  1WWX A;  3DKY A;  5M5X J;  1LPQ A;  1JUM A;  1NG6 A;  4H4K C;  2DPD A;  2HVS A;  2EV0 A;  5BPI A;  4EM1 A;  1DPR A;  1TT0 A;  2RN7 A;  3V7C A;  1K7A A;  2JWT A;  1IZ1 A;  1U5T C;  4I09 A;  3BPV A;  2YX7 A;  5FLX Z;  2QA4 I;  4BXF A;  4BY1 J;  4BE1 A;  3RJP A;  2WBM A;  1IXS B;  5F0F A;  2X51 A;  1CF7 B;  3OS1 A;  1SVL A;  3KP7 A;  1BI0 A;  2LKS A;  3KZZ A;  4LLN A;  2VON A;  3NQO A;  2DMU A;  1A35 A;  5JVT A;  3LSG A;  1FTZ A;  2F4O B;  3WHC A;  3OL3 A;  2E5Z A;  2ZXH A;  4MO7 A;  4HQM A;  2E1M B;  2CWE A;  2FBH A;  4E7I A;  1E3O C;  3MKW B;  2CUF A;  3BJO A;  2YU9 J;  2LC2 A;  1M1E B;  2M0C A;  1R6R A;  2HPI A;  2XUB A;  3FMR A;  3Q0U A;  2VKH A;  1X4P A;  2LYC A;  2NVY J;  2ZJR F;  1YTY A;  5F27 A;  3REO A;  3WU2 C;  2VQH A;  3I71 A;  3M8F A;  4CCM A;  2VLA A;  5D5V B;  1B1B A;  1XGO A;  2KFD A;  1YS6 A;  2C6Y A;  5M3M J;  2NS0 A;  1XPX A;  1SC7 A;  1G2H A;  2CV0 A;  2UV1 A;  3PQJ A;  3ZMU A;  4BU2 A;  3OYH A;  5HLH A;  2QM3 A;  3BG6 A;  3K4M A;  4PK4 A;  2MC3 A;  1TQP A;  3BTL A;  1HCR A;  1QPM A;  3I58 A;  2D45 A;  2FML A;  1NK3 P;  2LR8 A;  1EH7 A;  1QGP A;  2WAF A;  2X1E A;  2WWY A;  3HPH A;  3CCJ I;  2WC2 A;  1YJN I;  1BC8 C;  5F0H A;  4LIV A;  4F91 B;  1KU7 A;  4IQ4 A;  5IP6 A;  4AC0 A;  2IS1 A;  5BQT A;  3FMS A;  1EH8 A;  1MD0 A;  3DKX A;  4K2E A;  4KIC A;  4XLH A;  2Z3Y A;  4BGD A;  5HNF A;  2OUM A;  5FKM A;  1Z6R A;  1P7J A;  4G6Q A;  3CLQ A;  1GV5 A;  5M3F J;  2F48 A;  4UUS A;  3AAF A;  4AU7 A;  3CCS I;  3JAM K;  1MBF A;  1Z7U A;  2PMU A;  4ZZL A;  3TQN A;  4D1Q A;  1IGN A;  3ASO H;  3R4K A;  2AHQ A;  4B4C A;  4AYB A;  1GT0 C;  2EZL A;  1PP7 U;  5DD8 A;  2DFI A;  1OR7 C;  3RDI A;  2XDV A;  1GXP A;  3M4O J;  1B8I A;  1UZC A;  3MZY A;  4V2F A;  1PUF A;  3EDP A;  2FOK A;  1DUX C;  3ONQ A;  2QUF A;  4XKV A;  2KZV A;  3WOD F;  4RA2 A;  1ZR2 A;  4GXO A;  4V19 K;  2OCC H;  5D5W B;  1I6H J;  4FE7 A;  4DQ2 A;  3WGH A;  2XF7 A;  1X1B A;  1H89 C;  1ZK8 A;  2HVQ A;  3A1Y A;  4E7L A;  3OWT A;  3CD6 I;  1NH3 A;  4JK1 X;  3KP6 A;  1KZH A;  3V42 A;  5FRM A;  3OYK A;  4XOT A;  1D1C A;  2VJJ A;  1T0F C;  3R60 A;  4A3E J;  2HU9 A;  3I3L A;  2E1N A;  5JHF A;  4G12 A;  2P8T A;  3L09 A;  4E6K G;  2XC7 A;  1HC8 A;  4I98 B;  2W1O A;  3DU5 A;  4JX5 A;  4RM3 A;  3JTG A;  1FIA A;  1USS A;  2E2J J;  1ZG5 A;  4A3B J;  1F36 A;  1A5J A;  3AL0 C;  2V1U A;  3JRA A;  3F9K A;  3Q0V A;  3G4S I;  3FXK A;  1YIJ I;  1SFX A;  4CCO A;  3DXJ F;  2PG4 A;  2VPL A;  1XX5 A;  4IHS A;  5JR3 A;  1S7O A;  1SD6 A;  2R7W A;  1VQ7 I;  2R7R A;  4UUV A;  3OIQ A;  4LFU A;  4LMY A;  1QRY A;  1E0E A;  3U21 A;  2QQ9 A;  2XRO A;  2BVM A;  4KIS A;  3L2W A;  1V55 H;  3KCC A;  1F43 A;  3ZMZ A;  5L3B A;  5A2Q Z;  2CSO A;  1FC3 A;  1WVR A;  2GQQ A;  3CJR B;  2CRG A;  3NAU A;  3TO7 A;  2Y9Z A;  4LK1 F;  2R5Y A;  3K4J A;  2OAZ A;  4MFE A;  2RQQ A;  4Y15 A;  3CME I;  2NVX J;  3HL2 A;  2RVC A;  1U2W A;  5H6Q A;  2VN2 A;  4M3D A;  4WCG A;  2K85 A;  4GGG A;  1Z3X A;  3KFW X;  2JSC A;  3DTE A;  4A3I J;  3H36 A;  3ZPL A;  3A01 B;  2ID6 A;  3ABK H;  5EYR A;  2PI0 A;  2E1C A;  2HDD A;  1LVA A;  2MSY A;  1R49 A;  1GVJ A;  2NYX A;  3S3M A;  4I01 A;  4OMY A;  3HEF A;  1Y56 A;  2FE3 A;  2CUE A;  2Y0S A;  3GFJ A;  1A04 A;  4GDF A;  1FYL A;  2MFZ A;  2DK5 A;  1B59 A;  3QYB A;  2CH0 A;  3OYF A;  2O8X A;  1QBJ A;  2IGN A;  5B66 C;  2O9L A;  1G3S A;  2HNH A;  2KDZ A;  2O61 A;  1TWF J;  5ILV A;  4U88 A;  1DPU A;  1XB4 A;  2L0K A;  1K79 A;  3K69 A;  1K78 A;  4HF1 A;  1LQ1 A;  1IUF A;  4IJA A;  4C9Y A;  2R7V A;  1O3T A;  2D2W A;  3M9A A;  2BGC A;  1RR8 C;  2TCT A;  2ZNY A;  5CVJ A;  4XSX F;  3DEW A;  4ITV A;  4M9S A;  2M2E A;  2DXI A;  4OU0 A;  4Y17 A;  2EZI A;  3L2C A;  5DV5 A;  4FAS D;  5IYC J;  3I59 A;  3RZO J;  2BXY A;  4B48 A;  1SD4 A;  2CS3 A;  2PMH A;  3C1D A;  4UVA A;  2L9N A;  1ETO A;  4S0H B;  1J09 A;  4XKC A;  3G1M A;  3S2H J;  3KLO A;  3F22 A;  1CQT A;  3HPG A;  3FKI J;  2P7V B;  2ZXI A;  5CVR A;  3RI4 A;  1FEX A;  2I5U A;  2EIN H;  3K4K A;  4GCV A;  3CF5 F;  2R0Q C;  3BG7 A;  4BHP A;  5ILU A;  1WJ5 A;  2GOX B;  3OYI A;  2ZKZ A;  3M8J A;  1I5Z A;  2VKV A;  3HTU A;  2E1M C;  2KIQ A;  3QP6 A;  3ERE D;  1SEU A;  1ORK A;  2L9S A;  1GV2 A;  4GFB A;  2A5Y B;  4P1W A;  1R00 A;  1FWZ A;  5HDG A;  3DLA A;  4C3H J;  2Q1Z B;  3E1S A;  3HKZ A;  4A0Y A;  4PDK A;  3TO6 A;  2EPF A;  1XGS A;  2E5N A;  5TGT A;  1F5T A;  1ETY A;  5KK1 A;  3CCE I;  1MBJ A;  2E2H J;  3LAP A;  2R7D A;  1YIO A;  2XAF A;  1ZLJ A;  2FJ1 A;  2ME6 A;  3ZQG A;  1IRX A;  5FKN A;  5K7H A;  3PSI A;  4EEF G;  2A69 F;  2ZME B;  1ONV A;  2DI3 A;  4I0B A;  5E79 C;  1TBX A;  2F6C A;  4HYE A;  2W7N A;  3KEO A;  3S1M J;  3DBH B;  1FBS A;  1YHQ I;  3NRV A;  2DA3 A;  3CMA I;  4ON0 A;  1UEL B;  2XAG A;  3L7W A;  4IRI A;  2DA5 A;  5FB2 A;  3F8F A;  1N78 A;  2EIK H;  1WJD A;  2EBI A;  2AXT C;  4QLC U;  4XK4 A;  1IV8 A;  2A6E F;  3FMQ A;  3H5A A;  3H9Q A;  1ZYR F;  4YFX F;  1I1G A;  3JRE A;  3EET A;  4UXN A;  3DFG A;  3M3Y J;  3RZD J;  1LEA A;  3A03 A;  1XS9 A;  3FM3 A;  4B47 A;  2EFP A;  2CW0 F;  2BOL A;  5EZH A;  4CYC B;  4BH9 A;  2OD5 A;  4YFN F;  3IL2 A;  2DO7 A;  5GPA A;  2DK8 A;  2KRH A;  1ETQ A;  2VXD A;  5FJ8 J;  4A6E A;  1MDM A;  3WU0 A;  2L9V A;  4G9Y A;  3HTS B;  3DPL C;  2ESH A;  5J4V A;  2I8D A;  1VQ6 I;  1MH3 A;  3L2R A;  1WJA A;  3F0C A;  3FF5 A;  2XPU A;  1WKM A;  3DP7 A;  4AIJ A;  4DBQ A;  2DT6 A;  4PJ0 C;  4ENK A;  2DA2 A;  2LF7 A;  1JKR C;  2RRE A;  3GFM A;  2KPM A;  3C2H A;  4GYG A;  3GF2 A;  3QOE A;  5EGO B;  3OS0 A;  3BPX A;  2BW3 B;  2K02 A;  2M4G A;  1R1U A;  4A3G J;  2G9W A;  2XSJ C;  1T56 A;  1T2K A;  5CJ9 A;  1T8I A;  1ZH5 A;  2GM4 A;  2IGM A;  3ELK A;  2KZG A;  5CVV A;  4DOZ A;  2JRM A;  1ITY A;  3WTU C;  2W82 A;  4OIQ F;  4A2U A;  2DOE A;  4FCY A;  2HTS A;  2DDB A;  1QPI A;  1R5G A;  1GXQ A;  2EA4 A;  2XB5 A;  1YG2 A;  2P4W A;  4XLE A;  3U1K A;  3E6D A;  2QLZ A;  5J8C A;  2UXX A;  4XR6 A;  2M34 A;  3JRC A;  3O8H A;  1ETW A;  3RQI A;  2L3D A;  2HGC A;  4NQW A;  1HW1 A;  3QP5 A;  4KYW A;  1IDY A;  4CHU A;  4RB3 C;  2ZXJ A;  3AKZ A;  2KL4 A;  1MNE A;  2ZJQ F;  3FIW A;  5AIP A;  2KDO A;  1ZGA A;  2V9K A;  2PLY A;  4CIC A;  2BE5 F;  2STW A;  4HPQ A;  3S2W A;  1MMN A;  4CCJ A;  2E1O A;  5BNG A;  2X48 A;  1QZE A;  4A93 J;  5CQE A;  4AID A;  5E17 F;  1OIS A;  1SFE A;  5CVI A;  4U7B A;  3VB2 A;  2X6Y A;  5J3L A;  5D8K B;  5FFZ A;  4GRI A;  1L0O C;  4I02 A;  2R7F A;  1REP C;  2ZC2 A;  4AIK A;  2FMY A;  4HDV A;  1BI2 A;  3TMO A;  3VYU B;  3K4L A;  2Z5U A;  2R4G A;  3CO6 C;  1UJ8 A;  3FXJ A;  4U0W A;  1X2N A;  4L5E A;  1A6Q A;  2O7O A;  1LJ9 A;  5CQG A;  4BHB A;  2O5R A;  1S8N A;  4Y52 J;  2RDP A;  4QTR A;  2LTP A;  2XPW A;  4PJM A;  1E2X A;  1FP2 A;  1U78 A;  3CMM A;  1F4K A;  1N75 A;  3WTT C;  2VKE A;  3W6K B;  1NK2 P;  4U7D A;  4U0V A;  2BY0 A;  2ACJ A;  2HQA A;  1Z21 A;  1H9G A;  2LP0 A;  2XGD A;  1FLI A;  1SFO J;  5F04 A;  4I0A A;  5LLQ A;  2MG4 A;  4C3J J;  4A3F J;  4M3E A;  4UY8 I;  2XAU A;  2V6E A;  4UB6 C;  1S3J A;  3GO5 A;  2JA5 J;  3FIS A;  3CDL A;  3QPL A;  2WY7 Q;  5HS8 A;  1D3Y A;  1FSE A;  3BQZ A;  3IRR A;  4I99 C;  4BUP A;  5B3S H;  1XMX A;  2QQB A;  2VQC A;  5J47 A;  2Z16 A;  3I9V 2;  3I56 I;  3OL4 A;  4XM3 A;  2IRF G;  4ASN A;  2JRT A;  5E3N A;  4YFK F;  4HAM A;  2E7X A;  2M45 A;  3CP2 A;  3HGG A;  3T0Y A;  3QPT A;  1VQP I;  1WH5 A;  3E6M A;  4EJU A;  1I27 A;  3NEU A;  3KET A;  4ESB A;  1TTY A;  1POG A;  5D8L B;  4HX8 A;  1O3Q A;  3CC4 I;  1PDN C;  4DYC A;  3ABU A;  1JTY A;  2R7T A;  3L9F A;  1EKE A;  3F72 A;  2VXZ A;  3KIO A;  3BDD A;  3MMY B;  1AU7 A;  3KEQ A;  2ZSI B;  1CGP A;  1VZ0 A;  1R5H A;  2WY8 Q;  1G3Y A;  1FZP B;  1NG7 A;  1UHS A;  3MKL A;  3U2R A;  4F93 B;  4KDP A;  3GTL J;  1OCZ H;  3CUQ A;  1WH7 A;  3CCM I;  3GVA A;  2PJR A;  4M71 A;  4A3J J;  2L2O A;  5DS9 A;  2JA2 A;  5EEA A;  2A07 F;  2EB7 A;  2LSO A;  3RKW A;  3MKY B;  2VPR A;  5F6F A;  1WI3 A;  3FBI B;  5FD6 A;  2Y31 A;  2GIZ A;  3K1N A;  4DYR A;  5K5R A;  3HDD A;  1P4W A;  4X0G A;  1PVE A;  3K0L A;  1BM9 A;  3IH4 A;  2X1D A;  3DU6 A;  1PUE E;  1TZL A;  2Y75 A;  1T38 A;  2ZME C;  3A2K A;  1W5C C;  1D0Z A;  3K1P A;  3QU3 A;  2NNY A;  3GTO J;  2R7O A;  4FTH A;  3GZN B;  3JW4 A;  3QAH A;  3DKW A;  2EFO A;  3ECO A;  1TQM A;  2I10 A;  1UHM A;  4JOM A;  1R71 A;  1JGS A;  3KP2 A;  2QVO A;  4LG0 B;  1SD7 A;  1FT9 A;  4EJO A;  4CH7 A;  3VEP A;  1HLV A;  2LRD A;  3COA C;  3F6V A;  2HYF A;  4LLL A;  2OZU A;  5C44 J;  2MH9 A;  3ZQH A;  3R0A A;  3B02 A;  5B1A H;  5JI6 A;  4PCQ A;  4RAY A;  3ECH A;  2CFO A;  4R8H A;  2Y69 H;  3ABM H;  3TOB A;  1W36 D;  1LUJ B;  3EPZ A;  2BBY A;  1RPW A;  4ZDP A;  2IVM A;  4A5N A;  3O8G A;  3BR2 A;  4O5V A;  3HZJ A;  1WGX A;  2BY1 A;  2ZXW H;  2AXL A;  5JFR A;  2VE9 A;  3CC7 I;  2PQ8 A;  1P92 A;  1QHH D;  5FGM A;  3HG9 A;  4MEY F;  5J1Y A;  1APL C;  4ABZ A;  4RGX A;  2R5Z A;  3D5R C;  2JQ7 A;  1SFK A;  4EJV A;  1G6N A;  3OIO A;  4IHT A;  4AYB N;  3ZQL A;  3K70 C;  3FXQ A;  4EJT A;  3A4C A;  1MMA A;  3FK7 A;  4XKB A;  5KHD A;  2PMZ A;  2OZ6 A;  2PBI A;  1FP1 D;  2E34 A;  3KPH A;  1HKT A;  3PO2 J;  2H6C A;  3NAR A;  2ZO4 A;  4LG3 A;  1B72 B;  2CO5 A;  2OQG A;  4MLO A;  2EFN A;  5LGT A;  4C2T A;  2CGP A;  3CO7 C;  4RAZ A;  3OYE A;  3LL7 A;  3O2P E;  1TP4 A;  1RZ4 A;  2ZNZ A;  4YII A;  3IKT A;  3G1L A;  2V7F A;  4PZJ A;  2CUZ A;  3TP0 A;  2LY9 A;  2HTJ A;  5E1W A;  1RR7 A;  3HRU A;  5LFA A;  2K9L A;  2L5Q A;  1QZZ A;  3TOA A;  4BY7 J;  1TWC J;  3BR1 A;  1BR2 A;  1JHF A;  2K40 A;  3S2D J;  1T0F A;  2A6T A;  2FD5 A;  2X6W A;  1OMI A;  2IEK A;  3MD2 A;  2TDX A;  2WB1 A;  1MJB A;  2H1K A;  4JQF A;  2MW8 A;  1HW2 A;  3D5L A;  1MNM C;  1SVM A;  1YW7 A;  2IPQ X;  2FX0 A;  2P0W A;  5EDN A;  2OBP A;  5LHG A;  1R5I D;  2O8K A;  5FKL A;  4LD5 A;  1YJW I;  4LJZ F;  1BI3 A;  2IT0 A;  1HW5 A;  2NS7 A;  2CQK A;  5ILS A;  2HVR A;  1J75 A;  4IHV A;  3CUQ C;  5LRS A;  3M07 A;  1V5G A;  2J5P A;  2H27 A;  4LIU A;  1UMQ A;  3GFL A;  3U9G A;  4D5F A;  1U8R A;  1MMS A;  4CSW A;  1E3H A;  3H3V K;  3CP8 A;  2NAZ A;  1RNL A;  3ZQ7 A;  5J8F A;  4TV7 A;  5DM6 F;  3BC8 A;  3PQK A;  4KT6 A;  1OCC H;  4ZDO A;  1PUF B;  3I64 A;  1P4X A;  5E1Z B;  3JR9 A;  4B3A A;  2L4M A;  2E2I J;  1OYI A;  2Z2S B;  3HSR A;  3RIR A;  4XL9 A;  3ZR8 X;  3E3V A;  2JA7 J;  2QYO A;  1QQI A;  1WJC A;  2K9N A;  4OMZ A;  1FY7 A;  4KA4 A;  4Q4Z F;  1AWC A;  2RQP A;  2NXN B;  4M72 A;  1U8B A;  3HIF A;  4NUB A;  2P5L C;  4V2G A;  1X3U A;  4WX9 A;  3LA7 A;  3WTZ A;  2IAI A;  3WTY C;  3F3X A;  2R92 J;  2IP2 A;  2QZ8 A;  4GO1 A;  1IAW A;  2VBW A;  3BJ6 A;  4XMY A;  4IOC F;  3KE2 A;  1W4M A;  2JT1 A;  3J81 K;  3JSO A;  2F5F A;  1E17 A;  2HS5 A;  3I5U A;  5LEK A;  1HQC A;  4HDU A;  2DMN A;  1YRN B;  5FD5 A;  3RSN A;  5HS7 A;  1IDZ A;  1J9I A;  1SAX A;  2Y0S N;  5KVR A;  2A68 F;  4KMU X;  3A0H C;  2BY2 A;  2EIM H;  4B44 A;  1JT6 A;  3OR2 C;  2Y30 A;  3BZK A;  3OYL A;  3LQQ A;  2VQL A;  4FET A;  3JRD A;  1LE8 A;  3HGY A;  3HUG A;  4ESJ A;  3LST A;  3HHH A;  1W5T A;  2EFW A;  3M1C A;  3SYT A;  3H3Z A;  1TNT A;  1BR4 A;  4NC7 A;  4W97 A;  2PX9 A;  1X4O A;  2HOE A;  4KIT B;  5FKO A;  3PUB A;  2QKM B;  4YEJ A;  4C3I J;  1MKM A;  5DTD A;  3K4N A;  4E4H A;  4IOA F;  3AG2 H;  3K1M A;  1T33 A;  2FNP A;  4F52 A;  2WV1 A;  2GXG A;  4JX6 A;  2MBF A;  2P5V A;  3ZMV A;  1CF7 A;  1Z91 A;  1HXD A;  1JKQ C;  1ZQ3 P;  3S93 A;  1VQ9 I;  3HXL A;  5L3G A;  2V6C A;  3S32 A;  1QVU A;  1H88 C;  1FBU A;  1WJE A;  4A69 C;  3ZOB A;  5JHU A;  3IH3 A;  1JJ6 C;  4XN0 A;  3LFU A;  4HOB A;  2IS2 A;  2ISY A;  3MWM A;  3IP4 B;  2LF8 A;  1OJL A;  2XIG A;  2ZB9 A;  2LBF B;  3SFZ A;  1P6R A;  1S9H A;  3P9K A;  5IT9 K;  2JMW A;  3SZG A;  4RAF A;  3HKZ N;  2QGU A;  2HXI A;  3JRI A;  1ON2 A;  4J00 A;  3MFK A;  5M5Y J;  1RKW A;  2ID3 A;  3OV8 A;  1B9N A;  3M7G A;  5F0C A;  2W24 A;  2KMU A;  4XLA A;  4MFD A;  4OIP F;  3Q0W A;  1W5S A;  2OU2 A;  3FBN B;  1XTA A;  3PL8 A;  4U0Y A;  1RIO H;  4ENM A;  4RLQ A;  3VDX A;  1HST A;  1Z1D A;  3QOP A;  2FF4 A;  4RS8 A;  4F7Z A;  1BC7 C;  3IHU A;  3A0B C;  4I6Z A;  1ETX A;  9ANT A;  2R7Q A;  1EJ9 A;  2JSP A;  2YSR A;  5D4S A;  5LEJ A;  4OIO F;  4XOP A;  1I39 A;  3I59 B;  2E7W A;  5HOD A;  1IUY A;  2UWM A;  1LDJ A;  5IYB J;  2HQR A;  3HOV J;  2AO9 A;  2DT5 A;  3OYJ A;  1GDT A;  4OWR B;  2D5V A;  2GBY A;  3EUH A;  2XAJ A;  3PSF A;  3IWF A;  3I4N J;  4DZJ A;  3I53 A;  3DPT A;  3RPQ A;  5JLX A;  4YIF A;  5B1B H;  1RI7 A;  4IHW A;  2K5C A;  3KZI C;  3W6J B;  1BW5 A;  4JBA A;  3BR6 A;  3WTS C;  4CA0 A;  1AKH B;  4FX0 A;  4L9J A;  3FK6 A;  4RGU A;  1LFB A;  2IS4 A;  1Z3Y A;  3S8P A;  3CCU I;  3BJA A;  4NB5 A;  3OYM A;  1JKP C;  2M3A A;  3TGN A;  2L7F P;  3OSG A;  1WI9 A;  3HOX J;  1TWG J;  4R1H A;  3PIP F;  4P55 A;  2ZFU A;  3BG9 A;  1U3E M;  1IG7 A;  2CV1 A;  2E60 A;  1WRJ A;  4R79 A;  1TLH B;  5F1J A;  2HEO A;  5HOO A;  4JX4 A;  1UG2 A;  3JSP A;  5KCM A;  1O57 A;  1IF1 A;  3ZQF A;  2B63 J;  4LB5 A;  5L3D A;  2DLL A;  4XRF A;  2F5V A;  2MA3 A;  1SVO A;  3OYA A;  4KN4 X;  3NWT A;  1LFP A;  4PJJ A;  4L9V A;  2HZT A;  2E36 A;  5HDK A;  3DPU A;  4G8X A;  3W2W A;  1ZRD A;  2R93 J;  3SJM A;  1HA8 A;  1FOK A;  5TJJ A;  3KYC B;  5KNL A;  3SDG A;  2R7X A;  3K10 A;  2A3S A;  2EQR A;  4A3M J;  2LNB A;  4J01 A;  1V54 H;  2XGC A;  5TIS C;  3UKG A;  2VQG A;  1GUU A;  2E19 A;  4A0Z A;  2W84 A;  4XLF A;  1G3T A;  3TW7 A;  1UB9 A;  3BY6 A;  4BBS J;  2JVG A;  4EQQ A;  3CJQ B;  1WHU A;  5CPR B;  5F1R A;  2HYJ A;  4M9X A;  2V79 A;  3ULQ B;  2QBY B;  1ZEL A;  5HLT A;  3F6O A;  1IRF A;  3LFK A;  1BOA A;  3ZQC A;  3LSM A;  1RET A;  1D1A A;  1WQ2 A;  2M7A A;  2P5K A;  2QSH X;  2LY2 A;  2LVS A;  2F5C A;  3WU1 B;  1TC3 C;  1RUN A;  3DTI A;  4A6D A;  4ANJ A;  2RV8 A;  5FKK A;  4B3X A;  4P9U A;  2W25 A;  1YQA A;  2DQL A;  4IX7 A;  4NDL A;  5E18 F;  2HKO A;  4HST A;  2JVH A;  2CQ7 A;  1WCM J;  1WFX A;  2ME0 A;  3A01 A;  5GTH C;  1DQU A;  2IXS A;  2BXZ A;  3J81 Z;  4Y3O A;  3VPR A;  2XV4 S;  1ETK A;  5L3C A;  4CZC A;  3OYB A;  2HR3 A;  1BN5 A;  1AA7 A;  4Z2Y A;  2JPB A;  1H0M A;  2HQ5 A;  3RKX A;  4BXX J;  2B0L A;  3OYC A;  2K27 A;  1VTN C;  1MW7 A;  3EUH C;  4B8X A;  4NQW B;  4HG2 A;  2JN6 A;  3PFI A;  3MN2 A;  4DJA A;  3JAM Z;  2COB A;  1O3S A;  3OIP A;  1IRZ A;  3IC7 A;  2UXN A;  1MBE A;  1VQ4 I;  3EYY A;  1X3W B;  1WPK A;  1YW9 A;  2VBZ A;  3CC2 I;  2VUM J;  3TKY A;  3P7N A;  4HLY A;  3PUF A;  3EQL F;  1VQM I;  2CQN A;  4MTE A;  1EA3 A;  5ICG A;  3IV5 A;  3QOD A;  1XG1 A;  5FLM J;  5BOX A;  2LH9 A;  4G6T B;  1BJA A;  1Z0X A;  4ZDL A;  3BOQ A;  4RAG A;  3ROU A;  4XRS G;  2XRL A;  4OAY A;  2ICW G;  2EJR A;  1U0J A;  3H5R A;  1FJL A;  2O3F A;  1WJB A;  2DQR A;  4HNV A;  1MH4 A;  2PJP A;  3AFH A;  2IGK A;  2GA2 A;  5DCF A;  2EIJ H;  3DQV C;  3LWF A;  3E5X A;  4M9Z A;  1VQ8 I;  5LGU A;  3MQ0 A;  1K61 A;  3ZCO A;  3G2B A;  2F4M B;  1YX5 A;  3IKV A;  4MNU A;  3IAM 2;  3DEE A;  2HYG D;  3DEU A;  1T39 A;  2KHM A;  3HOT A;  2VAS A;  5IT9 Z;  1JI8 A;  1MBH A;  3DBL B;  5DM7 F;  1VQK I;  2YR2 A;  4FIS A;  2ADU A;  1BOB A;  3ZP5 A;  4P5O A;  3KEY A;  2QCO A;  4N0B A;  3K4B A;  4CUG A;  3C18 A;  5K1Y A;  5IYD J;  2X4H A;  3Q5F A;  2BY3 A;  3RKY A;  3MKZ A;  1Y6I A;  4M3G A;  4IO9 F;  3QU6 A;  5D6F A;  5IOY A;  3Q9S A;  1OKR A;  4BDZ A;  2DN0 A;  4BQO A;  2V4J C;  3GTJ J;  3QYF A;  3F8N A;  3HRS A;  4ZTF A;  2ZME A;  1XCB A;  4ENJ A;  1AOY A;  4DYQ A;  4Q47 A;  3R0J A;  4B09 A;  1FPQ A;  4HEA 2;  1R1T A;  2W48 A;  1W7P A;  3E97 A;  4D9J A;  2K3F A;  4AVZ A;  2EV5 A;  2DBB A;  3J7Y J;  2X6X A;  1KQ8 A;  5HNH A;  4AD9 A;  2EV6 A;  2AQF A;  1HF0 A;  1BIB A;  1X2M A;  4EGZ A;  1U5T B;  2BHY A;  1TWA J;  3JRG A;  1A6I A;  1UAA A;  2RNJ A;  2L7Z A;  5FLX K;  3DBR B;  4MEX F;  2VE8 A;  3T8T A;  3TBI A;  3DCF A;  4BQN A;  4ZYG A;  3M1E A;  1R4M B;  4CYC A;  2CV2 A;  5GP9 A;  1FMW A;  1NTC A;  1YS7 A;  1YW8 A;  2ISZ A;  5J1R A;  1HBX G;  4IRH A;  3W3C A;  4P96 A;  3S3N A;  3DWL E;  5ICF A;  5M5W J;  3K2A A;  2K9S A;  1BL0 A;  1X19 A;  4LOC A;  3LSI A;  4L9T A;  2V1D A;  4A3K J;  1R9T J;  3QWL A;  1YI2 I;  2GXB A;  2FNA A;  3SZP A;  5CLS A;  2ZSH B;  1Z05 A;  2CFX A;  1V5E A;  2M87 A;  3FXU A;  3K4C A;  1SFU A;  2K4J A;  3FKJ A;  1RC9 A;  3CTA A;  4M3F A;  3H9G A;  2L7M P;  5EGO A;  1X1C A;  2WTE A;  2BW3 A;  4CCL A;  5LD2 C;  1JXS A;  2STT A;  2Q2E B;  5AIQ A;  1O4X A;  4M6X A;  2VOP A;  5E1X A;  4UB8 C;  1KQ0 A;  2V9P A;  3HOS A;  2W4S A;  1SAU A;  4N9I A;  4LLG F;  3U1D A;  2R7Z J;  3SQN A;  3E6B A;  3S15 J;  4A12 A;  2O0Y A;  2X1C A;  3CMY A;  3VWB A;  1MND A;  4PJL A;  1Z67 A;  1VQL I;  1TNS A;  4E7H A;  4E7K A;  1ZRE A;  4EMS A;  1D5V A;  4BEH B;  3MVP A;  2MGQ A;  4AUX A;  2CJJ A;  3OYG A;  3H0G J;  2VJ5 A;  3LAJ A;  2Y9Y A;  4M3B A;  2IBD A;  3E6C C;  4S04 A;  4HX7 A;  1D8K A;  2Y2Z A;  2W57 A;  1Z9C A;  2WB1 N;  1LEB A;  5J1U A;  2OTL I;  1I6X A;  4OAZ A;  4ZYH A;  4PFO A;  4F3Q A;  3CCQ I;  5C4X J;  5LHI A;  3RYP A;  4YG2 F;  3MZ8 A;  3RCO A;  4BJ6 C;  3J7Z I;  3RPU D;  2M8G X;  5JVG F;  5F64 A;  1ZG3 A;  2DT7 B;  3R61 A;  1Z7L A;  3OY9 A;  2R5Z B;  2OCE A;  3JCU C;  3NWS A;  2HZD A;  3CF2 A;  4E7Z A;  4ZH4 F;  2OTJ I;  1IV6 A;  3VOD A;  1DU6 A;  2G7U A;  1R7J A;  4BQQ A;  5DCM B;  5EG0 B;  2MD5 A;  2QEX I;  4XLC A;  5BPD A;  2RAE A;  2X0L A;  5DYM A;  4L0Y B;  3BTJ A;  2HOT A;  1FSH A;  4QPQ A;  1YFH A;  1JUS A;  2X85 A;  4G94 A;  1ODD A;  5GAD J;  1I3Q J;  1W0T A;  5EEG A;  4UUT A;  2QSF X;  4MHG A;  5J4Y A;  2LK2 A;  2HFH A;  2CUJ A;  1FYK A;  1OPC A;  2CW8 A;  5ICE A;  1WJF A;  3G71 I;  2DOD A;  4NC8 A;  2K7L A;  2HPM A;  4HF0 A;  2WA0 A;  4PGG A;  4FE4 A;  1KU3 A;  3AG1 H;  3LSJ A;  3KP5 A;  1T08 B;  3E5U A;  2Q0O A;  2L9R A;  1X3Z B;  2NOG A;  1UG0 A;  5IPA A;  5ED4 A;  1XDS A;  4DW6 A;  1JHH A;  1OCO H;  2LG4 A;  4BBR J;  3IUO A;  4XLN F;  1YOV B;  3G73 A;  1R58 A;  4S05 A;  4BAC A;  1K6O A;  3CJN A;  3AL0 B;  2FQ3 A;  3PM1 A;  2VC1 A;  3CCV I;  1PYV A;  3H92 A;  1U9N A;  3OOU A;  3SXY A;  1R22 A;  3SHF A;  1HDP A;  1MMD A;  4MIM A;  4L9N A;  1XC5 A;  5CVU A;  2RKH A;  4AWX B;  3DV8 A;  4M73 A;  3HJE A;  1SD5 A;  2CW7 A;  1RRJ A;  3CCL I;  2H8W A;  1EH6 A;  3FDY A;  4L18 B;  4AIH A;  2VT2 A;  1BJZ A;  4D7N A;  1LKX A;  3M8E A;  4QSH A;  3WE3 A;  2M7B A;  2XPV A;  4LIT A;  1T98 A;  2JPC A;  2F4I A;  1K4S A;  3FXO A;  2IS6 A;  2FOW A;  4E7S A;  2WAD A;  4O3M A;  3ASN H;  4RB1 A;  3PJR A;  1P7I A;  2ELJ A;  3UNG C;  3ZQI A;  4BJT A;  4HZF A;  4XN3 A;  4JYK A;  2OPT A;  3H9J A;  2GLO A;  2JUC A;  3D0S A;  1D8J A;  2MD0 A;  2G7H A;  2IJL A;  2QWW A;  4CZZ A;  3HOU J;  2DJN A;  3C3W A;  2M4K A;  3N4M A;  2E35 A;  2VC0 A;  3BQY A;  3WG7 H;  1ERD A;  2VB6 A;  2ELK A;  4HX4 A;  1L3L A;  1DDN A;  3IH2 A;  2LDU A;  1VI0 A;  2JUG A;  3BT9 A;  2L4A A;  5KAF C;  3SDB A;  5LGN A;  3WHB A;  4DZP A;  4ENN A;  4BL0 B;  2KQR A;  1ZKG A;  2A05 A;  3FWE A;  3KLN A;  4Q48 A;  1YLF A;  4N4O B;  2JJ7 A;  4B43 A;  4UUS B;  1Y8Q B;  3GYH X;  1MSF C;  1UST A;  4QWQ A;  4YIR X;  2KP6 A;  1G8X A;  2FBI A;  2VBY A;  4RGR A;  3VYR B;  4LG0 A;  2YPR A;  3GFI A;  3PO3 J;  3S17 J;  1J7K A;  1XN7 A;  1LVK A;  1G3W A;  1X1A A;  3OSF A;  1LB2 A;  3F8M A;  5D5X B;  4BE0 A;  3QRF F;  1R1V A;  2X6O A;  1PJR A;  2H94 A;  2K4B A;  1B8I B;  1ZRC A;  1V4R A;  3R6S A;  1I1S A;  4CYD A;  2M8E A;  1I50 J;  4XKW A;  1S7E A;  3GWZ A;  3RTR A;  2L02 A;  4D5C A;  3LSP A;  4G7O F;  3FXM A;  2E71 A;  2LMD A;  3LSK A;  1BI1 A;  3GME A;  5E8I A;  1JT0 A;  2KRF A;  1U6G A;  2VI6 A;  1OCT C;  2OC6 A;  1XMA A;  2A6H F;  2DMP A;  5EJC A;  4RBO A;  4RMN A;  2CQQ A;  3QYE A;  3GLX A;  3A02 A;  3KX2 A;  3P5J A;  2IGO A;  2QF7 A;  3CCR I;  1PP8 F;  4WXD A;  3H0D A;  4HNT A;  4ESF A;  5H2F C;  2VIX A;  2ECC A;  2K9M A;  3GTQ J;  2F2E A;  4FQG A;  1KYZ A;  1S5L C;  5HS9 A;  1W36 C;  1KGS A;  2MAB A;  1OCR H;  1B72 A;  1ZAR A;  2H1L A;  3WE2 A;  2KRC A;  2IA1 A;  3HSF A;  2WAQ A;  2O6G E;  2MLK A;  4RM2 A;  4BE2 A;  3W6V A;  3S1Q J;  1BR1 A;  3T1B A;  2DTZ A;  4OIR F;  4E70 A;  3S3O A;  4PJN A;  2Y0M A;  4XSZ F;  2NRA C;  5ICC A;  2NVQ J;  2BEO A;  4MQ9 F;  2EH3 A;  1OCP A;  3F23 A;  3MCZ A;  2XKO A;  2DYR H;  1MSE C;  2XVC A;  2CU7 A;  4A0X A;  2V26 A;  3BP8 A;  1Y1V J;  3DTK A;  1S6L A;  1Y1W J;  1QA6 A;  4FHT A;  2EA2 A;  3SFI A;  3OR1 C;  2AQE A;  1SAN A;  2K86 A;  1ULY A;  3ZMT A;  2PEX A;  4P9F A;  3W2V A;  3AG3 H;  3BCA A;  2R5Y B;  2XGX A;  1SMY F;  4AVP A;  3ML6 A;  5BMZ A;  2V1N A;  4PUS A;  1ZRF A;  4UVB A;  2A61 A;  1IN4 A;  3VFZ A;  2KT0 A;  1OYW A;  3WTW C;  3TP3 A;  2L7K A;  4Q5S F;  2Z99 A;  2JK3 A;  3MEX A;  3HM5 A;  1MJ9 A;  2XAS A;  4WF2 A;  5K7Z A;  2KIS A;  5ERI A;  3WG9 A;  2VJI A;  1B6A A;  1I3A A;  4UNO A;  5EF6 A;  2H09 A;  1ZR4 A;  5D5U B;  2ZJP F;  2LRE A;  1BBY A;  5CKT A;  2LLK A;  4H0E A;  4XOR A;  1RKT A;  2MH2 A;  4IEJ A;  1Y8R B;  1MIJ A;  3GTP J;  4II3 A;  1A36 A;  2Z9O A;  3S14 J;  4UVC A;  2QSG X;  2P6T A;  3AG4 H;  1K78 B;  3HBL A;  1O3R A;  1YIT I;  4KMF A;  4A5M A;  2KIM A;  1LNW A;  2PFB A;  1FBQ A;  2DW4 A;  1A31 A;  1J2X A;  2O03 A;  4WXH A;  3V8L A;  3F8B A;  3QPH A;  2YUS A;  5FRN A;  2NOJ B;  2OQR A;  1YRN A;  4XID A;  4OIN F;  1OFC X;  3PIO F;  2OA4 A;  3FM5 A;  3C2B A;  1FIP A;  1XGN A;  3BRO A;  3BZ6 A;  4ZYA A;  4YRV A;  3PNV A;  2VL8 A;  4HBL A;  1O7L A;  5CYV A;  2NNN A;  3EUA A;  2D1H A;  1B4A A;  5E3M A;  4XRS A;  3K2Z A;  3SEQ A;  3LMM A;  4CO8 A;  1HKQ A;  1QVT A;  2V1X A;  4QPO A;  3ABL H;  3RYR A;  1Z6T A;  4RLF A;  1J59 A;  2F5E A;  1FOY A;  3IAS 2;  4FT8 A;  2KJC A;  2DA7 A;  3FZV A;  1D0X A;  3I4M J;  4KIB A;  4W1U A;  3UR3 C;  2R3S A;  2K9Q A;  3ZN0 A;  5J6X A;  2ZFW A;  2AS5 F;  2UZK A;  3J7A Y;  4DBR A;  3LSR A;  2LKX A;  3S1R J;  5GPC A;  5IY5 H;  2XGE A;  3Q9V A;  3OOP A;  1GVD A;  1VF9 A;  5IP9 J;  4WWC A;  5LBQ A;  3PFY A;  1C0W A;  3KYL A;  1KYW A;  2D1V A;  1IN8 A;  2JTV A;  4YEL A;  1X1D A;  5IOZ A;  5J40 A;  1KA8 A;  2GWR A;  4BQA A;  3J80 K;  1HOM A;  3I4P A;  3DF8 A;  2A5W A;  2IW5 A;  4EJW A;  2HI3 A;  5JLW A;  1ETV A;  5LHH A;  2LBF A;  3V7R A;  3V4G A;  1BW6 A;  3B6A A;  2DOF A;  1JJ8 C;  4DIQ A;  2XF6 A;  3T5X A;  3LA3 A;  4MQV A;  3F8C A;  4NNJ A;  1IW7 F;  3GUD A;  2DU9 A;  4XBF A;  2DOA A;  2FU4 A;  1X1P A;  2QQA A;  2L01 A;  3W2A A;  2BVL A;  4KIG A;  2NVT J;  2R7U A;  4KN7 X;  2FEZ A;  2LY1 A;  4UV9 A;  3BG5 A;  4ZYE A;  1Y0N A;  3LNQ A;  1RES A;  5DUI A;  3BCB A;  3ABT A;  2LFB A;  4BDY A;  1YO5 C;  1YE9 A;  1ZGJ A;  1UHW A;  5H6R A;  1T95 A;  3WTX C;  1MDM B;  2OJE D;  1F1Z A;  1N25 A;  2FQ4 A;  4D0P A;  2DA1 A;  2M0M A;  1IN6 A;  2VOO A;  4MGR A;  1JTX A;  3HHG A;  4GYI A;  2M5W A;  4BXU A;  1TT5 B;  1D1B A;  4E7J A;  2QKL B;  3BR3 A;  1V3F A;  3ZRG A;  6PAX A;  1KU2 A;  1QO0 D;  1ACI A;  5BS6 A;  1S29 A;  3ZMD A;  4EVI A;  4PSX A;  2DA6 A;  2WV0 A;  2Z1D A;  2RC4 A;  2VJ4 A;  2GOM A;  3FHN A;  4J19 A;  1JE8 A;  3RQ4 A;  1AKH A;  1XDU A;  5HDN A;  3HRM A;  4M74 A;  4XRM A;  3L2U A;  5DD4 A;  1D0Y A;  1XGM A;  3H3U A;  1H9T A;  3VYT B;  1VQN I;  3HOY J;  4EV0 A;  4Z6Y A;  1MGT A;  2XB0 X;  3QQA A;  3OYD A;  3B73 A;  1ENH A;  2M30 A;  1ON1 A;  4N9H A;  1AHD P;  2ETH A;  2Y48 A;  5GTI C;  3GLL A;  4HLX A;  5DEQ A;  2H6B A;  3BR5 A;  3ZQQ A;  2FBK A;  2M9H A;  3X2Q H;  4HQE A;  1XCV A;  5K7F A;  1VQ5 I;  2CYY A;  3V7S A;  2OF7 A;  1W7P B;  4HSR A;  1X58 A;  3E7L A;  1Q1H A;  3GW2 A;  2DTR A;  3RKQ A;  4IVN A;  4RGS A;  5IT3 A;  1BA5 A;  1ZHF A;  1R36 A;  4CCN A;  3G6E I;  4L0Z B;  1MBG A;  3ZXS A;  2RNG A;  1IXR C;  3BG3 A;  3D5S C;  1JKO C;  1FX7 A;  2MLG A;  4BNC A;  1IRG A;  3FXL A;  3OMY A;  1J5Y A;  1STZ A;  1FTT A;  1BIA A;  2M1B A;  1R4N B;  1TL8 A;  1N77 A;  4IRG A;  1ZG1 A;  3JRH A;  3N97 A;  1WSU A;  3FHZ A;  1DGW Y;  4OOI A;  5TRD A;  2DMT A;  2TRT A;  3GXO A;  1GLN A;  1Z77 A;  2LKP A;  2GXA A;  5HLI A;  2QBY A;  1ZN2 A;  2W85 A;  3G1O A;  2BYV E;  4KNY A;  4NC6 A;  4L5J A;  1ZGW A;  1U9O A;  3ZMS A;  2LOO A;  4IF4 A;  1OQY A;  4DNC A;  4I7H A;  4RDU A;  2VOD A;  1IN5 A;  3K9T A;  4D7M A;  1ZAO A;  1DGR M;  2EZH A;  2DMQ A;  3KP3 A;  2DFE A;  3DLL F;  3CQZ J;  2DAO A;  1S7A A;  3CCY A;  4LGW A;  1VND A;  4HNU A;  4BAY A;  2H8R A;  4WK8 F;  1JUP A;  5E20 A;  3BLY A;  4HV5 A;  3QPS A;  2MC4 A;  4I76 A;  5K5O A;  3EYI A;  1EF4 A;  3HYI A;  3H35 A;  4Y33 A;  3S1N J;  1K6Y A;  3ZGK A;  3J7A O;  3TDZ C;  3HC7 A;  4L5I A;  1LDK B;  2MYS A;  3CUO A;  4CXF A;  1G59 A;  1FOX A;  2CQX A;  4WXC A;  2JZY A;  2NS8 A;  1EV7 A;  3GBG A;  3GX4 X;  3F21 A;  1OYY A;  3CDI A;  2JA6 J;  1Y0U A;  3Q3S A;  4F55 A;  1R23 A;  2GAU A;  4JP0 A;  5GAG J;  4UV8 A;  2GZW A;  5H20 A;  3ESW B;  2FSW A;  3I54 A;  4HF2 A;  2ESN A;  4XIC A;  1IC8 A;  1MBK A;  4ZZD A;  4A3L J;  2DJI A;  2BV6 A;  2B7E A;  2G0E A;  5AON A;  2Q8K A;  4ZJZ A;  5F08 A;  4BJ5 C;  1J0R A;  1TQI A;  1TW2 A;  3CUQ B;  2DA4 A;  1Y39 A;  1TWH J;  5HLG A;  1Q1V A;  2HQN A;  1W7P D;  2UUZ A;  2XAH A;  1DU0 A;  2PJR B;  4N4N B;  1RUO A;  5L3F A;  4HA8 A;  3HOW J;  5D4R A;  2N8G A;  4QIW N;  4M6V A;  1H8A C;  3HOZ J;  2DYS H;  2NVU B;  1TW3 A;  4IL6 C;  4ZTJ A;  5GAH J;  2XKP A;  4PSW A;  4II2 A;  3L1P A;  1IJW C;  4Y13 A;  3J80 Z;  3SEZ A;  1D5Y A;  4IKF A;  3K7A J;  4X6A J;  4AM3 A;  4Y4R A;  2PMZ N;  3MAJ A;  2VBX A;  3PNY A;  4XON A;  3IRQ A;  3P9I A;  3WGG A;  4LK0 F;  1FYM A;  3CDH A;  1P4A A;  1KQ9 A;  1YYV A;  5IP7 J;  2XSD C;  4U87 A;  2XRN A;  4C2U A;  2IA2 A;  3EUK L;  2HXO A;  2XHK A;  3T8R A;  3HRT A;  4LB6 B;  2P81 A;  3WTV C;  3G3Z A;  1NHA A;  5C3E J;  5LRR A;  4B1R A;  3L2V A;  3K70 D;  2COM A;  2CMP A;  1QNT A;  4IZZ A;  4A3C J;  4KUM A;  4KT5 C;  2HOA A;  2YS9 A;  2J5O A;  1MZB A;  3ERM A;  4CDG A;  1E3P A;  1QU3 A;  1P2F A;  3H1C A;  2ECB A;  3RPU A;  4CGZ A;  2F5D A;  1B9M A;  3BZC A;  3I0T A;  5GAE J;  1XSD A;  5FLV A;  2R7S A;  3ZN1 A;  2XAQ A;  1IN7 A;  4Y7N J;  2Z33 A;  1W0U A;  2HOS A;  2EWN A;  2DFF A;  2HDW A;  3H5N A;  1S72 I;  3TW6 A;  4IPA A;  4ETS A;  1P9Q C;  4EM0 B;  3BR0 A;  5KAI C;  3VOE A;  1T6S A;  5E3L A;  2GIV A;  4ZYD A;  4PGH A;  3BTI A;  1UCR A;  3CZ6 A;  3KZY A;  3N05 A;  1U5T A;  1DP7 P;  2L54 A;  1IO2 A;  2K3P A;  2W00 A;  1XMK A;  2KIF A;  4HV6 A;  3VSL A;  4IXA A;  3PNT A;  3KYD B;  5EEH A;  3TDU C;  4BS9 A;  3IWZ A;  3O3K A;  1W1W E;  4KFC A;  4XQF A;  4MTD A;  2YU3 A;  3L2Q A;  3LA2 A;  1HKS A;  4HW0 A;  1HDD C;  3E5Q A;  5DDG A;  2QQ8 A;  5K5Q A;  3TL4 X;  3C7J A;  1WZ2 A;  2KJB A;  1LFU P;  1OLT A;  2VT3 A;  5E3O A;  4FX4 A;  1F9N A;  3VSK A;  4UHT A;  3HSE A;  5HVQ C;  4NHJ A;  1ZTR A;  1YX3 A;  4A3D J;  2CG4 A;  3OS2 A;  2FA5 A;  1HSJ A;  4KJZ A;  3OYN A;  4IHX A;  3MZH A;  1FNN A;  1SMT A;  1ZLK A;  2HWV A;  3V8K A;  2ZBK A;  3WGI A;  1O7F A;  3GCM A;  4NBQ A;  2EZK A; 
#chains in the Genus database with same CATH homology
 1HC8 A;  3CJT B;  2E36 A;  1VQ9 I;  1VQ5 I;  1VQL I;  3CCM I;  1VQ8 I;  2FOW A;  2ZJQ F;  5GAH J;  3G4S I;  2ZJR F;  1YIJ I;  1QA6 A;  3CCE I;  5DM7 F;  3G6E I;  1VQK I;  1YJW I;  1VQ7 I;  1VQO I;  2OTL I;  3CCQ I;  2E35 A;  1YJ9 I;  3J7Z I;  4IO9 F;  1MMS A;  5JVG F;  1YHQ I;  5DM6 F;  3CME I;  3CMA I;  3I55 I;  2OTJ I;  1YJN I;  3CCJ I;  2QEX I;  2K3F A;  3J7Y J;  2ZJP F;  2NXN B;  5GAE J;  3CCS I;  5GAD J;  1FOW A;  1S72 I;  3DLL F;  4IOC F;  3G71 I;  4UY8 I;  1YIT I;  3CC7 I;  1ACI A;  1VQ6 I;  2JQ7 A;  1FOX A;  3CCU I;  3PIO F;  3I56 I;  3CCR I;  1VQ4 I;  2E34 A;  4V19 K;  3PIP F;  1YI2 I;  5GAG J;  1VQP I;  3CC2 I;  3CCV I;  2QA4 I;  1VQM I;  1VQN I;  3CD6 I;  3CC4 I;  3CCL I;  1FOY A;  4IOA F;  3CF5 F;  1Y39 A;  2H8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...