3CCMI

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
70
structure length
70
Chain Sequence
b'GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3ccmI00
2ZJPF 1VQMI 3CMEI 1YJ9I 1S72I 1VQKI 1HC8A 4UY8I 3I55I 3I56I 3CJTB 1VQOI 1YIJI 1YJWI 2E36A 1MMSA 3PIOF 2E34A 2NXNB 4IO9F 1FOYA 5GADJ 3CCMI 3CCQI 2E35A 1VQ5I 1VQ7I 5JVGF 5GAHJ 3DLLF 1VQ9I 2H8WA 3CCVI 1YITI 3PIPF 1ACIA 2JQ7A 1FOWA 1QA6A 4IOAF 3CCRI 5GAEJ 1YI2I 1YHQI 1VQ8I 4V19K 3G6EI 2ZJRF 3G71I 3CF5F 3CC2I 2QA4I 2K3FA 2ZJQF 2QEXI 2OTLI 3CCJI 3CCEI 2FOWA 1VQ6I 3CD6I 1FOXA 3CMAI 1Y39A 3G4SI 3J7YJ 1VQNI 1VQPI 3CCUI 3J7ZI 3CC7I 3CCSI 5DM7F 1VQLI 1YJNI 5GAGJ 2OTJI 4IOCF 5DM6F 1VQ4I 3CCLI 3CC4I
chains in the Genus database with same CATH superfamily
5D5WB 1AHDP 2KDOA 1S3JA 4O3MA 3BJOA 2LR8A 2FXAA 2E1NA 5FB2A 1Z77A 4NBQA 5IYBJ 1XDUA 2H1LA 2M7AA 5TISC 1ONVA 4PJJA 1UHMA 2KJCA 1BR4A 2PEXA 1DDNA 3HRSA 4Y13A 3I56I 2FOKA 3N97A 4PGHA 1BIAA 3EQLF 4BHBA 3I71A 5EDNA 2E2HJ 4EGZA 1ZRFA 2E34A 1D0YA 2BW3B 4M3BA 1MW7A 2AQEA 4OIQF 4WX9A 2DMTA 3HXLA 3MZ8A 2A5YB 1FOYA 4BEHA 1DP3A 2UZKA 1AA7A 4ZYGA 2UV1A 4BH9A 4HF2A 1ZGJA 1QHHD 5FKOA 4AU7A 3DLLF 3KCCA 1OYWA 4IXAA 2YU9J 4XMYA 4BJ5C 3OYAA 5LEJA 2VQLA 3GCMA 3SHFA 5EG0B 2LF7A 2ZMEB 3LA7A 1F4KA 1Q1VA 3ZXSA 2DYSH 2A6TA 2L9VA 3AL0B 4IOAF 4NDLA 1R5GA 4CZZA 4FETA 1YHQI 2VBYA 4Y17A 3EPZA 5K1YA 4EJUA 2MH2A 2DFEA 2FEZA 2X48A 2EZKA 3ZCOA 3T1BA 2ESNA 2VIXA 1DU0A 5HDKA 3L2QA 3FK7A 3IHUA 1HW5A 5ICFA 2FUG2 1B72A 4OMZA 2IXSA 2XAQA 2VC0A 4JP0A 3OYHA 1MBEA 5C3EJ 3RKXA 1FOXA 2STTA 2LOOA 2W57A 4XRMA 2X6YA 1D5VA 4KN7X 3NRVA 1R00A 2OCEA 4CO8A 4CUGA 2F5FA 2ZNYA 1RC9A 4E7IA 4BQNA 1T08B 4QWQA 1BI2A 1D5YA 2DW4A 1N25A 3SDBA 3JRCA 4IF4A 1TP4A 3V7SA 1GUUA 2MW8A 5D5VB 2NVQJ 1VF9A 2DOFA 2H8RA 4AYBA 4IPAA 5JLXA 3G2BA 3TOBA 2OJED 4HSRA 4UUSB 3HGGA 2E1MB 3BY6A 4GYIA 1R1TA 2BW3A 1KU9A 3C7JA 1D0ZA 2JRTA 3DP7A 4G6DA 1X1CA 4IJAA 5DM6F 1PVEA 5J8FA 3A02A 1UHSA 1VQ4I 3D5RC 1BN5A 4XQFA 4Z6YA 1Y6IA 2Y0MA 4XR6A 2A6EF 3DEWA 3SZGA 1GXPA 3HRMA 1LEBA 5HVQC 3O8GA 1JUPA 1SEUA 3GLXA 3KP5A 5LHHA 2JJ7A 1YJ9I 2QKLB 2GAUA 3MKWB 2P6TA 3CUQC 3E6MA 5E3OA 2R7FA 3V8JA 4ESFA 5EG0A 5BMZA 2ZMEA 2JVGA 1C0WA 2DT7B 3IC7A 3T8TA 3TP3A 2WAQN 2DA1A 4P1WA 2E2IJ 1ZYRF 2KRHA 4TV7A 3D5SC 3HC7A 1ZGWA 2Z9OA 4G94A 2WY7Q 4I6ZA 2HOAA 1RUNA 2LSOA 2XROA 1MBHA 2NS7A 3V7CA 4CCKA 3DLAA 2OUMA 2VQHA 4XLAA 2D5VA 3UNGC 2HQAA 2XKOA 1XC5A 2KFDA 5GAHJ 1XGMA 2G9WA 2KIUA 3VOEA 1HBXG 5FLMJ 2NRAC 3O2PE 3GZ6A 1STZA 3IKTA 2HKXA 1CQTA 1GLNA 3LFKA 2XIGA 1HKTA 5D5UB 5J47A 3BG7A 1ON2A 3EYYA 1L3LA 2ACJA 5M5XJ 3S17J 5IYDJ 2KRCA 2KRFA 2L2OA 2ISZA 3BQYA 1Z3YA 3RI4A 1LFUP 2FA5A 3WTZA 4JK1X 2V6EA 3ZMUA 4X1EA 4RM2A 4U7BA 5GTHC 4V19K 2WBMA 1OCTC 4IRIA 2AXLA 1KU3A 1HDDC 1G3WA 2BY3A 4A3CJ 3CC2I 5KNLA 2R7RA 4BJ6C 3J81Z 4CGZA 4RDUA 4UUSA 3CMMA 5J1UA 2R7UA 3GYHX 5E3NA 2BEOA 1FEXA 2L02A 2FNAA 5HS8A 1A36A 1XCVA 1TQMA 2EFQA 1SMYF 2GA2A 2L9NA 4H0EA 2EBIA 4C9YA 3S2WA 2R5YA 1LPQA 4W97A 4G7HF 4XSZF 3PO3J 1VI0A 4FASD 4L18B 3JRBA 1W7PB 2VL8A 4DYRA 2CV1A 3MZYA 4XKBA 3E0JB 4MIMA 1W5CC 4FE7A 4MTEA 2V79A 1KYZA 2QCOA 4HLXA 4I7HA 2DJIA 1BI3A 5DDGA 1U78A 4IHSA 1B6AA 3QP6A 2UWMA 5CVIA 1Y56A 5ILVA 5L3FA 2UUZA 2WB1A 4BKXA 4EGYA 3RKWA 4HF1A 5FFZA 4LB6B 1WPKA 2K02A 1LDKB 4WXCA 4XLFA 4J01A 3OYIA 1XSXA 1OCCH 3RDIA 1WJDA 4BY7J 2OD5A 4KT6A 1X58A 3NARA 4XK4A 3O6BB 1HC8A 3FWEA 3HHGA 4PUSA 1G4DA 2DJNA 4CCNA 2QUFA 5H2FC 5EGOB 2N8GA 4ZYEA 1BM9A 5L3DA 3K7AJ 2QQBA 1A6QA 1MNDA 2P0WA 3P7NA 5L3EA 1YJWI 1D3YA 5C4JJ 2OF7A 4HV5A 5IOYA 1TC3C 4JX6A 1O3TA 3GTGJ 1RZ4A 3BTJA 1OCRH 3U21A 1FBUA 2E19A 4RGRA 2EWNA 2M4KA 2HTJA 1BOAA 2Z99A 4E7LA 2IP2A 4E7ZA 2HKOA 4AIKA 2MA3A 2YPRA 2K27A 9ANTA 1OCOH 2IJLA 3RYPA 5K7HA 5ICCA 1I27A 3R4KA 3D0SA 1U9OA 1RI7A 1WH7A 2CSOA 2VASA 3L00A 1YLFA 1HKSA 3OL3A 2V6CA 2A05A 2ZKZA 4MEYF 2NVTJ 2RNGA 1W7PA 4J00A 3G6EI 2HYFA 5LRSA 2RN7A 3LL7A 3ASNH 1D1CA 3LAJA 2WADA 2COMA 4IRGA 2IRFG 3OV8A 1ZLKA 3S1NJ 2L5QA 3I5UA 3DFGA 4B3AA 2QA4I 1IJWC 2K3FA 4U0YA 3C2BA 3W3CA 2HVSA 5GTIC 1P9QC 4N0BA 4BBRJ 3CCJI 3I4PA 2Y75A 2IS2A 3CJNA 4IL6C 4LIVA 4M3DA 1ZG5A 2XF5A 3ZOBA 3I59B 1ETVA 3WTSC 3CMAI 4XNFA 2R7QA 3WU1B 1O3RA 4IHTA 1D1BA 2LP0A 4E7JA 4U0WA 1XGNA 1LVKA 1W7PD 3H5RA 2X6XA 5DD8A 4MHGA 4KMFA 1O7FA 2G0EA 2JUGA 3ZRGA 2IA2A 3FF5A 1JXSA 2DA5A 2K9LA 3OYJA 3D5LA 3S16J 1R5HA 2P4WA 3J80K 2F48A 5EGOA 3L2RA 3OIQA 2GOMA 2IA1A 2O5RA 2X1DA 1VQLI 3GTQJ 1H0MA 4L0YB 1QPMA 4L9JA 5BS6A 1JHHA 3BTCA 2Z3YA 3A2KA 5M3FJ 4C3HJ 2X1CA 1Y8RB 5ILSA 5BQTA 4JQFA 1ORKA 1RETA 3P9CA 1BI1A 2I5UA 1LDJA 5DS9A 5FO5A 4ASNA 4CYCB 2R7ZJ 1TT0A 2ID3A 1AU7A 4M6VA 1UHWA 2H1KA 5IY5H 2XB5A 3DV8A 3KX2A 3K0LA 3S32A 2BGCA 3RQIA 2B0LA 5K7ZA 4DZPA 2B9SA 1OCZH 1T8IA 1ENHA 2VLAA 5FRNA 2DT6A 1UB9A 4BS9A 3PIOF 1BC7C 3GFLA 4A3LJ 1IRFA 4M72A 4IEJA 5F0FA 4ENNA 2NVXJ 3VYUB 2WY8Q 3CCQI 2CRGA 1GVDA 1YE9A 3WODF 1U9NA 1ZH5A 2HXOA 1IN5A 1YX3A 1YOVB 3VPRA 4BYYA 4PK4A 3CJQB 5EJCA 1R9TJ 2XSJC 4HEA2 3MAJA 1P92A 2CH0A 2TCTA 3HGYA 2EQRA 5LRRA 1OKRA 4UHTA 6PAXA 2VPRA 1OYIA 3DU6A 2K40A 2CQNA 1T38A 5DYMA 2CQXA 1OPCA 3H5NA 3F6VA 2DA3A 3QWLA 1AKHB 2R0QC 2GIVA 4D5FA 4XKWA 3G71I 3O3KA 4XSXF 4WK8F 2XRNA 2VJJA 3S2HJ 4XONA 2DTZA 3NEUA 1QO0D 5J3LA 3DU5A 2DOEA 3ZQHA 3ZQFA 4KA4A 2MC4A 4CYDA 4OMYA 1V4RA 2IS1A 4OIOF 5L3CA 2Y69H 2XKPA 4AIDA 2BV6A 1POGA 3RKQA 3GFJA 2VJ4A 2JSCA 1YG2A 1S7OA 4CYCA 3BTIA 3HEFA 1VQPI 2STWA 2BY1A 1MZBA 2RAEA 1W0UA 3JCUC 4M74A 4II2A 1GV2A 2VB6A 4YRVA 2M4GA 2ZXWH 2HNHA 1XGSA 1X2MA 3GTLJ 1XSVA 2GIZA 2LREA 5JI6A 1RESA 1F43A 2QGUA 1V3FA 4B43A 1REPC 4DYCA 3BOQA 1WQ2A 2FE3A 2GZWA 3PQJA 1FYKA 1RR7A 1MH4A 3OIPA 4N9IA 2EA4A 1V55H 4KT5C 5FKMA 3T8RA 5D5XB 3ABMH 3JRDA 3KLNA 3GW2A 2RGVA 2W84A 1FIAA 3GWZA 5E3LA 1ON1A 3MMYB 1HF0A 4UUTA 3NWSA 3FXLA 4CCMA 1IRGA 2RDPA 2MLKA 3U1KA 5E1ZB 1MDMB 2BXZA 1ZK8A 2CUFA 3CJTB 3CUOA 1FOKA 5DEQA 1ZARA 2VKDA 1RR8C 3IWFA 1Y0NA 1AKHA 4XLHA 5KAFC 3ZQCA 3ZMDA 5GADJ 2KMUA 3AL0C 3SZTA 5M5YJ 2M8EA 3RPQA 1BJAA 2VKHA 3KFWX 3KP7A 3TQNA 3JRGA 3OSGA 1GXQA 4DBRA 5E8IA 3P5JA 2EV5A 4C2UA 2R7WA 3MN2A 3LFUA 1U5TA 3IH4A 2DQLA 3FM5A 3WTTC 2YX7A 1Y0UA 2VT3A 3QODA 5EEGA 5HS7A 1RIOH 2L7FP 3FISA 3DKYA 3BCBA 2KDZA 4BE1A 3VYSB 3ML6A 2M45A 2LKXA 3AG1H 2IS6A 4RAYA 2CFXA 2DT5A 4AYBN 3K1MA 1CGPA 4MEXF 1UZCA 1LKXA 1TNSA 2R7OA 2E5NA 5F27A 1PDNC 5J1RA 1X3UA 3BTLA 1E2XA 3MWMA 5EZHA 4HX7A 3VFZA 4RBOA 2DBBA 3HOTA 3CF5F 4IHYA 3GTOJ 3WE3A 2P5LC 3A01B 3TO9A 2K9SA 4F3QA 2EINH 1FPQA 3ULQB 2VXZA 3WTWC 1XGOA 4OOIA 1E0EA 3K4MA 4FHTA 3S1MJ 3BDDA 3A1YA 2ICWG 1YO5C 1S6LA 3HG9A 1KU7A 1S9HA 2W4SA 3CTAA 3E5QA 2VXDA 2VPLA 1JT0A 1ZAOA 3GLLA 1V54H 1TWHJ 4KN4X 2E1MC 1EKEA 4LLLA 1SVOA 2YU3A 5HLTA 2V9VA 2VOOA 1Z7LA 4GCVA 3MQ0A 2JN6A 3HSRA 1FYMA 2NAZA 4E4HA 1IXRC 1FYLA 1XMKA 1MDMA 2ME6A 2UXXA 3QPSA 4XN3A 2CGPA 3ZMZA 3E5UA 2EK5A 2V1UA 1FBQA 4L9TA 5F08A 1ZGAA 3K10A 5JHFA 1SMTA 2FD5A 3OIOA 4GXOA 4PFPA 4OINF 3ZPLA 4UV8A 3FIWA 2XRLA 5TGTA 4FE4A 1TZLA 4XM3A 1SFOJ 2EV0A 4B48A 2M7BA 2WAFA 1A04A 2DA6A 2CW7A 3KZZA 1SAUA 4MQVA 2D45A 1X2NA 1SFUA 5BNGA 2ISYA 4F52A 1TQIA 2A6HF 3BCAA 3AG4H 2WTEA 4UNOA 2V1XA 1SC7A 4B3XA 4YFNF 1W0TA 3HM5A 4HRIA 1MBKA 1B72B 4KUMA 3OYLA 1J9IA 4RB0A 2Y31A 4WXDA 2CO5A 3TDZC 3A01A 4UUVA 2TDXA 5KCMA 5CYVA 3K1PA 5ED4A 1EV7A 3C3WA 1VQ9I 1CF7A 2W82A 2AHQA 2P5VA 1J0RA 3BG6A 2YR2A 4ENJA 1O57A 5FGMA 3OYEA 4ZTJA 3OOUA 1T56A 3MKYB 4DW6A 3ECHA 1E3OC 1FIPA 5E17F 3CCRI 2FX0A 3G1MA 2FNPA 3OYGA 4FTHA 3G3ZA 4ESJA 2OQGA 2L4AA 5D6FA 2DPDA 3BC8A 1WJBA 1WJFA 4WXHA 5FKKA 3J80Z 1XS9A 4G8XA 4RGSA 1PP7U 3K4LA 2XASA 3RYRA 4M3EA 3JAMK 5IT3A 3K4KA 1YFHA 3TL4X 2R4GA 2OTLI 5KAIC 1LFBA 3L09A 1IUFA 2D1HA 3H5AA 4WCGA 3OS0A 3VWBA 1QVTA 3GEZA 4HSTA 1VQ6I 3FZVA 3F8BA 4EEFG 1UG0A 4XKCA 2X51A 1XG1A 2MH9A 2DA2A 3Q3SA 1A31A 5B1BH 3KEOA 3RZDJ 4NUBA 1R71A 2HZDA 4AVZA 3CCUI 4IHVA 2Z33A 3CC7I 1IW7F 1Z0XA 2ZC2A 4F7ZA 3JTGA 1DUXC 3UKGA 2NS8A 1EA3A 2BZTA 1IGNA 4RGXA 2A3SA 1G3TA 2ELHA 4PJLA 2W24A 3RZOJ 5DCFA 2DYRH 2OTJI 5F0CA 1E3PA 4LJZF 3OSFA 1J7KA 5LGNA 2DO7A 3ZN1A 3GZ5A 2CQQA 3EYIA 1X3WB 1RUOA 5HS9A 2QWWA 3LNQA 4PFOA 2VT2A 1VNDA 4RAFA 3V7RA 1K4TA 1QNTA 3F9KA 2Z1DA 5HDNA 5H6QA 3A0HC 4H4KC 1OISA 4ON0A 2QENA 3H1CA 4UVAA 2W1OA 4O6JA 4BU2A 3WTXC 2OAZA 3GTPJ 5FLVA 1WCMJ 1H9TA 1YX5A 4G7OF 2XSDC 1FX7A 1RRJA 3K4JA 2ZSIB 4I0BA 4KMUX 4UB8C 4W1UA 5J6XA 2E35A 3ZN0A 3VB2A 2R5YB 3SFZA 5AIQA 4S0HB 3B02A 1GHCA 4L9VA 2X4HA 3PIPF 3KEYA 4F93B 3HJEA 2KIQA 3KYDB 2IS4A 3OL4A 2HZTA 3PM1A 3K1NA 5DTDA 3L2UA 2X6OA 2G7UA 2RKHA 1HXDA 2BHYA 3EETA 5EYRA 5E3MA 3AFHA 5D8LB 3JSOA 4LFUA 2DFFA 3RSNA 3FBNB 1RKTA 2VE8A 2M8GX 2DMUA 3ZMTA 5HLIA 2EB7A 3I9V2 3KETA 4XICA 1F9NA 2Z16A 3SZPA 4AIJA 4NC8A 1NG6A 1ETOA 3DCFA 2YUSA 1ETYA 3K69A 3LSJA 2EZLA 1TL8A 3TKYA 4X6AJ 1FP1D 3WHCA 1T39A 1WI9A 3TBIA 3H3ZA 1N77A 1YYVA 3HIFA 3PUFA 3GFMA 3BZ6A 2MYSA 3MD2A 2F5VA 2A5WA 2P7VB 4KICA 1BA5A 3CQZJ 3CLQA 3FXOA 3HDDA 1APLC 4M6YA 2PJPA 1Y1VJ 3CO7C 1PJRA 2BXYA 4KDPA 5E79C 1NH3A 5IYCJ 2PX9A 1JUSA 4GO1A 1T2KA 2RREA 4K2EA 1IN4A 4HDUA 2HPMA 1TW2A 1ZELA 2EZHA 3CC4I 2KZVA 4ZDLA 4NQWB 2M0CA 2EA2A 5LBQA 2HYJA 4MFEA 2ADUA 1EH8A 2EIKH 2QQ8A 3GTJJ 4A3DJ 3CP8A 3OS1A 1DPRA 3I4MJ 2VJIA 4A3JJ 2PFBA 4NC6A 1SANA 2OZ6A 1QBJA 4CICA 4I01A 3BZCA 3I55I 2IGMA 4XLPF 2RQPA 3LSMA 2F5CA 1FC3A 2O0YA 4A5MA 1DP7P 1G3SA 2JRMA 3H9GA 3V42A 4M6XA 2O3FA 2DXIA 1Z21A 1BJZA 1QZZA 3K2AA 4BXUA 3GX4X 3S15J 3ESWB 4CDGA 1XB4A 2MSYA 2ZSHB 2PG4A 4ZYAA 3CO6C 4A5NA 1VQ5I 1S5LC 1B9NA 4BQAA 3HRUA 3DTEA 2H8WA 4HOBA 1YITI 4FISA 3AAFA 1ACIA 1ZLJA 2DK5A 2P8TA 1PP8F 1I1GA 2LD5A 4FCYA 4RB3C 3OWTA 1K7AA 5CVRA 3FKJA 2FQ4A 3QPHA 1MMDA 1JTXA 3GUDA 5GAEJ 1IDYA 1XSDA 3FXJA 1IF1A 2I8DA 4V2GA 1IV6A 1P7JA 2ZJRF 1T6SA 4I76A 1B59A 4MQ9F 1IAWA 1SVLA 2R7SA 3H3VK 1H8AC 3H9JA 4YIIA 1TT5B 1IXSB 2JWTA 2X6WA 2HU9A 2HQ5A 2IPQX 3KEQA 4CCJA 4N4OB 4CXFA 2JK3A 1I1SA 2ZXHA 4U87A 1WI3A 4NQWA 4Y15A 3W6KB 2IT0A 1IXCA 3J7YJ 1A5JA 1R4NB 1KGSA 1MJAA 4IX7A 2GWRA 2FMYA 2V9KA 4NB5A 2HXIA 3DTIA 1IRZA 5CVVA 1G59A 1X3ZB 2DPUA 2H09A 3HSEA 2VKVA 4RA2A 1FMWA 2IW5A 2BE5F 1PUFB 4BHPA 4G6QA 4Q5SF 3OR1C 5C4XJ 2OV7A 2ECBA 4KISA 3QPLA 4JOMA 4HDVA 2LTPA 2JA5J 3RPUA 3ASOH 3KP6A 2M3AA 4XL9A 3LA3A 2RVCA 3N05A 1ZRCA 2ZJPF 1YS6A 2VE9A 2H27A 3U9GA 3BR1A 2VQGA 3DPTA 1S72I 1O4XA 2M2EA 3ZMSA 3E1SA 4J19A 4MO7A 3MZHA 2JSPA 3Q0UA 5HLGA 2P6SA 3LSPA 3FK6A 3IAS2 1W4MA 1A6IA 5J4VA 1MD0A 3BWGA 1EF4A 4LB5A 1P4XA 3E3VA 4II3A 2L9RA 5JVTA 5E1WA 1IG7A 4A69C 2K4JA 3TW6A 2VBZA 1KONA 4GYGA 2WAQA 4HBLA 3WGGA 2JT1A 2PMUA 1JJ6C 1F5TA 1BR1A 2MBFA 1VZ0A 1YRNA 4HNVA 2HOSA 4XBFA 3JAMZ 2B63J 1VTNC 2CYYA 4PSXA 1P4WA 1OYYA 2GXGA 3BJ6A 3M7GA 2FF4A 4P55A 1QA6A 3EUHA 4B4CA 5K5QA 5EEAA 1ZN2A 3RQ4A 1UCRA 3L9FA 4D7NA 3V8KA 2BYVE 4JBAA 3BZKA 3U2RA 4ZYHA 3HRTA 3HTUA 1X4PA 4U0VA 2Q1ZB 1MBFA 3CMYA 5B5EC 4XLCA 2NNYA 3J7AY 4G7ZF 3CJRB 3AG2H 3HOWJ 3ZQ7A 2XHKA 4I0AA 4F92B 4GFBA 3JRFA 1PUFA 1IN7A 2CWEA 3GMEA 2C6YA 3IRQA 1DGWY 2BBYA 4RMNA 3TP0A 5LFAA 5A2QK 2A61A 3DBLB 5LGUA 3TOAA 2ZCWA 3JTHA 3QP5A 1XMXA 4A6EA 2MLGA 5F1JA 4LK0F 1MSEC 4KJZA 1SD4A 2OU2A 1VQNI 1E17A 2F4OB 3B6AA 1BW6A 1P4AA 4P5OA 2DOAA 2R5ZB 2X85A 2V26A 2HEOA 5CVJA 3SYTA 3KZYA 5GPAA 4EV0A 4EMSA 1O3QA 5D8KB 2XAUA 1S7AA 3H0DA 4LG3A 3COAC 1WSUA 2FU4A 2F5DA 3OYMA 2HVRA 2DU9A 2IEKA 2VOPA 2JPBA 2EIJH 3SEZA 1WKMA 2XUBA 1U5TB 1K4SA 2W00A 3GZNB 3I0TA 4D1QA 3R61A 4NNJA 5FD6A 3LMMA 5CKTA 1LUJB 3I64A 3CCLI 4IHWA 1QVUA 5LHIA 2JVHA 4PCQA 3S1RJ 3WGIA 2AO9A 2M0MA 1YW9A 4EM0B 2GXAA 1OMIA 3M1CA 4RGUA 4BHCA 3OYCA 4AC0A 1ODDA 3WTVC 1ZR2A 1DU6A 1OR7A 4LMYA 2QBYA 3UR3C 1MMAA 2HOEA 4YG2F 4ETSA 2E60A 4R79A 3LOCA 4OWRB 2BY2A 1MMSA 2VC1A 2VKEA 4U88A 3A03A 2F4MB 3RIRA 2ELKA 1LJ9A 2YX4A 1TWGJ 3C2GA 2GBYA 3FMRA 4JX4A 4QIWN 4FX4A 2Q0OA 2EJRA 1JKOC 2NOJB 1KA8A 1TLHB 2DQRA 2WAEA 5AIPA 1KQ8A 4NC7A 1FWZA 4YIRX 2K86A 2IGKA 3F8FA 4ZDPA 2NNNA 2O8XA 2P5KA 4XN0A 4XOPA 3GF2A 2Y30A 4ZJZA 1E3HA 3L7WA 2R5ZA 4HG2A 5DD4A 2LFBA 2MC3A 2ZMEC 4BBSJ 3LQRA 2Y9YA 2LY1A 4MNUA 2CV0A 2ZNZA 4C2MJ 1B1BA 1NTCA 4F55A 1GVJA 2W48A 3LWFA 4MFDA 5FROA 2QEXI 2AS5F 1Z05A 4HAMA 2CV2A 1R7JA 2B7EA 4E7SA 3BQZA 2DN0A 1FZPB 3SEQA 1W36D 2WC2A 1K78A 3BPXA 4A2UA 1TWAJ 3M3YJ 1JKRC 5LD2C 4UV9A 2L9SA 3FMQA 4Q47A 3F0CA 5EF6A 1Z1DA 4AIHA 4D9JA 1WVRA 4ENKA 5J1YA 2R7XA 1U2WA 4X0GA 3K6GA 1HSTA 1GT0C 4GGGA 1I6XA 3MKZA 5J8CA 3DBHB 1UAAA 5LGTA 1USTA 2Y0SA 4HPQA 1H88C 2DDAA 1ERDA 2FMLA 1CF7B 1G2HA 2PMZA 2WV1A 3HHHA 5CQGA 4KFCA 3ROUA 4YEJA 3DTKA 1R1UA 2VODA 3P9KA 4LITA 4G9YA 4C3IJ 3O8HA 1AWCA 3BR6A 3HL2A 2K4BA 2KHMA 3SDGA 4JX5A 3IRRA 1LEAA 4D5CA 2HS5A 1IO2A 2I10A 3ZQIA 4XRSA 3HKZA 1XN7A 4S05A 4A93J 2M87A 2ZO4A 1U8RA 1ITYA 4FX0A 4EJTA 3FMSA 1I39A 4CA0A 3B6CA 2QSFX 2TRTA 1VQOI 1YIJI 1SAXA 2BOLA 2HQNA 1PUEE 2HDCA 4IO9F 3ERED 4A3BJ 2J5OA 2OZUA 3D1NI 1FTZA 2LVSA 1QQIA 5FD5A 1VQ7I 2E7WA 2CQKA 3HUGB 3KZIC 3Q0WA 2KQRA 1R4MB 4KYWA 5E1XA 4MGRA 2R3SA 5M3MJ 1SFKA 4B09A 3ZR8X 4Y52J 5E18F 4DGWB 2WA0A 4EJVA 4G6TB 1WWXA 4D7MA 3L2WA 2LLKA 4DJAA 2XVCA 4C30A 5ILUA 3GO5A 3Q9SA 5FJ8J 3GVAA 3JSPA 1T0FA 4F91B 3ECOA 3WTUC 2V1DA 3F8NA 4N4NB 4I2OA 1EJ9A 2QM3A 4BGDA 4QTRA 1TBXA 4IRHA 4LG0B 3F23A 5IP9J 3PJRA 4RLQA 5LLQA 3M8FA 1EH7A 1XPXA 3G73A 3Q9VA 1JT6A 3G4SI 2R7DA 1K79A 2K5CA 4IVNA 1XX5A 3ZQQA 3M8JA 4EJOA 1SD5A 2PBIA 3KYLA 2DMQA 2WB1N 3E6DA 1X1AA 2HYGD 4AUXA 2FRHA 1G8XA 2L4MA 2W25A 2M30A 4E70A 2XF6A 3PQKA 2JMWA 2KLOA 3BR0A 5CLSA 2F6CA 5H6RA 5TRDA 3DPUA 2XV4S 2XAFA 3FXMA 2CUEA 1UFMA 3DPLC 2XAHA 2P7CB 3A4CA 3HUGA 1I3AA 2MABA 2HFHA 4I99C 3I54A 1VQMI 1R36A 5IT9K 1NHAA 2ELJA 3BG5A 3HPHA 4HX4A 2JTVA 2VBXA 4A3KJ 3OOPA 1UMQA 3HOZJ 1KYWA 1D1AA 4E6KG 1TNTA 5K5RA 2E36A 2UXNA 2VBWA 1KU2A 3LSTA 5KVRA 1T98A 2LC2A 5HLHA 2IVMA 3GBGA 2IGNA 2VQCA 2O6GE 3HTSB 1XDSA 1VFCA 2Y48A 4L5EA 1Z6RA 3MFKA 2QVOA 4V2FA 2DTRA 4M71A 4LG0A 1X1BA 3FHZA 1YS7A 1D0XA 3CCVI 1MSFC 2GLOA 2HDWA 2LBFA 2OBPA 3BROA 2RC4A 4Y7NJ 1BBYA 5A2QZ 2MD5A 1L0OC 1V5GA 2MGQA 1TQPA 4XRFA 2K9MA 2IAIA 3OR2C 1I5ZA 3M1EA 2ZBKA 3BR2A 4FT8A 4KIGA 2E1CA 4CZCA 4P9UA 4ESBA 2XDVA 3BR5A 2DODA 3KP3A 4L0ZB 2JUCA 2KISA 1OLTA 2Z2SB 3EUHC 2JA6J 3TGNA 4HW0A 3E97A 4R1HA 1JJ8C 2Q2EB 3OYBA 3FHNA 3ISPA 2VN2A 3LQQA 3N4MA 1JGGA 4OAZA 1R58A 2COBA 2CJJA 3BG9A 2KKOA 2OC6A 2V7FA 1S7EA 1P6RA 3PUBA 3HOXJ 1A35A 1B4AA 4RS8A 4ENMA 2LY2A 3EDPA 1JI8A 1LE8B 2K7LA 1IN6A 4M9ZA 5HDGA 2KJBA 2L7MP 4ZZLA 1B8IB 1ZTRA 2XPWA 3DKXA 4HV6A 1WZ2A 1HW2A 3X2QH 3TO7A 3LSGA 2ETHA 3TW7A 5B66C 3MVPA 1LB2A 3GTMJ 1QHGA 3PNTA 3CCSI 5DM7F 2DI3A 2LKSA 3WG7H 3K70D 3LSIA 2YS9A 4BXXJ 2H6BA 3BJAA 3S2DJ 3LSKA 1LDDA 3QOPA 3KE2A 1BR2A 1FY7A 2KL4A 3WU0A 1U3EM 4QLCU 1SFXA 5D4SA 1XMAA 3L2VA 1PYVA 2IBDA 2L54A 2V9PA 3S8PA 1K83J 5F0HA 4D0PA 3CDLA 2VONA 3BLYA 4U7DA 2H6CA 3S93A 4A3IJ 3KLOA 3CMEI 3ZP5A 1ZQ3P 1AOYA 1TWCJ 5B1AH 2M5WA 1VQKI 3PSFA 5DUKA 2HPIA 1J09A 2GXBA 5CPRB 1HQCA 2J5PA 2KIMA 5C44J 4YIFA 4ITVA 4OAYA 3IAM2 5HOOA 5ICEA 1R1VA 3CCYA 2L7KA 2GM4A 3PSIA 3VEPA 3I4NJ 2NXNB 1OR7C 5CJ9A 1LFPA 5ERIA 2A07F 3DEEA 5TJJA 2FBIA 5DV5A 3CCMI 5F6FA 1WJCA 2Q2EA 3BR3A 4OU0A 2A68F 4ZDOA 3KP4A 2O03A 2XPUA 4ZYDA 3R6SA 3ZGKA 3QPTA 1TW3A 3PFIA 4XLEA 4KNYA 2DDBA 2QKMB 1BC8C 3K4BA 3A0BC 3S3NA 1FOWA 4IKFA 3ERMA 3KP2A 1MH3A 1NG7A 2K9NA 2P81A 5M5WJ 1LE8A 5JFRA 2GOXB 1HSJA 3CESA 2CUZA 3QOEA 3VSLA 1B8IA 2OCCH 1ETWA 5FLXK 1NK2P 1MGTA 3SFIA 2ZFUA 1I3QJ 4Z2YA 1YI2I 4I02A 2HOTA 2DMNA 2ME0A 5DCMB 3M9AA 1BL0A 5IPAA 2X1EA 3F8MA 2E5ZA 2KZGA 1IRXA 4I09A 1ZHFA 3KYCB 3I58A 1ETQA 4A12A 1W36C 2EILH 2DAOA 1R6RA 3NWTA 3CDHA 2ZB9A 4KITB 2QYOA 4WF2A 1U8BA 1WJ5A 2XPVA 2FOWA 1XTAA 3IL2A 2OA4A 2L3DA 1WFXA 4BE0A 5HNFA 1HCRA 1F36A 1D8JA 4IQJA 4EM2A 1Z9CA 1X1DA 4DYQA 2V1NA 2PI0A 4CCOA 1U5TC 4Y33A 4HA8A 1Y1WJ 2EV6A 2CMPA 2O7OA 4HF0A 1T33A 4P9FA 3MKLA 3J7ZI 3GFIA 1QZEA 1U6GA 3C1DA 3MCZA 1Z7UA 4UVBA 3DXJF 5L3GA 3K4CA 3W6JB 3BT9A 3Q5FA 1MMNA 1MJBA 3H9QA 1YRNB 3HOYJ 1LQ1A 2M34A 1YJNI 2QQAA 4RM3A 3C18A 5D6EA 4PGGA 3ZQGA 1JTYA 2FBHA 4HQMA 1GDTA 1O7LA 2DCEA 2FJ1A 1MBJA 2ZXJA 1FLIA 1R49A 3OYDA 1LVAA 1MBGA 2CW8A 3F6OA 4GRIA 3W2WA 4DZJA 3VSKA 5F64A 2W7NA 2XAJA 4BDYA 1HDPA 3BPVA 2ZFWA 5CQEA 1P7IA 1IN8A 2ECCA 2DA7A 4ZZDA 4UY8I 4LIUA 2KP6A 2OPTA 4M9SA 1WJAA 3U1DA 3W2VA 2K85A 1YQAA 1V5EA 4N9HA 2R93J 3IH3A 4L9NA 3OYFA 2BHZA 3HBLA 2XGEA 3GXOA 2XGDA 5IP7J 2HR3A 2JA2A 5DCMA 1ETXA 3CUQB 5GPCA 4A6DA 5L3BA 1H89C 4MLOA 2W85A 4Y3OA 1WHUA 4AVPA 5AONA 4YELA 5D4RA 5F04A 5JVGF 4UXNA 1U0JA 5EEHA 3R60A 2LRDA 3VODA 3V4GA 1G6NA 4B47A 1IDZA 3L2CA 3QQAA 2AXTC 3S14J 2JQ7A 3CDIA 3EUKL 4B1RA 4A3MJ 2BY0A 1EH6A 3T5XA 4RLFA 3IUOA 4HZFA 5JR3A 2MD0A 3QYEA 2FQ3A 2O8KA 4RB2C 4LLGF 1JHFA 3RPUD 5FKLA 2Y0SN 4PZJA 1Z3XA 2PMZN 3LAPA 4AD9A 5ICGA 1JGSA 2PQ8A 5H20A 4XRSG 3H3UA 1R22A 1RPWA 3PNVA 2EIMH 2XAGA 3WGHA 4AM3A 3BP8A 4HQEA 4PJNA 4BXFA 2WV0A 3SXYA 4PJ0C 5B3SH 1T0FC 4WWCA 3H36A 1MMGA 1ZKGA 1XCBA 2V4JC 3OYKA 3CD6I 2QBYB 3HZJA 3JRAA 4A0XA 3HKZN 1JKPC 2H94A 3F3XA 4O5VA 1T95A 1SD6A 3DEUA 3DF8A 3REOA 3VYRB 4R8HA 3R0JA 5LHGA 5JLWA 2LH9A 1FP2A 2KPMA 1ZG3A 2JA7J 2XB0X 3LA2A 1Y8QB 1YTYA 5IT9Z 1YIOA 4G12A 3IP4B 2NYXA 1ZRDA 2LYCA 3WTYC 1DGRM 3HYIA 1F1ZA 2RNJA 5HNHA 4LD5A 3E7LA 1HOMA 1MKMA 3CLOA 3ZMVA 1MJ9A 1QZYA 5GAGJ 1XD7A 2CUJA 3H92A 2DFHA 3CUQA 2BVLA 1FBSA 2F4IA 1FMVA 4PSWA 4HNTA 1IUYA 4UB6C 3QRFF 5IOZA 4YFXF 2MFZA 4E7HA 4UVCA 3JREA 2X9DA 3ABKH 3ZQLA 1BW5A 2JZYA 3CF2A 3MEXA 1YW7A 2VUMJ 3M4OJ 2NOGA 4Y4RA 1OCPA 4S04A 4BY1J 4LK1F 4DOZA 3I53A 2CFOA 3KPHA 3RTRA 2EZIA 2IGOA 4BQQA 2XC7A 5HODA 3IV5A 2EFNA 2FBKA 4IZZA 1WGXA 4BE2A 3I59A 4DIQA 3DQVC 3QU3A 3F8CA 2HDDA 2R7VA 5BPDA 4L5JA 5GP9A 2PN6A 2ZJ2A 3T0YA 1SFEA 3F72A 5K7FA 1JE8A 5J4YA 4NHJA 1FSHA 1Z67A 2BVMA 4LOCA 4C2TA 1MIJA 1Q1HA 1K78B 4ABZA 1JUMA 1H9GA 2XGCA 3I3LA 2MG4A 5JHUA 1ZREA 1HKQA 1I50J 3V8LA 1X4OA 1D8KA 2R7TA 1OJLA 5K5OA 2HI3A 2M1BA 4CH7A 2PMHA 2FSWA 3VDXA 2CS3A 2L0KA 2NVUB 1X19A 4DQ2A 5LEKA 2RV8A 3FBIB 3WE2A 4CCLA 4M9XA 3WG9A 5F1RA 2DFIA 3E6BA 2LKPA 3CP2A 3R0AA 4C3JJ 4QSHA 5KK1A 2F2EA 1W5TA 4I98B 3E6CC 1FT9A 1RKWA 2XF7A 4A0YA 3GTKJ 3K9TA 4A0ZA 2F5EA 1GV5A 3BG3A 4LGWA 1M1EB 3QAHA 4HYEA 3JRIA 3L1PA 4A3EJ 1UJ8A 2VI6A 1SD7A 2YSRA 2EH3A 1IV8A 1X1PA 2Y9ZA 2AQFA 1BOBA 1BIBA 3LSRA 2X0LA 3P9IA 4BL0B 2ZJQF 4RAGA 4B44A 1O3SA 1MNEA 4XKVA 1SVMA 2K3PA 4JYKA 2NVYJ 3K4NA 1V5FA 2QSGX 1USSA 4HLYA 4XOTA 5EZGA 2O61A 3FXQA 3WHBA 4RB1A 4HNUA 3K70C 1W5SA 1MNMC 3ONQA 3HOSA 3F22A 2D2WA 2GA1A 3PO2J 1HW1A 1RNLA 2CG4A 3IWZA 5DUIA 3SJMA 1Z91A 1K61A 1DPUA 1KZHA 3IH2A 3J81K 2G7HA 3E5XA 2Z5UA 2LMDA 5FKNA 2HGCA 1IC8A 3M8EA 1FTTA 5BOXA 1W1WE 3KIOA 3RKYA 4DNCA 3DBRB 4RAZA 3HSFA 5BPIA 3W6VA 5FFXA 3WU2C 4IOCF 3LSHA 4M3FA 4A3FJ 1TTYA 1HA8A 2GQQA 3H35A 3TMOA 1FJLA 3NQOA 4ZC3A 2O9LA 3QU6A 2E71A 2KIFA 2DMPA 4B8XA 1UG2A 1FSEA 3W2AA 3F21A 4BUPA 4BAYA 2QQ9A 2M9HA 3AG3H 2QF7A 3PFYA 3DKWA 5E20A 4KIBA 3AKZA 2EFWA 3H0GJ 2PJRB 2Q8KA 1S8NA 4GDFA 1LNWA 3HB9A 4IQ4A 4M73A 3OS2A 3FM3A 2LG4A 5CVUA 1JKQC 1J59A 2Y2ZA 3HOUJ 3QYFA 5FLXZ 3VYTB 3CZ6A 3PNYA 3FKIJ 1N75A 3S3MA 3FXKA 3ABUA 4EATA 3FXRA 2RQQA 4YFKF 1N78A 3NAUA 2WWYA 4CHUA 2E1OA 1R23A 4PDKA 3ABLH 3HPGA 4EVIA 4QPQA 3C2HA 1P2FA 1R5ID 3PL8A 2DK8A 1WJEA 2QLZA 3HOVJ 1QU3A 3J7AO 3DWLE 3JR9A 1IZ1A 4EJWA 2XGXA 1BI0A 3JW4A 1ETKA 4BQOA 2HWVA 3JRHA 3TEDA 3M07A 4CSWA 3K2ZA 1KQ9A 1WH5A 1YW8A 3FXUA 2EFOA 2ID6A 4BACA 2CQ7A 2OQRA 5J40A 4ANJA 4MTDA 4PJMA 1VQ8I 2VJ5A 1OFCX 2EFPA 3SQNA 2HTSA 4DBQA 1K6YA 2CU7A 1TWFJ 1OQYA 4ZTFA 1Z6TA 4BEHB 1ZR4A 1J75A 2E2JJ 3RJPA 4OIPF 4A3GJ 4AWXB 3ELKA 4XORA 4XIDA 3G1LA 4BJTA 1QPIA 5KHDA 2LDUA 5E8GA 1B9MA 1QRYA 1S29A 1FNNA 3FDYA 3CCEI 2ZXIA 4M3GA 1UELB 2LK2A 4ZH4F 3OY9A 1NK3P 4L5IA 2HVQA 2PLYA 1HLVA 4Q4ZF 2ESHA 2L01A 1J5YA 3ABTA 1K6OA 1KQ0A 3OMYA 2CW0F 2LNBA 3Q0VA 2L7ZA 1ZG1A 3B73A 1Y39A 2HQRA 2LF8A 2E7XA 2EPFA 4FQGA 4XLNF 4EM1A 3G1OA 3OYNA 4LLNA 2DLLA 2QSHX 2PJRA 3S1QJ 2NS0A 1DQUA 3FX3A 4EQQA 1QGPA 2R92J 4IHXA 1I6HJ 2KT0A 3TDUC 4P96A 4Q48A 3IKVA 5FRMA 4E7KA 3RCOA 2JPCA 1WRJA 2K9QA 2D1VA 2A69F 1J2XA 2LY9A 2QZ8A 4HX8A 4QPOA 2LBFB 1ULYA 2JA8J 3EUAA 4BNCA 4OIRF 4BDZA 5IP6A 2DA4A 4KIFA 3S3OA 2IA0A 3TO6A 1G3YA 3QYBA
chains in the Genus database with same CATH topology
2ZJPF 1VQMI 3CMEI 1YJ9I 1S72I 1VQKI 1HC8A 4UY8I 3I55I 3I56I 3CJTB 1VQOI 1YIJI 1YJWI 2E36A 1MMSA 3PIOF 2E34A 2NXNB 4IO9F 1FOYA 5GADJ 3CCMI 3CCQI 2E35A 1VQ5I 1VQ7I 5JVGF 5GAHJ 3DLLF 1VQ9I 2H8WA 3CCVI 1YITI 3PIPF 1ACIA 2JQ7A 1FOWA 1QA6A 4IOAF 3CCRI 5GAEJ 1YI2I 1YHQI 1VQ8I 4V19K 3G6EI 2ZJRF 3G71I 3CF5F 3CC2I 2QA4I 2K3FA 2ZJQF 2QEXI 2OTLI 3CCJI 3CCEI 2FOWA 1VQ6I 3CD6I 1FOXA 3CMAI 1Y39A 3G4SI 3J7YJ 1VQNI 1VQPI 3CCUI 3J7ZI 3CC7I 3CCSI 5DM7F 1VQLI 1YJNI 5GAGJ 2OTJI 4IOCF 5DM6F 1VQ4I 3CCLI 3CC4I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZJP F;  1VQM I;  3CME I;  1YJ9 I;  1S72 I;  1VQK I;  1HC8 A;  4UY8 I;  3I55 I;  3I56 I;  3CJT B;  1VQO I;  1YIJ I;  1YJW I;  2E36 A;  1MMS A;  3PIO F;  2E34 A;  2NXN B;  4IO9 F;  1FOY A;  5GAD J;  3CCM I;  3CCQ I;  2E35 A;  1VQ5 I;  1VQ7 I;  5JVG F;  5GAH J;  3DLL F;  1VQ9 I;  2H8W A;  3CCV I;  1YIT I;  3PIP F;  1ACI A;  2JQ7 A;  1FOW A;  1QA6 A;  4IOA F;  3CCR I;  5GAE J;  1YI2 I;  1YHQ I;  1VQ8 I;  4V19 K;  3G6E I;  2ZJR F;  3G71 I;  3CF5 F;  3CC2 I;  2QA4 I;  2K3F A;  2ZJQ F;  2QEX I;  2OTL I;  3CCJ I;  3CCE I;  2FOW A;  1VQ6 I;  3CD6 I;  1FOX A;  3CMA I;  1Y39 A;  3G4S I;  3J7Y J;  1VQN I;  1VQP I;  3CCU I;  3J7Z I;  3CC7 I;  3CCS I;  5DM7 F;  1VQL I;  1YJN I;  5GAG J;  2OTJ I;  4IOC F;  5DM6 F;  1VQ4 I;  3CCL I;  3CC4 I; 
#chains in the Genus database with same CATH topology
 5D5W B;  1AHD P;  2KDO A;  1S3J A;  4O3M A;  3BJO A;  2LR8 A;  2FXA A;  2E1N A;  5FB2 A;  1Z77 A;  4NBQ A;  5IYB J;  1XDU A;  2H1L A;  2M7A A;  5TIS C;  1ONV A;  4PJJ A;  1UHM A;  2KJC A;  1BR4 A;  2PEX A;  1DDN A;  3HRS A;  4Y13 A;  3I56 I;  2FOK A;  3N97 A;  4PGH A;  1BIA A;  3EQL F;  4BHB A;  3I71 A;  5EDN A;  2E2H J;  4EGZ A;  1ZRF A;  2E34 A;  1D0Y A;  2BW3 B;  4M3B A;  1MW7 A;  2AQE A;  4OIQ F;  4WX9 A;  2DMT A;  3HXL A;  3MZ8 A;  2A5Y B;  1FOY A;  4BEH A;  1DP3 A;  2UZK A;  1AA7 A;  4ZYG A;  2UV1 A;  4BH9 A;  4HF2 A;  1ZGJ A;  1QHH D;  5FKO A;  4AU7 A;  3DLL F;  3KCC A;  1OYW A;  4IXA A;  2YU9 J;  4XMY A;  4BJ5 C;  3OYA A;  5LEJ A;  2VQL A;  3GCM A;  3SHF A;  5EG0 B;  2LF7 A;  2ZME B;  3LA7 A;  1F4K A;  1Q1V A;  3ZXS A;  2DYS H;  2A6T A;  2L9V A;  3AL0 B;  4IOA F;  4NDL A;  1R5G A;  4CZZ A;  4FET A;  1YHQ I;  2VBY A;  4Y17 A;  3EPZ A;  5K1Y A;  4EJU A;  2MH2 A;  2DFE A;  2FEZ A;  2X48 A;  2EZK A;  3ZCO A;  3T1B A;  2ESN A;  2VIX A;  1DU0 A;  5HDK A;  3L2Q A;  3FK7 A;  3IHU A;  1HW5 A;  5ICF A;  2FUG 2;  1B72 A;  4OMZ A;  2IXS A;  2XAQ A;  2VC0 A;  4JP0 A;  3OYH A;  1MBE A;  5C3E J;  3RKX A;  1FOX A;  2STT A;  2LOO A;  2W57 A;  4XRM A;  2X6Y A;  1D5V A;  4KN7 X;  3NRV A;  1R00 A;  2OCE A;  4CO8 A;  4CUG A;  2F5F A;  2ZNY A;  1RC9 A;  4E7I A;  4BQN A;  1T08 B;  4QWQ A;  1BI2 A;  1D5Y A;  2DW4 A;  1N25 A;  3SDB A;  3JRC A;  4IF4 A;  1TP4 A;  3V7S A;  1GUU A;  2MW8 A;  5D5V B;  2NVQ J;  1VF9 A;  2DOF A;  2H8R A;  4AYB A;  4IPA A;  5JLX A;  3G2B A;  3TOB A;  2OJE D;  4HSR A;  4UUS B;  3HGG A;  2E1M B;  3BY6 A;  4GYI A;  1R1T A;  2BW3 A;  1KU9 A;  3C7J A;  1D0Z A;  2JRT A;  3DP7 A;  4G6D A;  1X1C A;  4IJA A;  5DM6 F;  1PVE A;  5J8F A;  3A02 A;  1UHS A;  1VQ4 I;  3D5R C;  1BN5 A;  4XQF A;  4Z6Y A;  1Y6I A;  2Y0M A;  4XR6 A;  2A6E F;  3DEW A;  3SZG A;  1GXP A;  3HRM A;  1LEB A;  5HVQ C;  3O8G A;  1JUP A;  1SEU A;  3GLX A;  3KP5 A;  5LHH A;  2JJ7 A;  1YJ9 I;  2QKL B;  2GAU A;  3MKW B;  2P6T A;  3CUQ C;  3E6M A;  5E3O A;  2R7F A;  3V8J A;  4ESF A;  5EG0 A;  5BMZ A;  2ZME A;  2JVG A;  1C0W A;  2DT7 B;  3IC7 A;  3T8T A;  3TP3 A;  2WAQ N;  2DA1 A;  4P1W A;  2E2I J;  1ZYR F;  2KRH A;  4TV7 A;  3D5S C;  3HC7 A;  1ZGW A;  2Z9O A;  4G94 A;  2WY7 Q;  4I6Z A;  2HOA A;  1RUN A;  2LSO A;  2XRO A;  1MBH A;  2NS7 A;  3V7C A;  4CCK A;  3DLA A;  2OUM A;  2VQH A;  4XLA A;  2D5V A;  3UNG C;  2HQA A;  2XKO A;  1XC5 A;  2KFD A;  5GAH J;  1XGM A;  2G9W A;  2KIU A;  3VOE A;  1HBX G;  5FLM J;  2NRA C;  3O2P E;  3GZ6 A;  1STZ A;  3IKT A;  2HKX A;  1CQT A;  1GLN A;  3LFK A;  2XIG A;  1HKT A;  5D5U B;  5J47 A;  3BG7 A;  1ON2 A;  3EYY A;  1L3L A;  2ACJ A;  5M5X J;  3S17 J;  5IYD J;  2KRC A;  2KRF A;  2L2O A;  2ISZ A;  3BQY A;  1Z3Y A;  3RI4 A;  1LFU P;  2FA5 A;  3WTZ A;  4JK1 X;  2V6E A;  3ZMU A;  4X1E A;  4RM2 A;  4U7B A;  5GTH C;  4V19 K;  2WBM A;  1OCT C;  4IRI A;  2AXL A;  1KU3 A;  1HDD C;  1G3W A;  2BY3 A;  4A3C J;  3CC2 I;  5KNL A;  2R7R A;  4BJ6 C;  3J81 Z;  4CGZ A;  4RDU A;  4UUS A;  3CMM A;  5J1U A;  2R7U A;  3GYH X;  5E3N A;  2BEO A;  1FEX A;  2L02 A;  2FNA A;  5HS8 A;  1A36 A;  1XCV A;  1TQM A;  2EFQ A;  1SMY F;  2GA2 A;  2L9N A;  4H0E A;  2EBI A;  4C9Y A;  3S2W A;  2R5Y A;  1LPQ A;  4W97 A;  4G7H F;  4XSZ F;  3PO3 J;  1VI0 A;  4FAS D;  4L18 B;  3JRB A;  1W7P B;  2VL8 A;  4DYR A;  2CV1 A;  3MZY A;  4XKB A;  3E0J B;  4MIM A;  1W5C C;  4FE7 A;  4MTE A;  2V79 A;  1KYZ A;  2QCO A;  4HLX A;  4I7H A;  2DJI A;  1BI3 A;  5DDG A;  1U78 A;  4IHS A;  1B6A A;  3QP6 A;  2UWM A;  5CVI A;  1Y56 A;  5ILV A;  5L3F A;  2UUZ A;  2WB1 A;  4BKX A;  4EGY A;  3RKW A;  4HF1 A;  5FFZ A;  4LB6 B;  1WPK A;  2K02 A;  1LDK B;  4WXC A;  4XLF A;  4J01 A;  3OYI A;  1XSX A;  1OCC H;  3RDI A;  1WJD A;  4BY7 J;  2OD5 A;  4KT6 A;  1X58 A;  3NAR A;  4XK4 A;  3O6B B;  1HC8 A;  3FWE A;  3HHG A;  4PUS A;  1G4D A;  2DJN A;  4CCN A;  2QUF A;  5H2F C;  5EGO B;  2N8G A;  4ZYE A;  1BM9 A;  5L3D A;  3K7A J;  2QQB A;  1A6Q A;  1MND A;  2P0W A;  3P7N A;  5L3E A;  1YJW I;  1D3Y A;  5C4J J;  2OF7 A;  4HV5 A;  5IOY A;  1TC3 C;  4JX6 A;  1O3T A;  3GTG J;  1RZ4 A;  3BTJ A;  1OCR H;  3U21 A;  1FBU A;  2E19 A;  4RGR A;  2EWN A;  2M4K A;  2HTJ A;  1BOA A;  2Z99 A;  4E7L A;  2IP2 A;  4E7Z A;  2HKO A;  4AIK A;  2MA3 A;  2YPR A;  2K27 A;  9ANT A;  1OCO H;  2IJL A;  3RYP A;  5K7H A;  5ICC A;  1I27 A;  3R4K A;  3D0S A;  1U9O A;  1RI7 A;  1WH7 A;  2CSO A;  2VAS A;  3L00 A;  1YLF A;  1HKS A;  3OL3 A;  2V6C A;  2A05 A;  2ZKZ A;  4MEY F;  2NVT J;  2RNG A;  1W7P A;  4J00 A;  3G6E I;  2HYF A;  5LRS A;  2RN7 A;  3LL7 A;  3ASN H;  1D1C A;  3LAJ A;  2WAD A;  2COM A;  4IRG A;  2IRF G;  3OV8 A;  1ZLK A;  3S1N J;  2L5Q A;  3I5U A;  3DFG A;  4B3A A;  2QA4 I;  1IJW C;  2K3F A;  4U0Y A;  3C2B A;  3W3C A;  2HVS A;  5GTI C;  1P9Q C;  4N0B A;  4BBR J;  3CCJ I;  3I4P A;  2Y75 A;  2IS2 A;  3CJN A;  4IL6 C;  4LIV A;  4M3D A;  1ZG5 A;  2XF5 A;  3ZOB A;  3I59 B;  1ETV A;  3WTS C;  3CMA I;  4XNF A;  2R7Q A;  3WU1 B;  1O3R A;  4IHT A;  1D1B A;  2LP0 A;  4E7J A;  4U0W A;  1XGN A;  1LVK A;  1W7P D;  3H5R A;  2X6X A;  5DD8 A;  4MHG A;  4KMF A;  1O7F A;  2G0E A;  2JUG A;  3ZRG A;  2IA2 A;  3FF5 A;  1JXS A;  2DA5 A;  2K9L A;  3OYJ A;  3D5L A;  3S16 J;  1R5H A;  2P4W A;  3J80 K;  2F48 A;  5EGO A;  3L2R A;  3OIQ A;  2GOM A;  2IA1 A;  2O5R A;  2X1D A;  1VQL I;  3GTQ J;  1H0M A;  4L0Y B;  1QPM A;  4L9J A;  5BS6 A;  1JHH A;  3BTC A;  2Z3Y A;  3A2K A;  5M3F J;  4C3H J;  2X1C A;  1Y8R B;  5ILS A;  5BQT A;  4JQF A;  1ORK A;  1RET A;  3P9C A;  1BI1 A;  2I5U A;  1LDJ A;  5DS9 A;  5FO5 A;  4ASN A;  4CYC B;  2R7Z J;  1TT0 A;  2ID3 A;  1AU7 A;  4M6V A;  1UHW A;  2H1K A;  5IY5 H;  2XB5 A;  3DV8 A;  3KX2 A;  3K0L A;  3S32 A;  2BGC A;  3RQI A;  2B0L A;  5K7Z A;  4DZP A;  2B9S A;  1OCZ H;  1T8I A;  1ENH A;  2VLA A;  5FRN A;  2DT6 A;  1UB9 A;  4BS9 A;  3PIO F;  1BC7 C;  3GFL A;  4A3L J;  1IRF A;  4M72 A;  4IEJ A;  5F0F A;  4ENN A;  2NVX J;  3VYU B;  2WY8 Q;  3CCQ I;  2CRG A;  1GVD A;  1YE9 A;  3WOD F;  1U9N A;  1ZH5 A;  2HXO A;  1IN5 A;  1YX3 A;  1YOV B;  3VPR A;  4BYY A;  4PK4 A;  3CJQ B;  5EJC A;  1R9T J;  2XSJ C;  4HEA 2;  3MAJ A;  1P92 A;  2CH0 A;  2TCT A;  3HGY A;  2EQR A;  5LRR A;  1OKR A;  4UHT A;  6PAX A;  2VPR A;  1OYI A;  3DU6 A;  2K40 A;  2CQN A;  1T38 A;  5DYM A;  2CQX A;  1OPC A;  3H5N A;  3F6V A;  2DA3 A;  3QWL A;  1AKH B;  2R0Q C;  2GIV A;  4D5F A;  4XKW A;  3G71 I;  3O3K A;  4XSX F;  4WK8 F;  2XRN A;  2VJJ A;  3S2H J;  4XON A;  2DTZ A;  3NEU A;  1QO0 D;  5J3L A;  3DU5 A;  2DOE A;  3ZQH A;  3ZQF A;  4KA4 A;  2MC4 A;  4CYD A;  4OMY A;  1V4R A;  2IS1 A;  4OIO F;  5L3C A;  2Y69 H;  2XKP A;  4AID A;  2BV6 A;  1POG A;  3RKQ A;  3GFJ A;  2VJ4 A;  2JSC A;  1YG2 A;  1S7O A;  4CYC A;  3BTI A;  3HEF A;  1VQP I;  2STW A;  2BY1 A;  1MZB A;  2RAE A;  1W0U A;  3JCU C;  4M74 A;  4II2 A;  1GV2 A;  2VB6 A;  4YRV A;  2M4G A;  2ZXW H;  2HNH A;  1XGS A;  1X2M A;  3GTL J;  1XSV A;  2GIZ A;  2LRE A;  5JI6 A;  1RES A;  1F43 A;  2QGU A;  1V3F A;  4B43 A;  1REP C;  4DYC A;  3BOQ A;  1WQ2 A;  2FE3 A;  2GZW A;  3PQJ A;  1FYK A;  1RR7 A;  1MH4 A;  3OIP A;  4N9I A;  2EA4 A;  1V55 H;  4KT5 C;  5FKM A;  3T8R A;  5D5X B;  3ABM H;  3JRD A;  3KLN A;  3GW2 A;  2RGV A;  2W84 A;  1FIA A;  3GWZ A;  5E3L A;  1ON1 A;  3MMY B;  1HF0 A;  4UUT A;  3NWS A;  3FXL A;  4CCM A;  1IRG A;  2RDP A;  2MLK A;  3U1K A;  5E1Z B;  1MDM B;  2BXZ A;  1ZK8 A;  2CUF A;  3CJT B;  3CUO A;  1FOK A;  5DEQ A;  1ZAR A;  2VKD A;  1RR8 C;  3IWF A;  1Y0N A;  1AKH A;  4XLH A;  5KAF C;  3ZQC A;  3ZMD A;  5GAD J;  2KMU A;  3AL0 C;  3SZT A;  5M5Y J;  2M8E A;  3RPQ A;  1BJA A;  2VKH A;  3KFW X;  3KP7 A;  3TQN A;  3JRG A;  3OSG A;  1GXQ A;  4DBR A;  5E8I A;  3P5J A;  2EV5 A;  4C2U A;  2R7W A;  3MN2 A;  3LFU A;  1U5T A;  3IH4 A;  2DQL A;  3FM5 A;  3WTT C;  2YX7 A;  1Y0U A;  2VT3 A;  3QOD A;  5EEG A;  5HS7 A;  1RIO H;  2L7F P;  3FIS A;  3DKY A;  3BCB A;  2KDZ A;  4BE1 A;  3VYS B;  3ML6 A;  2M45 A;  2LKX A;  3AG1 H;  2IS6 A;  4RAY A;  2CFX A;  2DT5 A;  4AYB N;  3K1M A;  1CGP A;  4MEX F;  1UZC A;  1LKX A;  1TNS A;  2R7O A;  2E5N A;  5F27 A;  1PDN C;  5J1R A;  1X3U A;  3BTL A;  1E2X A;  3MWM A;  5EZH A;  4HX7 A;  3VFZ A;  4RBO A;  2DBB A;  3HOT A;  3CF5 F;  4IHY A;  3GTO J;  3WE3 A;  2P5L C;  3A01 B;  3TO9 A;  2K9S A;  4F3Q A;  2EIN H;  1FPQ A;  3ULQ B;  2VXZ A;  3WTW C;  1XGO A;  4OOI A;  1E0E A;  3K4M A;  4FHT A;  3S1M J;  3BDD A;  3A1Y A;  2ICW G;  1YO5 C;  1S6L A;  3HG9 A;  1KU7 A;  1S9H A;  2W4S A;  3CTA A;  3E5Q A;  2VXD A;  2VPL A;  1JT0 A;  1ZAO A;  3GLL A;  1V54 H;  1TWH J;  4KN4 X;  2E1M C;  1EKE A;  4LLL A;  1SVO A;  2YU3 A;  5HLT A;  2V9V A;  2VOO A;  1Z7L A;  4GCV A;  3MQ0 A;  2JN6 A;  3HSR A;  1FYM A;  2NAZ A;  4E4H A;  1IXR C;  1FYL A;  1XMK A;  1MDM A;  2ME6 A;  2UXX A;  3QPS A;  4XN3 A;  2CGP A;  3ZMZ A;  3E5U A;  2EK5 A;  2V1U A;  1FBQ A;  4L9T A;  5F08 A;  1ZGA A;  3K10 A;  5JHF A;  1SMT A;  2FD5 A;  3OIO A;  4GXO A;  4PFP A;  4OIN F;  3ZPL A;  4UV8 A;  3FIW A;  2XRL A;  5TGT A;  4FE4 A;  1TZL A;  4XM3 A;  1SFO J;  2EV0 A;  4B48 A;  2M7B A;  2WAF A;  1A04 A;  2DA6 A;  2CW7 A;  3KZZ A;  1SAU A;  4MQV A;  2D45 A;  1X2N A;  1SFU A;  5BNG A;  2ISY A;  4F52 A;  1TQI A;  2A6H F;  3BCA A;  3AG4 H;  2WTE A;  4UNO A;  2V1X A;  1SC7 A;  4B3X A;  4YFN F;  1W0T A;  3HM5 A;  4HRI A;  1MBK A;  1B72 B;  4KUM A;  3OYL A;  1J9I A;  4RB0 A;  2Y31 A;  4WXD A;  2CO5 A;  3TDZ C;  3A01 A;  4UUV A;  2TDX A;  5KCM A;  5CYV A;  3K1P A;  5ED4 A;  1EV7 A;  3C3W A;  1VQ9 I;  1CF7 A;  2W82 A;  2AHQ A;  2P5V A;  1J0R A;  3BG6 A;  2YR2 A;  4ENJ A;  1O57 A;  5FGM A;  3OYE A;  4ZTJ A;  3OOU A;  1T56 A;  3MKY B;  4DW6 A;  3ECH A;  1E3O C;  1FIP A;  5E17 F;  3CCR I;  2FX0 A;  3G1M A;  2FNP A;  3OYG A;  4FTH A;  3G3Z A;  4ESJ A;  2OQG A;  2L4A A;  5D6F A;  2DPD A;  3BC8 A;  1WJB A;  1WJF A;  4WXH A;  5FKK A;  3J80 Z;  1XS9 A;  4G8X A;  4RGS A;  1PP7 U;  3K4L A;  2XAS A;  3RYR A;  4M3E A;  3JAM K;  5IT3 A;  3K4K A;  1YFH A;  3TL4 X;  2R4G A;  2OTL I;  5KAI C;  1LFB A;  3L09 A;  1IUF A;  2D1H A;  3H5A A;  4WCG A;  3OS0 A;  3VWB A;  1QVT A;  3GEZ A;  4HST A;  1VQ6 I;  3FZV A;  3F8B A;  4EEF G;  1UG0 A;  4XKC A;  2X51 A;  1XG1 A;  2MH9 A;  2DA2 A;  3Q3S A;  1A31 A;  5B1B H;  3KEO A;  3RZD J;  4NUB A;  1R71 A;  2HZD A;  4AVZ A;  3CCU I;  4IHV A;  2Z33 A;  3CC7 I;  1IW7 F;  1Z0X A;  2ZC2 A;  4F7Z A;  3JTG A;  1DUX C;  3UKG A;  2NS8 A;  1EA3 A;  2BZT A;  1IGN A;  4RGX A;  2A3S A;  1G3T A;  2ELH A;  4PJL A;  2W24 A;  3RZO J;  5DCF A;  2DYR H;  2OTJ I;  5F0C A;  1E3P A;  4LJZ F;  3OSF A;  1J7K A;  5LGN A;  2DO7 A;  3ZN1 A;  3GZ5 A;  2CQQ A;  3EYI A;  1X3W B;  1RUO A;  5HS9 A;  2QWW A;  3LNQ A;  4PFO A;  2VT2 A;  1VND A;  4RAF A;  3V7R A;  1K4T A;  1QNT A;  3F9K A;  2Z1D A;  5HDN A;  5H6Q A;  3A0H C;  4H4K C;  1OIS A;  4ON0 A;  2QEN A;  3H1C A;  4UVA A;  2W1O A;  4O6J A;  4BU2 A;  3WTX C;  2OAZ A;  3GTP J;  5FLV A;  1WCM J;  1H9T A;  1YX5 A;  4G7O F;  2XSD C;  1FX7 A;  1RRJ A;  3K4J A;  2ZSI B;  4I0B A;  4KMU X;  4UB8 C;  4W1U A;  5J6X A;  2E35 A;  3ZN0 A;  3VB2 A;  2R5Y B;  3SFZ A;  5AIQ A;  4S0H B;  3B02 A;  1GHC A;  4L9V A;  2X4H A;  3PIP F;  3KEY A;  4F93 B;  3HJE A;  2KIQ A;  3KYD B;  2IS4 A;  3OL4 A;  2HZT A;  3PM1 A;  3K1N A;  5DTD A;  3L2U A;  2X6O A;  2G7U A;  2RKH A;  1HXD A;  2BHY A;  3EET A;  5EYR A;  5E3M A;  3AFH A;  5D8L B;  3JSO A;  4LFU A;  2DFF A;  3RSN A;  3FBN B;  1RKT A;  2VE8 A;  2M8G X;  2DMU A;  3ZMT A;  5HLI A;  2EB7 A;  3I9V 2;  3KET A;  4XIC A;  1F9N A;  2Z16 A;  3SZP A;  4AIJ A;  4NC8 A;  1NG6 A;  1ETO A;  3DCF A;  2YUS A;  1ETY A;  3K69 A;  3LSJ A;  2EZL A;  1TL8 A;  3TKY A;  4X6A J;  1FP1 D;  3WHC A;  1T39 A;  1WI9 A;  3TBI A;  3H3Z A;  1N77 A;  1YYV A;  3HIF A;  3PUF A;  3GFM A;  3BZ6 A;  2MYS A;  3MD2 A;  2F5V A;  2A5W A;  2P7V B;  4KIC A;  1BA5 A;  3CQZ J;  3CLQ A;  3FXO A;  3HDD A;  1APL C;  4M6Y A;  2PJP A;  1Y1V J;  3CO7 C;  1PJR A;  2BXY A;  4KDP A;  5E79 C;  1NH3 A;  5IYC J;  2PX9 A;  1JUS A;  4GO1 A;  1T2K A;  2RRE A;  4K2E A;  1IN4 A;  4HDU A;  2HPM A;  1TW2 A;  1ZEL A;  2EZH A;  3CC4 I;  2KZV A;  4ZDL A;  4NQW B;  2M0C A;  2EA2 A;  5LBQ A;  2HYJ A;  4MFE A;  2ADU A;  1EH8 A;  2EIK H;  2QQ8 A;  3GTJ J;  4A3D J;  3CP8 A;  3OS1 A;  1DPR A;  3I4M J;  2VJI A;  4A3J J;  2PFB A;  4NC6 A;  1SAN A;  2OZ6 A;  1QBJ A;  4CIC A;  4I01 A;  3BZC A;  3I55 I;  2IGM A;  4XLP F;  2RQP A;  3LSM A;  2F5C A;  1FC3 A;  2O0Y A;  4A5M A;  1DP7 P;  1G3S A;  2JRM A;  3H9G A;  3V42 A;  4M6X A;  2O3F A;  2DXI A;  1Z21 A;  1BJZ A;  1QZZ A;  3K2A A;  4BXU A;  3GX4 X;  3S15 J;  3ESW B;  4CDG A;  1XB4 A;  2MSY A;  2ZSH B;  2PG4 A;  4ZYA A;  3CO6 C;  4A5N A;  1VQ5 I;  1S5L C;  1B9N A;  4BQA A;  3HRU A;  3DTE A;  2H8W A;  4HOB A;  1YIT I;  4FIS A;  3AAF A;  1ACI A;  1ZLJ A;  2DK5 A;  2P8T A;  1PP8 F;  1I1G A;  2LD5 A;  4FCY A;  4RB3 C;  3OWT A;  1K7A A;  5CVR A;  3FKJ A;  2FQ4 A;  3QPH A;  1MMD A;  1JTX A;  3GUD A;  5GAE J;  1IDY A;  1XSD A;  3FXJ A;  1IF1 A;  2I8D A;  4V2G A;  1IV6 A;  1P7J A;  2ZJR F;  1T6S A;  4I76 A;  1B59 A;  4MQ9 F;  1IAW A;  1SVL A;  2R7S A;  3H3V K;  1H8A C;  3H9J A;  4YII A;  1TT5 B;  1IXS B;  2JWT A;  2X6W A;  2HU9 A;  2HQ5 A;  2IPQ X;  3KEQ A;  4CCJ A;  4N4O B;  4CXF A;  2JK3 A;  1I1S A;  2ZXH A;  4U87 A;  1WI3 A;  4NQW A;  4Y15 A;  3W6K B;  2IT0 A;  1IXC A;  3J7Y J;  1A5J A;  1R4N B;  1KGS A;  1MJA A;  4IX7 A;  2GWR A;  2FMY A;  2V9K A;  4NB5 A;  2HXI A;  3DTI A;  1IRZ A;  5CVV A;  1G59 A;  1X3Z B;  2DPU A;  2H09 A;  3HSE A;  2VKV A;  4RA2 A;  1FMW A;  2IW5 A;  2BE5 F;  1PUF B;  4BHP A;  4G6Q A;  4Q5S F;  3OR1 C;  5C4X J;  2OV7 A;  2ECB A;  4KIS A;  3QPL A;  4JOM A;  4HDV A;  2LTP A;  2JA5 J;  3RPU A;  3ASO H;  3KP6 A;  2M3A A;  4XL9 A;  3LA3 A;  2RVC A;  3N05 A;  1ZRC A;  2ZJP F;  1YS6 A;  2VE9 A;  2H27 A;  3U9G A;  3BR1 A;  2VQG A;  3DPT A;  1S72 I;  1O4X A;  2M2E A;  3ZMS A;  3E1S A;  4J19 A;  4MO7 A;  3MZH A;  2JSP A;  3Q0U A;  5HLG A;  2P6S A;  3LSP A;  3FK6 A;  3IAS 2;  1W4M A;  1A6I A;  5J4V A;  1MD0 A;  3BWG A;  1EF4 A;  4LB5 A;  1P4X A;  3E3V A;  4II3 A;  2L9R A;  5JVT A;  5E1W A;  1IG7 A;  4A69 C;  2K4J A;  3TW6 A;  2VBZ A;  1KON A;  4GYG A;  2WAQ A;  4HBL A;  3WGG A;  2JT1 A;  2PMU A;  1JJ6 C;  1F5T A;  1BR1 A;  2MBF A;  1VZ0 A;  1YRN A;  4HNV A;  2HOS A;  4XBF A;  3JAM Z;  2B63 J;  1VTN C;  2CYY A;  4PSX A;  1P4W A;  1OYY A;  2GXG A;  3BJ6 A;  3M7G A;  2FF4 A;  4P55 A;  1QA6 A;  3EUH A;  4B4C A;  5K5Q A;  5EEA A;  1ZN2 A;  3RQ4 A;  1UCR A;  3L9F A;  4D7N A;  3V8K A;  2BYV E;  4JBA A;  3BZK A;  3U2R A;  4ZYH A;  3HRT A;  3HTU A;  1X4P A;  4U0V A;  2Q1Z B;  1MBF A;  3CMY A;  5B5E C;  4XLC A;  2NNY A;  3J7A Y;  4G7Z F;  3CJR B;  3AG2 H;  3HOW J;  3ZQ7 A;  2XHK A;  4I0A A;  4F92 B;  4GFB A;  3JRF A;  1PUF A;  1IN7 A;  2CWE A;  3GME A;  2C6Y A;  3IRQ A;  1DGW Y;  2BBY A;  4RMN A;  3TP0 A;  5LFA A;  5A2Q K;  2A61 A;  3DBL B;  5LGU A;  3TOA A;  2ZCW A;  3JTH A;  3QP5 A;  1XMX A;  4A6E A;  2MLG A;  5F1J A;  4LK0 F;  1MSE C;  4KJZ A;  1SD4 A;  2OU2 A;  1VQN I;  1E17 A;  2F4O B;  3B6A A;  1BW6 A;  1P4A A;  4P5O A;  2DOA A;  2R5Z B;  2X85 A;  2V26 A;  2HEO A;  5CVJ A;  3SYT A;  3KZY A;  5GPA A;  4EV0 A;  4EMS A;  1O3Q A;  5D8K B;  2XAU A;  1S7A A;  3H0D A;  4LG3 A;  3COA C;  1WSU A;  2FU4 A;  2F5D A;  3OYM A;  2HVR A;  2DU9 A;  2IEK A;  2VOP A;  2JPB A;  2EIJ H;  3SEZ A;  1WKM A;  2XUB A;  1U5T B;  1K4S A;  2W00 A;  3GZN B;  3I0T A;  4D1Q A;  3R61 A;  4NNJ A;  5FD6 A;  3LMM A;  5CKT A;  1LUJ B;  3I64 A;  3CCL I;  4IHW A;  1QVU A;  5LHI A;  2JVH A;  4PCQ A;  3S1R J;  3WGI A;  2AO9 A;  2M0M A;  1YW9 A;  4EM0 B;  2GXA A;  1OMI A;  3M1C A;  4RGU A;  4BHC A;  3OYC A;  4AC0 A;  1ODD A;  3WTV C;  1ZR2 A;  1DU6 A;  1OR7 A;  4LMY A;  2QBY A;  3UR3 C;  1MMA A;  2HOE A;  4YG2 F;  4ETS A;  2E60 A;  4R79 A;  3LOC A;  4OWR B;  2BY2 A;  1MMS A;  2VC1 A;  2VKE A;  4U88 A;  3A03 A;  2F4M B;  3RIR A;  2ELK A;  1LJ9 A;  2YX4 A;  1TWG J;  3C2G A;  2GBY A;  3FMR A;  4JX4 A;  4QIW N;  4FX4 A;  2Q0O A;  2EJR A;  1JKO C;  2NOJ B;  1KA8 A;  1TLH B;  2DQR A;  2WAE A;  5AIP A;  1KQ8 A;  4NC7 A;  1FWZ A;  4YIR X;  2K86 A;  2IGK A;  3F8F A;  4ZDP A;  2NNN A;  2O8X A;  2P5K A;  4XN0 A;  4XOP A;  3GF2 A;  2Y30 A;  4ZJZ A;  1E3H A;  3L7W A;  2R5Z A;  4HG2 A;  5DD4 A;  2LFB A;  2MC3 A;  2ZME C;  4BBS J;  3LQR A;  2Y9Y A;  2LY1 A;  4MNU A;  2CV0 A;  2ZNZ A;  4C2M J;  1B1B A;  1NTC A;  4F55 A;  1GVJ A;  2W48 A;  3LWF A;  4MFD A;  5FRO A;  2QEX I;  2AS5 F;  1Z05 A;  4HAM A;  2CV2 A;  1R7J A;  2B7E A;  4E7S A;  3BQZ A;  2DN0 A;  1FZP B;  3SEQ A;  1W36 D;  2WC2 A;  1K78 A;  3BPX A;  4A2U A;  1TWA J;  3M3Y J;  1JKR C;  5LD2 C;  4UV9 A;  2L9S A;  3FMQ A;  4Q47 A;  3F0C A;  5EF6 A;  1Z1D A;  4AIH A;  4D9J A;  1WVR A;  4ENK A;  5J1Y A;  2R7X A;  1U2W A;  4X0G A;  3K6G A;  1HST A;  1GT0 C;  4GGG A;  1I6X A;  3MKZ A;  5J8C A;  3DBH B;  1UAA A;  5LGT A;  1UST A;  2Y0S A;  4HPQ A;  1H88 C;  2DDA A;  1ERD A;  2FML A;  1CF7 B;  1G2H A;  2PMZ A;  2WV1 A;  3HHH A;  5CQG A;  4KFC A;  3ROU A;  4YEJ A;  3DTK A;  1R1U A;  2VOD A;  3P9K A;  4LIT A;  4G9Y A;  4C3I J;  3O8H A;  1AWC A;  3BR6 A;  3HL2 A;  2K4B A;  2KHM A;  3SDG A;  4JX5 A;  3IRR A;  1LEA A;  4D5C A;  2HS5 A;  1IO2 A;  2I10 A;  3ZQI A;  4XRS A;  3HKZ A;  1XN7 A;  4S05 A;  4A93 J;  2M87 A;  2ZO4 A;  1U8R A;  1ITY A;  4FX0 A;  4EJT A;  3FMS A;  1I39 A;  4CA0 A;  3B6C A;  2QSF X;  2TRT A;  1VQO I;  1YIJ I;  1SAX A;  2BOL A;  2HQN A;  1PUE E;  2HDC A;  4IO9 F;  3ERE D;  4A3B J;  2J5O A;  2OZU A;  3D1N I;  1FTZ A;  2LVS A;  1QQI A;  5FD5 A;  1VQ7 I;  2E7W A;  2CQK A;  3HUG B;  3KZI C;  3Q0W A;  2KQR A;  1R4M B;  4KYW A;  5E1X A;  4MGR A;  2R3S A;  5M3M J;  1SFK A;  4B09 A;  3ZR8 X;  4Y52 J;  5E18 F;  4DGW B;  2WA0 A;  4EJV A;  4G6T B;  1WWX A;  4D7M A;  3L2W A;  2LLK A;  4DJA A;  2XVC A;  4C30 A;  5ILU A;  3GO5 A;  3Q9S A;  5FJ8 J;  3GVA A;  3JSP A;  1T0F A;  4F91 B;  3ECO A;  3WTU C;  2V1D A;  3F8N A;  4N4N B;  4I2O A;  1EJ9 A;  2QM3 A;  4BGD A;  4QTR A;  1TBX A;  4IRH A;  4LG0 B;  3F23 A;  5IP9 J;  3PJR A;  4RLQ A;  5LLQ A;  3M8F A;  1EH7 A;  1XPX A;  3G73 A;  3Q9V A;  1JT6 A;  3G4S I;  2R7D A;  1K79 A;  2K5C A;  4IVN A;  1XX5 A;  3ZQQ A;  3M8J A;  4EJO A;  1SD5 A;  2PBI A;  3KYL A;  2DMQ A;  2WB1 N;  3E6D A;  1X1A A;  2HYG D;  4AUX A;  2FRH A;  1G8X A;  2L4M A;  2W25 A;  2M30 A;  4E70 A;  2XF6 A;  3PQK A;  2JMW A;  2KLO A;  3BR0 A;  5CLS A;  2F6C A;  5H6R A;  5TRD A;  3DPU A;  2XV4 S;  2XAF A;  3FXM A;  2CUE A;  1UFM A;  3DPL C;  2XAH A;  2P7C B;  3A4C A;  3HUG A;  1I3A A;  2MAB A;  2HFH A;  4I99 C;  3I54 A;  1VQM I;  1R36 A;  5IT9 K;  1NHA A;  2ELJ A;  3BG5 A;  3HPH A;  4HX4 A;  2JTV A;  2VBX A;  4A3K J;  3OOP A;  1UMQ A;  3HOZ J;  1KYW A;  1D1A A;  4E6K G;  1TNT A;  5K5R A;  2E36 A;  2UXN A;  2VBW A;  1KU2 A;  3LST A;  5KVR A;  1T98 A;  2LC2 A;  5HLH A;  2IVM A;  3GBG A;  2IGN A;  2VQC A;  2O6G E;  3HTS B;  1XDS A;  1VFC A;  2Y48 A;  4L5E A;  1Z6R A;  3MFK A;  2QVO A;  4V2F A;  2DTR A;  4M71 A;  4LG0 A;  1X1B A;  3FHZ A;  1YS7 A;  1D0X A;  3CCV I;  1MSF C;  2GLO A;  2HDW A;  2LBF A;  2OBP A;  3BRO A;  2RC4 A;  4Y7N J;  1BBY A;  5A2Q Z;  2MD5 A;  1L0O C;  1V5G A;  2MGQ A;  1TQP A;  4XRF A;  2K9M A;  2IAI A;  3OR2 C;  1I5Z A;  3M1E A;  2ZBK A;  3BR2 A;  4FT8 A;  4KIG A;  2E1C A;  4CZC A;  4P9U A;  4ESB A;  2XDV A;  3BR5 A;  2DOD A;  3KP3 A;  4L0Z B;  2JUC A;  2KIS A;  1OLT A;  2Z2S B;  3EUH C;  2JA6 J;  3TGN A;  4HW0 A;  3E97 A;  4R1H A;  1JJ8 C;  2Q2E B;  3OYB A;  3FHN A;  3ISP A;  2VN2 A;  3LQQ A;  3N4M A;  1JGG A;  4OAZ A;  1R58 A;  2COB A;  2CJJ A;  3BG9 A;  2KKO A;  2OC6 A;  2V7F A;  1S7E A;  1P6R A;  3PUB A;  3HOX J;  1A35 A;  1B4A A;  4RS8 A;  4ENM A;  2LY2 A;  3EDP A;  1JI8 A;  1LE8 B;  2K7L A;  1IN6 A;  4M9Z A;  5HDG A;  2KJB A;  2L7M P;  4ZZL A;  1B8I B;  1ZTR A;  2XPW A;  3DKX A;  4HV6 A;  1WZ2 A;  1HW2 A;  3X2Q H;  3TO7 A;  3LSG A;  2ETH A;  3TW7 A;  5B66 C;  3MVP A;  1LB2 A;  3GTM J;  1QHG A;  3PNT A;  3CCS I;  5DM7 F;  2DI3 A;  2LKS A;  3WG7 H;  3K70 D;  3LSI A;  2YS9 A;  4BXX J;  2H6B A;  3BJA A;  3S2D J;  3LSK A;  1LDD A;  3QOP A;  3KE2 A;  1BR2 A;  1FY7 A;  2KL4 A;  3WU0 A;  1U3E M;  4QLC U;  1SFX A;  5D4S A;  1XMA A;  3L2V A;  1PYV A;  2IBD A;  2L54 A;  2V9P A;  3S8P A;  1K83 J;  5F0H A;  4D0P A;  3CDL A;  2VON A;  3BLY A;  4U7D A;  2H6C A;  3S93 A;  4A3I J;  3KLO A;  3CME I;  3ZP5 A;  1ZQ3 P;  1AOY A;  1TWC J;  5B1A H;  2M5W A;  1VQK I;  3PSF A;  5DUK A;  2HPI A;  1J09 A;  2GXB A;  5CPR B;  1HQC A;  2J5P A;  2KIM A;  5C44 J;  4YIF A;  4ITV A;  4OAY A;  3IAM 2;  5HOO A;  5ICE A;  1R1V A;  3CCY A;  2L7K A;  2GM4 A;  3PSI A;  3VEP A;  3I4N J;  2NXN B;  1OR7 C;  5CJ9 A;  1LFP A;  5ERI A;  2A07 F;  3DEE A;  5TJJ A;  2FBI A;  5DV5 A;  3CCM I;  5F6F A;  1WJC A;  2Q2E A;  3BR3 A;  4OU0 A;  2A68 F;  4ZDO A;  3KP4 A;  2O03 A;  2XPU A;  4ZYD A;  3R6S A;  3ZGK A;  3QPT A;  1TW3 A;  3PFI A;  4XLE A;  4KNY A;  2DDB A;  2QKM B;  1BC8 C;  3K4B A;  3A0B C;  3S3N A;  1FOW A;  4IKF A;  3ERM A;  3KP2 A;  1MH3 A;  1NG7 A;  2K9N A;  2P81 A;  5M5W J;  1LE8 A;  5JFR A;  2GOX B;  1HSJ A;  3CES A;  2CUZ A;  3QOE A;  3VSL A;  1B8I A;  2OCC H;  1ETW A;  5FLX K;  1NK2 P;  1MGT A;  3SFI A;  2ZFU A;  1I3Q J;  4Z2Y A;  1YI2 I;  4I02 A;  2HOT A;  2DMN A;  2ME0 A;  5DCM B;  3M9A A;  1BL0 A;  5IPA A;  2X1E A;  3F8M A;  2E5Z A;  2KZG A;  1IRX A;  4I09 A;  1ZHF A;  3KYC B;  3I58 A;  1ETQ A;  4A12 A;  1W36 C;  2EIL H;  2DAO A;  1R6R A;  3NWT A;  3CDH A;  2ZB9 A;  4KIT B;  2QYO A;  4WF2 A;  1U8B A;  1WJ5 A;  2XPV A;  2FOW A;  1XTA A;  3IL2 A;  2OA4 A;  2L3D A;  1WFX A;  4BE0 A;  5HNF A;  1HCR A;  1F36 A;  1D8J A;  4IQJ A;  4EM2 A;  1Z9C A;  1X1D A;  4DYQ A;  2V1N A;  2PI0 A;  4CCO A;  1U5T C;  4Y33 A;  4HA8 A;  1Y1W J;  2EV6 A;  2CMP A;  2O7O A;  4HF0 A;  1T33 A;  4P9F A;  3MKL A;  3J7Z I;  3GFI A;  1QZE A;  1U6G A;  3C1D A;  3MCZ A;  1Z7U A;  4UVB A;  3DXJ F;  5L3G A;  3K4C A;  3W6J B;  3BT9 A;  3Q5F A;  1MMN A;  1MJB A;  3H9Q A;  1YRN B;  3HOY J;  1LQ1 A;  2M34 A;  1YJN I;  2QQA A;  4RM3 A;  3C18 A;  5D6E A;  4PGG A;  3ZQG A;  1JTY A;  2FBH A;  4HQM A;  1GDT A;  1O7L A;  2DCE A;  2FJ1 A;  1MBJ A;  2ZXJ A;  1FLI A;  1R49 A;  3OYD A;  1LVA A;  1MBG A;  2CW8 A;  3F6O A;  4GRI A;  3W2W A;  4DZJ A;  3VSK A;  5F64 A;  2W7N A;  2XAJ A;  4BDY A;  1HDP A;  3BPV A;  2ZFW A;  5CQE A;  1P7I A;  1IN8 A;  2ECC A;  2DA7 A;  4ZZD A;  4UY8 I;  4LIU A;  2KP6 A;  2OPT A;  4M9S A;  1WJA A;  3U1D A;  3W2V A;  2K85 A;  1YQA A;  1V5E A;  4N9H A;  2R93 J;  3IH3 A;  4L9N A;  3OYF A;  2BHZ A;  3HBL A;  2XGE A;  3GXO A;  2XGD A;  5IP7 J;  2HR3 A;  2JA2 A;  5DCM A;  1ETX A;  3CUQ B;  5GPC A;  4A6D A;  5L3B A;  1H89 C;  4MLO A;  2W85 A;  4Y3O A;  1WHU A;  4AVP A;  5AON A;  4YEL A;  5D4R A;  5F04 A;  5JVG F;  4UXN A;  1U0J A;  5EEH A;  3R60 A;  2LRD A;  3VOD A;  3V4G A;  1G6N A;  4B47 A;  1IDZ A;  3L2C A;  3QQA A;  2AXT C;  3S14 J;  2JQ7 A;  3CDI A;  3EUK L;  4B1R A;  4A3M J;  2BY0 A;  1EH6 A;  3T5X A;  4RLF A;  3IUO A;  4HZF A;  5JR3 A;  2MD0 A;  3QYE A;  2FQ3 A;  2O8K A;  4RB2 C;  4LLG F;  1JHF A;  3RPU D;  5FKL A;  2Y0S N;  4PZJ A;  1Z3X A;  2PMZ N;  3LAP A;  4AD9 A;  5ICG A;  1JGS A;  2PQ8 A;  5H20 A;  4XRS G;  3H3U A;  1R22 A;  1RPW A;  3PNV A;  2EIM H;  2XAG A;  3WGH A;  4AM3 A;  3BP8 A;  4HQE A;  4PJN A;  4BXF A;  2WV0 A;  3SXY A;  4PJ0 C;  5B3S H;  1T0F C;  4WWC A;  3H36 A;  1MMG A;  1ZKG A;  1XCB A;  2V4J C;  3OYK A;  3CD6 I;  2QBY B;  3HZJ A;  3JRA A;  4A0X A;  3HKZ N;  1JKP C;  2H94 A;  3F3X A;  4O5V A;  1T95 A;  1SD6 A;  3DEU A;  3DF8 A;  3REO A;  3VYR B;  4R8H A;  3R0J A;  5LHG A;  5JLW A;  2LH9 A;  1FP2 A;  2KPM A;  1ZG3 A;  2JA7 J;  2XB0 X;  3LA2 A;  1Y8Q B;  1YTY A;  5IT9 Z;  1YIO A;  4G12 A;  3IP4 B;  2NYX A;  1ZRD A;  2LYC A;  3WTY C;  1DGR M;  3HYI A;  1F1Z A;  2RNJ A;  5HNH A;  4LD5 A;  3E7L A;  1HOM A;  1MKM A;  3CLO A;  3ZMV A;  1MJ9 A;  1QZY A;  5GAG J;  1XD7 A;  2CUJ A;  3H92 A;  2DFH A;  3CUQ A;  2BVL A;  1FBS A;  2F4I A;  1FMV A;  4PSW A;  4HNT A;  1IUY A;  4UB6 C;  3QRF F;  5IOZ A;  4YFX F;  2MFZ A;  4E7H A;  4UVC A;  3JRE A;  2X9D A;  3ABK H;  3ZQL A;  1BW5 A;  2JZY A;  3CF2 A;  3MEX A;  1YW7 A;  2VUM J;  3M4O J;  2NOG A;  4Y4R A;  1OCP A;  4S04 A;  4BY1 J;  4LK1 F;  4DOZ A;  3I53 A;  2CFO A;  3KPH A;  3RTR A;  2EZI A;  2IGO A;  4BQQ A;  2XC7 A;  5HOD A;  3IV5 A;  2EFN A;  2FBK A;  4IZZ A;  1WGX A;  4BE2 A;  3I59 A;  4DIQ A;  3DQV C;  3QU3 A;  3F8C A;  2HDD A;  2R7V A;  5BPD A;  4L5J A;  5GP9 A;  2PN6 A;  2ZJ2 A;  3T0Y A;  1SFE A;  3F72 A;  5K7F A;  1JE8 A;  5J4Y A;  4NHJ A;  1FSH A;  1Z67 A;  2BVM A;  4LOC A;  4C2T A;  1MIJ A;  1Q1H A;  1K78 B;  4ABZ A;  1JUM A;  1H9G A;  2XGC A;  3I3L A;  2MG4 A;  5JHU A;  1ZRE A;  1HKQ A;  1I50 J;  3V8L A;  1X4O A;  1D8K A;  2R7T A;  1OJL A;  5K5O A;  2HI3 A;  2M1B A;  4CH7 A;  2PMH A;  2FSW A;  3VDX A;  2CS3 A;  2L0K A;  2NVU B;  1X19 A;  4DQ2 A;  5LEK A;  2RV8 A;  3FBI B;  3WE2 A;  4CCL A;  4M9X A;  3WG9 A;  5F1R A;  2DFI A;  3E6B A;  2LKP A;  3CP2 A;  3R0A A;  4C3J J;  4QSH A;  5KK1 A;  2F2E A;  1W5T A;  4I98 B;  3E6C C;  1FT9 A;  1RKW A;  2XF7 A;  4A0Y A;  3GTK J;  3K9T A;  4A0Z A;  2F5E A;  1GV5 A;  3BG3 A;  4LGW A;  1M1E B;  3QAH A;  4HYE A;  3JRI A;  3L1P A;  4A3E J;  1UJ8 A;  2VI6 A;  1SD7 A;  2YSR A;  2EH3 A;  1IV8 A;  1X1P A;  2Y9Z A;  2AQF A;  1BOB A;  1BIB A;  3LSR A;  2X0L A;  3P9I A;  4BL0 B;  2ZJQ F;  4RAG A;  4B44 A;  1O3S A;  1MNE A;  4XKV A;  1SVM A;  2K3P A;  4JYK A;  2NVY J;  3K4N A;  1V5F A;  2QSG X;  1USS A;  4HLY A;  4XOT A;  5EZG A;  2O61 A;  3FXQ A;  3WHB A;  4RB1 A;  4HNU A;  3K70 C;  1W5S A;  1MNM C;  3ONQ A;  3HOS A;  3F22 A;  2D2W A;  2GA1 A;  3PO2 J;  1HW1 A;  1RNL A;  2CG4 A;  3IWZ A;  5DUI A;  3SJM A;  1Z91 A;  1K61 A;  1DPU A;  1KZH A;  3IH2 A;  3J81 K;  2G7H A;  3E5X A;  2Z5U A;  2LMD A;  5FKN A;  2HGC A;  1IC8 A;  3M8E A;  1FTT A;  5BOX A;  1W1W E;  3KIO A;  3RKY A;  4DNC A;  3DBR B;  4RAZ A;  3HSF A;  5BPI A;  3W6V A;  5FFX A;  3WU2 C;  4IOC F;  3LSH A;  4M3F A;  4A3F J;  1TTY A;  1HA8 A;  2GQQ A;  3H35 A;  3TMO A;  1FJL A;  3NQO A;  4ZC3 A;  2O9L A;  3QU6 A;  2E71 A;  2KIF A;  2DMP A;  4B8X A;  1UG2 A;  1FSE A;  3W2A A;  3F21 A;  4BUP A;  4BAY A;  2QQ9 A;  2M9H A;  3AG3 H;  2QF7 A;  3PFY A;  3DKW A;  5E20 A;  4KIB A;  3AKZ A;  2EFW A;  3H0G J;  2PJR B;  2Q8K A;  1S8N A;  4GDF A;  1LNW A;  3HB9 A;  4IQ4 A;  4M73 A;  3OS2 A;  3FM3 A;  2LG4 A;  5CVU A;  1JKQ C;  1J59 A;  2Y2Z A;  3HOU J;  3QYF A;  5FLX Z;  3VYT B;  3CZ6 A;  3PNY A;  3FKI J;  1N75 A;  3S3M A;  3FXK A;  3ABU A;  4EAT A;  3FXR A;  2RQQ A;  4YFK F;  1N78 A;  3NAU A;  2WWY A;  4CHU A;  2E1O A;  1R23 A;  4PDK A;  3ABL H;  3HPG A;  4EVI A;  4QPQ A;  3C2H A;  1P2F A;  1R5I D;  3PL8 A;  2DK8 A;  1WJE A;  2QLZ A;  3HOV J;  1QU3 A;  3J7A O;  3DWL E;  3JR9 A;  1IZ1 A;  4EJW A;  2XGX A;  1BI0 A;  3JW4 A;  1ETK A;  4BQO A;  2HWV A;  3JRH A;  3TED A;  3M07 A;  4CSW A;  3K2Z A;  1KQ9 A;  1WH5 A;  1YW8 A;  3FXU A;  2EFO A;  2ID6 A;  4BAC A;  2CQ7 A;  2OQR A;  5J40 A;  4ANJ A;  4MTD A;  4PJM A;  1VQ8 I;  2VJ5 A;  1OFC X;  2EFP A;  3SQN A;  2HTS A;  4DBQ A;  1K6Y A;  2CU7 A;  1TWF J;  1OQY A;  4ZTF A;  1Z6T A;  4BEH B;  1ZR4 A;  1J75 A;  2E2J J;  3RJP A;  4OIP F;  4A3G J;  4AWX B;  3ELK A;  4XOR A;  4XID A;  3G1L A;  4BJT A;  1QPI A;  5KHD A;  2LDU A;  5E8G A;  1B9M A;  1QRY A;  1S29 A;  1FNN A;  3FDY A;  3CCE I;  2ZXI A;  4M3G A;  1UEL B;  2LK2 A;  4ZH4 F;  3OY9 A;  1NK3 P;  4L5I A;  2HVQ A;  2PLY A;  1HLV A;  4Q4Z F;  2ESH A;  2L01 A;  1J5Y A;  3ABT A;  1K6O A;  1KQ0 A;  3OMY A;  2CW0 F;  2LNB A;  3Q0V A;  2L7Z A;  1ZG1 A;  3B73 A;  1Y39 A;  2HQR A;  2LF8 A;  2E7X A;  2EPF A;  4FQG A;  4XLN F;  4EM1 A;  3G1O A;  3OYN A;  4LLN A;  2DLL A;  2QSH X;  2PJR A;  3S1Q J;  2NS0 A;  1DQU A;  3FX3 A;  4EQQ A;  1QGP A;  2R92 J;  4IHX A;  1I6H J;  2KT0 A;  3TDU C;  4P96 A;  4Q48 A;  3IKV A;  5FRM A;  4E7K A;  3RCO A;  2JPC A;  1WRJ A;  2K9Q A;  2D1V A;  2A69 F;  1J2X A;  2LY9 A;  2QZ8 A;  4HX8 A;  4QPO A;  2LBF B;  1ULY A;  2JA8 J;  3EUA A;  4BNC A;  4OIR F;  4BDZ A;  5IP6 A;  2DA4 A;  4KIF A;  3S3O A;  2IA0 A;  3TO6 A;  1G3Y A;  3QYB A; 
#chains in the Genus database with same CATH homology
 2ZJP F;  1VQM I;  3CME I;  1YJ9 I;  1S72 I;  1VQK I;  1HC8 A;  4UY8 I;  3I55 I;  3I56 I;  3CJT B;  1VQO I;  1YIJ I;  1YJW I;  2E36 A;  1MMS A;  3PIO F;  2E34 A;  2NXN B;  4IO9 F;  1FOY A;  5GAD J;  3CCM I;  3CCQ I;  2E35 A;  1VQ5 I;  1VQ7 I;  5JVG F;  5GAH J;  3DLL F;  1VQ9 I;  2H8W A;  3CCV I;  1YIT I;  3PIP F;  1ACI A;  2JQ7 A;  1FOW A;  1QA6 A;  4IOA F;  3CCR I;  5GAE J;  1YI2 I;  1YHQ I;  1VQ8 I;  4V19 K;  3G6E I;  2ZJR F;  3G71 I;  3CF5 F;  3CC2 I;  2QA4 I;  2K3F A;  2ZJQ F;  2QEX I;  2OTL I;  3CCJ I;  3CCE I;  2FOW A;  1VQ6 I;  3CD6 I;  1FOX A;  3CMA I;  1Y39 A;  3G4S I;  3J7Y J;  1VQN I;  1VQP I;  3CCU I;  3J7Z I;  3CC7 I;  3CCS I;  5DM7 F;  1VQL I;  1YJN I;  5GAG J;  2OTJ I;  4IOC F;  5DM6 F;  1VQ4 I;  3CCL I;  3CC4 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...