3CCMQ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3ccmQ00
3CCUQ 1VQOQ 1Q82R 3CMAQ 1Q81R 1K8AR 1VQ6Q 1VQ4Q 1VQ8Q 1VQKQ 3CPWP 3CCEQ 1K73R 1Q86R 3CC4Q 1S72Q 1YHQQ 1NJIR 2QA4Q 3CCQQ 1JJ2P 2OTLQ 2OTJQ 3G4SQ 1KD1R 3CCVQ 1YJ9Q 1VQMQ 1W2BP 1KQSP 1QVGP 1Q7YR 3I56Q 1QVFP 1VQ7Q 3G71Q 3CCMQ 1N8RR 1K9MR 3CCSQ 3CCLQ 1VQNQ 3OW2P 1YITQ 1KC8R 3CXCP 1YI2Q 1YJWQ 1M90R 2QEXQ 1VQPQ 3CD6Q 1VQ5Q 1M1KR 3I55Q 3CMEQ 1YIJQ 1VQ9Q 3CC7Q 3CCRQ 3CCJQ 3G6EQ 1YJNQ 1VQLQ 3CC2Q
chains in the Genus database with same CATH superfamily
1K9MC 1R0CB 2RHXA 4PFZA 1HYOA 4ELYC 4PFPA 4VUBA 3THKA 4A54A 3OS2A 4PL6A 1TG0A 3UF4A 4L5GA 3C95A 1Q7YR 3HFNA 3PVLA 1TOVA 5GMKi 3CXCS 3PMIA 1ARKA 3CCSA 1KQSA 2XI9A 1ACMB 4J7FA 3I55Q 1SF9A 2RHUA 2H8HA 3QDRB 2AHJB 1XOVA 2CS7A 2K2VA 2F1LA 4M78F 2GGRA 2L3RA 3OYKA 4M7AE 3M0RA 3M53A 4ELZC 5GAMh 1BI3A 5J26A 2KY9A 3GBQA 1WX6A 4QW2A 1QVFS 5HK3A 3DLMA 3G4SA 1FXXA 1YJWT 3M57A 1ZSZC 1Q81U 3CCJT 2KT8A 1CKBA 2L3SA 3EG9A 1OX8A 1ZUUA 4A63B 4KRTA 4M75G 3RDVA 3V8LA 1NBEB 4MZTA 3H0HA 2C0OA 4HKEA 1RAAB 1G8XA 1YJ9Q 4JUVA 2MCNA 2CYZB 3VS3A 2HMAA 4M75D 2X3WD 2YXYA 3CCRT 4LDUA 4CC3A 2DKGA 5GAOn 2V1QA 1BBZA 2NUPB 2E10A 5GANj 3JSCA 1SEMA 4A4EA 1N27A 4J9HA 2P4TA 2OTJA 1YCSB 3LH0A 2L8DA 1TUDA 1C6VX 1PKTA 4HT8A 4PJOB 2VC8A 2XHCA 3HSBA 1YNZA 2CT3A 2QGGA 2LT4A 1KD1C 1OYXA 4M77G 2JW4A 5CR2A 1Q7YU 3L2UA 3GP8A 5A0DA 1M1KC 2COZA 5CQYA 4WCIA 4Z02A 3OB9A 3SD4A 2JM8A 2J6KA 4FSSA 1C0MA 3G71A 5GAMd 3EG3A 1QP2A 1UGVA 1TSFA 1VQKT 1VQLQ 2CGHA 2C0IA 1XTDA 2YHTA 3ULRB 3GIBA 1WA7A 4A4HA 2HCKA 3UPUA 1MNEA 1JJ2P 3UA6A 1M3CA 1I5LA 2B8AA 1QCNA 2VB6A 3CCLQ 1GFCA 4XAXB 2LC4A 1AWWA 1Q86C 5CKFA 4QKUA 1RAHB 2D0QB 5LJ3j 2BUDA 1OULA 2NUPA 2EKOA 2K79A 3QXEB 5AT1B 4M7DF 2DNUA 1IO6A 1YBYA 1OOTA 3HFOA 4HVUA 1WLPB 4Z88A 1VQMT 1H3ZA 5KYXB 3X25B 2OTLQ 2A7YA 3BDLA 3FJPA 4PJOA 3EGDB 4LE9A 4RTTA 3VUBA 5GAN4 2JNGA 2LZ6B 1NPRA 1WHJA 1M3BA 4FYWB 1BI0A 4KULA 1QP3A 4F7UB 2RA2A 3CCQT 4C92C 1ZSGA 4UC4A 1XQHA 2RPNA 3AHUA 3QG1A 3C12A 2DXCA 4XTVA 1VYUA 1WHHA 2QDYB 5DLQE 2A28A 1E6HA 2LCSA 2COYA 4JLIA 2DBKA 4LUEA 4F7UF 1VQ8T 2ZGWA 3M5AA 1R0BG 2PVGB 2XICA 4B9WA 2KK4A 2KRMA 2O31A 3SEMA 2IPOB 4KH0B 4O6JA 1IHVA 4JS5A 1WQWA 3GNFB 3ZL7C 3INZA 2RD1A 5L8RE 1FYNA 2M16A 4EDUA 1VQ5Q 1NJIC 4L6V5 1YIJQ 2DL5A 4LD6A 5KYUB 1K73U 1FMVA 2MWOA 3OS0A 2VASA 4R56A 1RL2A 2A36A 3G7ZA 5KE3A 2EW3A 3F70A 3REBB 5KYXA 1BYMA 5GAOl 5LJ5h 1VQNT 5KCHA 2D0NA 1JJ2A 2NYSA 3OW2P 1PM3A 1N9RA 4QVZA 2ATCB 2OJ2A 1VQ4T 1T3SA 3O8VA 2KT1A 4F7UA 1X2KA 5GAOq 3RKXA 4RCBA 2JT4A 4DOWA 4PK4A 4C0DB 3JCMf 1P92A 1TXQA 2K2MA 1NE8A 2KMTA 1YI2T 4AG1C 2EYYA 2K3YA 3QJYA 4BUGA 2X4JA 2KXCA 3CEYA 2OAUA 3I55A 1BKBA 4C8QC 2GTOA 3CPWP 5FROA 1IRXA 3M55A 3DB4A 1N9SA 3V8KA 5IXBA 1SRLA 2EYXA 3V7SA 3HRUA 1JRIA 1UJYA 5FLXE 1QVGP 1RI9A 1XNIA 2L2PA 3RERA 4J7IA 4KGZB 4M75F 2E6ZA 4M7AB 3P8DA 5IH2A 1KSWA 5FWCA 5KYUA 1QMCA 5GMKh 4BD3A 4M78E 1UB4A 2HNIA 3VS1A 3TCJA 1B3QA 5M9OA 2BTTA 1Q82R 1N8RC 2PUKB 5AYFA 1YCYA 3JCMb 2CP6A 2HDAA 4OMMA 2DEUA 2O88A 1RADB 4GLKA 2W0ZA 3UT1A 1NLOC 1YJ9A 1QVFP 4DEXA 1YITQ 3H9NA 2GF7A 3VS5A 4Z8AA 4BE2A 5LJ5d 2BZYA 4F04B 2LX7A 4D8DA 1YHQT 1WHLA 1UHFA 4PKCC 4L59A 4AT1B 1D3BB 1TS9A 4DBRA 2CH4A 4Y91A 1I8FA 3BY7A 2ESWA 2JVVA 1TUGB 4ZGDB 4OP0A 2HKQB 2WSCE 2DYBA 1AWOA 1RAFB 4MZMA 4BE1A 4CC2A 1M1FA 2OTJQ 2QA4Q 2EFIA 3JAME 2MF2A 1IXDA 1WI7A 2Y4XA 5GANe 4M7AA 2LJ3A 2DX1A 2DJZA 3SWNC 3PFSA 2RK1A 3OYIA 3JB9D 2RF0A 4N4HA 4EMGA 4A53A 3M54A 1VQLA 4M77C 3FC3A 2MK5A 1G3TA 2C0TA 1U8RA 1PWTA 3QKJA 2JTFA 5IHNA 2ZPGB 1YJWQ 3CCLA 1V1CA 2JXBA 3MEVA 1W6XA 4HA8A 2VYTA 3HTRA 3G6EA 2DZCA 1BB9A 4JS4A 2DD5A 1XJWB 5I11A 4C92E 2OTLA 1D3BA 4PJOD 1BIBA 2O2OA 4EIKA 1K9MR 4BDYA 5GANf 3H8ZA 2P0PA 2GQVA 1U5SA 2LVMA 3JCMP 4M7DE 3RUXA 2CH4W 2FYKA 3CCRQ 2HZYA 3H0FA 2A3LA 2K5FA 1VQOQ 5GAN7 3FIFA 2RN8A 5IAYA 2CP7A 2K5LA 3QHSA 4JLGA 3RMSA 1VIFA 1U1SA 1W2BS 5LJ3e 5C0MA 4JRPA 3A8GB 1DJ7B 2L3QA 3A1PA 3OBWA 2YRDA 1VQ7A 1KJWA 5A0LA 4BY6C 4JJDA 1YJNT 3C94A 1ABOA 4JDSA 4R55A 4HCCA 1Y96B 2GBQA 3CC2A 2EGEA 2VGMA 2YWWA 2SRCA 1M3AA 4GBQA 3BE3A 2X3XD 4LNPA 3OA6A 2JZ2A 3ER0A 1U06A 3PIOA 1ABQA 1V76A 2O01E 1FWZA 4XTZA 2LRQA 1JBMA 1CSKA 4E2FB 1JXMA 4J9EA 2ENMA 2DETA 1YIJA 2DILA 5DY9A 1GCQC 2DYIA 3LGFA 4CC4B 1VQKQ 1UFFA 4O5VA 3EHQA 4OMQA 3EFOB 3P8HA 1X01A 1JEGA 2V8KA 2M9UA 4F7UG 3CCMT 5LJ3f 3CD6T 3P8BB 4KT0E 2X35A 2DFUA 5DM7R 4LDYA 3QBYA 4XU1A 4CI0C 2R58A 4OB0B 2RQWA 2ZCFB 4X1VA 2LQKA 1TU0B 3CCET 4C0ZA 3NHNA 4FT2A 2AKLA 2HAXA 3G4ST 1K9MU 2QQ9A 4C8QE 4V2SA 3GOXA 2EKHA 2IG0A 1KD1R 1VQMQ 3L2ZA 3OS5A 1MGQA 3BFMA 3A8HB 2QEXA 1UE9A 1M1KR 1Y96A 1B7TA 4FSXA 3E1SA 3VS0A 2EGAA 2JOYA 5CO7A 1ZSZB 3JCMg 1VA7A 4A4FA 1K4US 2KDSA 4PJNA 4C5IA 1N5ZA 1X6GA 1OU9A 1WQ7A 2HBPA 2J6OA 5GAMj 2K57A 5LL6S 1HD3A 3CMAT 2VWFA 3KUFA 1X6BA 1GCPA 4PJMA 2NLUA 4J6YA 3MP8A 2CUDA 1VQ8Q 4D6WA 1W4SA 1WNLA 4HCZA 4AFUC 1Q86R 2GNCA 4AMCA 4M75E 3DKMA 1RAGB 1GXIE 4PJJA 1I07A 1WIEA 1UGRB 1D1BA 2JJ9A 3SFMA 2RH2A 4J9FA 1VQ9T 3J7AF 1M2VB 1YITA 3PVQA 3L42A 2DXTA 1QLYA 8AT1B 4MZPA 4DBFA 3KXTA 2E65A 1KIKA 1B34B 2EWNA 3MCAB 3LYIA 3Q1JA 3L2VA 3UA7A 4N0AA 4C0FA 2E3HA 3G1JA 3TSWA 2PZ1A 1NEGA 1PD1A 1G83A 2M02A 4M78C 3S3OA 2E5QA 2HBWA 3E9GA 4LDWA 3JB9F 1IREB 5FU6C 4XTXA 3L2RA 3CCUQ 3EFRA 1KD1U 2H3JA 3FRNA 5KE2A 4HCKA 2CZ6B 2LMJA 3OYAA 4M77E 2RJCA 2D8JA 2QA4A 2ZZDA 4M7AD 2PU9B 3NTIA 1OEBA 4ESRA 5L23A 5IN1A 1Q81C 3EH1A 3CBOA 3VV0A 4Q5WA 1YI2Q 1VQPQ 3WVEB 2DVEA 1HXDA 1FX7A 1W70A 4NL3A 1VQ6T 5GJVB 2DVJA 3RMQA 3CQTA 5I22A 9ATCB 1QKWA 1NJIR 4PJOF 1B07A 1NPPA 4J9CA 1GRIA 1Z9QA 5FU7C 2RJFA 1M2VA 2X51A 1BCMA 1YJWA 3E19A 1IHWA 1RI0A 1Q86U 4HVVA 1M4ZA 2CUBA 1PRMC 4J6WA 4ZGJB 1G3YA 2CSIA 1B34A 2LX9A 3MJXA 3HRSA 4XK8E 3X28B 2EQUA 2E3IA 3L1AA 2MWPA 4R0KA 4XU3A 1D1CA 2ABLA 3QZ9B 3SHWA 4C92B 4MMLA 3EG2A 3RKYA 4LDVA 2OX7A 5GAOp 3G6EQ 3TQ7P 3CCRA 5D6WA 2BE7D 2R57A 2FVUA 1VQOA 1LCKA 5A0GA 3JCMX 3X24B 4BB7A 3TSZA 2DRKA 1TTHB 1YHQQ 2Z0WA 4JJNK 2F2WA 5KYNA 3I56Q 2KAFA 2F2XA 3D7SB 5GANg 2K9GA 1E6GA 2RI2A 5CKDA 3CMEQ 2FPEA 1YP5A 2QK0A 2FPDA 4NL2A 3VRZA 1SRMA 4K11A 4AFZC 2O9VA 5FRMA 1QCOA 2EJ9A 1KQSS 2O4XB 2JTMA 4C5HA 1VQ7Q 3VS6A 4DA4A 1N8RR 2EQKA 3OMGA 3MEAA 3UATA 4M7DC 4LXCA 2QQAA 2CDTA 1NJIU 1O9SA 1OI1A 3KFVA 4JJCA 3CC2Q 3M4YA 3QWYA 2RQUA 3OYFA 1ZQ1A 3VYGA 3CC4T 1VQKA 3M0TA 2JTEA 2EQJA 1X2QA 4FM4B 4YTLA 3V8JA 2DLPA 2M0OA 3A8MB 4ORZA 1X69A 4PFOA 2RI5A 1WXUA 1RUWA 2RQVA 2DEQA 3I55T 2DXBA 4J6XA 1LPLA 2EIFA 5LJ5j 2LQNA 1V29B 3I35A 4HVWA 4RTVA 1ZBJA 2YUOA 3EAEA 3EG1A 3CCVQ 5HCKA 1M2OA 1RAIB 3EGDA 4B6MA 5LJ3g 1VQMA 1QWEA 3KBGA 3OYCA 1MHNA 4C8QB 1PNJA 3OSSC 2ROLA 1GL5A 3CC7Q 5HK0A 4JPBW 4OB2B 1S72T 1KC8C 4DBHA 1YJ9T 4RTWA 1W1FA 2O4XA 5KYYB 2JN0A 3CCQA 2X4WA 4C5GA 1AWXA 4FYVB 2G6FX 2Y4YA 5CKEA 2B86A 2QEXQ 2C06A 4RKUE 3JB9I 5KH6A 2DTHA 1WPYA 1YJNQ 1MMNA 1U1TA 1WXBA 2GTJA 3JCMQ 4FW1A 3L2QA 2EBPA 3A8LB 1VQ8A 2D9TA 5GMKj 2MIOA 2QYZA 1OPKA 3CBPA 1SHGA 3LLRA 3J81E 4LD9K 2KSSA 2RHIA 5I21A 1D0XA 2O9SA 7AT1B 1I0CA 2DZ9A 2LCCA 1ZLMA 3CXCP 2YRCA 2XDBA 2P4RA 4E7LA 1GBQA 1I4K1 2GFAA 3FB9A 1K76A 2JM9A 3LWHA 4DOVA 1TUCA 1SKUB 5GAMe 1J3TA 2YUQA 1M8MA 3OYEA 1TWBA 1H8KA 1MMGA 3EGXB 1SSHA 2COWA 2CSQA 4M7AF 4RMOA 1M8VA 2QASA 3CCMQ 3A8OB 4C0DC 1VQNA 2CP2A 2MPXC 3CD6Q 2FG0A 2D6FA 1IZ6A 3M0QA 5GAN2 3C4SA 4XQ3A 3PTAA 2EJGA 1UG1A 3CCUA 4EMKB 1IGQA 4M75C 5CKBA 5KYYA 2DPPB 4ANJA 3SWNB 3JCMJ 2DTOA 3CCLT 1A0NB 2QTVA 5IT9E 2I2LA 4RTZA 1HJDA 4M77B 1WHMA 4BDZA 1YI2A 1VQPA 3HP9A 4RG8A 2DL3A 3NGPA 1D09B 3OW2A 4E7ZA 3SDZA 4QVDA 3LH5A 1M90C 1C1AA 2M1HA 1JQQA 1KG1A 5CIUA 2M0YA 1KHIA 3OYNA 5GAMf 4HCBA 4MMKA 1IB8A 2NUZA 3JB9G 1EZZB 3OYLA 3JCMc 2F5KA 2PNIA 4E7SA 2JMCA 5GAOm 2P84A 2NUTB 3S6WA 2DTIA 3UDCA 2QQBA 1KFZA 2F69A 2ED0A 1OZ3A 1CKAA 4IIMA 2L0AA 4AFQC 2FHDA 2KBTA 3L2WA 4RTYA 4PJOE 2DIQA 4EMHA 3EGXA 3VKIA 1NG2A 2XIDA 4FYXB 3RNJA 2PVDB 4B9XA 3CPWA 1AOJA 1WHKA 5D7UA 1UTIA 1PG5B 4ZTJA 2RM4A 1Q82U 1QVGA 1UHCA 2CP3A 2EAYA 1UGPB 4PJOG 3CCJQ 3M0UA 4EMKA 2EYZA 2D8HA 1G2BA 2EVRA 2EQMA 1JJ2S 4BY6B 4E47A 2F2VA 2HKNA 1YHQA 2CREA 1NM7A 4JZ4A 2NWMA 5IHKA 3I56A 2MYSA 2V26A 1VQ5T 1BI1A 2DD4A 2XG8D 3DLLA 1NEBA 2E64A 1QVFA 2ECZA 2M51A 3CMEA 2KNBB 5FW9A 2ZPEB 4CRIA 5CVIA 4PNOA 3AT1B 3ZBDA 1MUZA 5HKCA 2MMPA 1Z9ZA 1GFDA 2J7IA 3ME9A 4PJLA 3M0PA 2EYQA 3CPFA 2NUTA 2E6NA 1VYTA 5EG2A 4J9DA 4J9GA 1FMKA 2JMAA 3FLGA 3OYDA 2DF6A 2QQRA 3N5BB 1VQ6Q 2V1RA 3MEWA 1MNDA 2YRVA 1TH7A 2ZPFB 3SB2A 2KXDA 1R77A 2LT1A 2KR3A 1AZEA 3ASKA 1KQSP 4XTUA 4C92D 3TU4K 5FRNA 1WGSA 3EG0A 4J9IA 1RACB 4F7UE 2HQEA 4J9BA 1SG5A 2FRYA 2VVKA 1UJ0A 4RG2A 4E6RA 2CT4A 2KVQG 4ZGEB 6AT1B 3REAB 4II1A 5GAOr 2R5MA 1I5OB 4DBQA 1AD5A 3H0IA 3JCMh 1VUBA 3LW5E 1T3LA 1WZOA 2E1HA 3RIRA 3CCST 3CCVA 5D6XA 4IUTA 2QI2A 3O5ZA 2MAMA 3FDRA 4Z89A 2K7AA 4IUQA 3OMCA 2ZPHB 3HHTB 3M58A 2BE9B 1LNXA 1LOJA 3CC7A 1K1ZA 1Q81R 1VIEA 1ZX6A 3OYJA 4F14A 5LJ5e 4ZTFA 2HL3A 2VXEA 4IIOA 3VJPA 3OW2S 4IUUA 2QTXA 4LDXA 3NFCA 3QYHB 1Y57A 2EJFA 1BI2A 4AG2C 2KE9A 1ZUKA 4OF1A 1YJNA 2DERA 4MDWA 4HXJA 2LP5A 2WACA 8ATCB 3M0SA 3CCQQ 1QKXA 4Y28E 2P0QA 4JZ3A 1F1BB 4BACA 1PSEA 1JO8A 3OQ5A 2RJDA 1OX9A 3GF5A 2XMFA 3CPWS 1H92A 2QGFB 2DA9A 2OTJT 2QA4T 3FEOA 3EFOA 2YUNA 1UECA 3CC4Q 3IQLA 4M78B 1QVGS 4WF2A 5LJ5f 5D6YA 4C8QD 5FU6B 1K8AC 2JUFA 3LGLA 4Y92A 1RAEB 3JCMd 4ZN3A 2K5IA 2K3XA 2RI3A 3CCMA 2J05A 2BKDN 4DQ2A 1AT1B 5GMKe 3CD6A 2KQWA 1WHGA 2YDLA 4N0AC 1RLQC 2DXUA 2CP5A 2FPFA 2K6DA 4QQ6A 5GJWB 3CCEA 1WYXA 2BZXA 1Y7XA 4OB3B 1X27A 3G71T 4MDXA 5C6SA 2YUPA 2BIVA 3OYHA 2WSEE 1KK7A 1EX4A 1VQNQ 1JXOA 1KHCA 1OPLA 2XK0A 4OMFB 1ZHIA 2DL7A 4QQDA 4M7AG 2MOXA 3RBBB 3QUIA 2LQWA 5FU7B 1VQ4Q 1AZGB 1K0XA 1RLPC 2JS0A 1ZSZA 2A08A 1S72Q 1NZ9A 2ZPIB 2VKNA 3X20B 3GLXA 3ZEHA 3JCMW 2GFUA 1M1KU 4NOYA 1Y71A 2DE0X 4PLIA 2PQWA 2FEIA 3OSVA 3QIIA 2ZPBB 1VQOT 2DO3A 2QDLA 3META 1WFWA 5J3BA 3I9QA 4JRQA 2LQ8A 2RB6A 3CMAA 4M78A 1OU8A 2KEAA 5GAMg 4J8OA 2QXFA 4M4ZA 5KCOA 5GANh 2HEQA 2H3EB 1YWOA 4J5YA 3GNGA 1BU1A 2D1XA 1VQ9A 4XTWA 2SEMA 3T9NA 3PGGA 2RMOA 3MPUB 2E70A 3CCJA 4ATOA 1MV0B 2JS2A 2OI3A 2R5AA 3OYMA 2J06A 3MHXA 2KYBA 4M77D 4OMOA 1KC8R 3PIPA 4KGVB 3VUZA 4QVCA 1YN8A 2X4XA 2ED1A 1Q95G 2P0KA 5GAN5 1Q7YC 1T0HA 3QSUA 4PJOC 1PSFA 1M9SA 1K73R 4M7DB 3M59A 3E9FA 3HRTA 3MKDA 1EIFA 3OYBA 4C92F 2CZ7B 1ZA2B 3R6NA 2HSPA 1LVKA 3QWXX 1PKSA 1SHFA 1VQ6A 2WSFE 3V7RA 2PTKA 2XU8A 2A0FB 4IURA 5FWBA 2AIRB 2LNHB 3OYYA 5LJ3h 1W2BP 5HY6A 5I2MA 2XDPA 4KH1B 3A5ZB 2LJ0A 4QQGA 5GANd 1QQJA 4N4GA 2E4HA 1N6AA 1UDLA 1PD0A 3DB3A 2DL8A 2KYMA 2OAWA 1OV3A 1BCOA 3JCMV 2A37A 2VV5A 2LCLA 3EH2A 2GCXA 2E12A 3VS4A 4C92A 5KYWB 4FIBA 2FZCB 2VUBA 3OS1A 1NYGA 3JCMe 2X9HA 2XDDA 3WVDB 2DK3A 4M7DA 1KQ2A 4IKFA 3X26B 1X43A 1Y07A 3BDUA 3M9QA 1KC8U 2FB7A 2F5TX 3HPWA 1WJQA 1BK2A 1M1GA 2PVOB 2L5QA 1OZ2A 1LJOA 1M90R 4A4KA 5ECAA 1D0YA 1ZBXA 3OYGA 2HSEB 2YT6A 3EFSA 1KQ1A 2HL5C 2RQRA 3CBMA 2FL7A 4BI4A 1MMAA 1T0JA 3RKWA 4C8QF 5EC7A 3PT9A 1AVZC 1ZUYA 2FRWA 4RUGA 4E7JA 2AZVA 1K73C 2V8JA 5LJ3d 3CCUT 2LJ1A 4FYYB 1I81A 1RABB 4KBMB 1K9AA 2YLCA 3QPHA 2AT1B 1QCFA 1N8RU 2E5KA 3MP1A 3CC4A 1WJRA 4TVRA 2EPDA 5J39A 1GBRA 2KGTA 1VQPT 1UUEA 1WXTA 1W2BA 5KYWA 3A98A 4JRIA 4LUDA 3OBYA 2DBMA 4M75B 3VYHB 2E41A 3JRZA 2GQIA 2AK5A 2CP0A 2KRSA 4FU6A 1G3WA 3E2UA 1SSFA 2DM1A 1HK9A 3I5SA 4KUDK 1PRLC 1I1JA 3LWIA 1WJSA 5LJ5g 4ZN1A 4BI8B 4C8QA 2MI6A 3CCSQ 3VS7A 3ZFJA 5DLOA 1Y0MA 4WTOB 5CCAA 1SPKA 2CKKA 2DRMA 4E7IA 2Y90A 1VQLT 2K3BA 4HT9A 3EHRA 3S3NA 1VQ4A 4C5EA 3CCEQ 1M90U 1X75C 1S72A 1D1AA 2FZGB 1HSQA 3PE0A 4N4IA 3G4SQ 2KRNA 2DL4A 5GMKl 4ME7A 4M78G 4OGCA 4PLLA 5CAIA 3G6ET 1OQKA 3UWNA 5IHIA 4FW2A 1AHJB 4M7AC 4M78D 4XTYA 5IXFA 4E7HA 2OTLT 2IIMA 1JU5C 3I56T 4KGXB 1VOMA 4M77F 1G5VA 5I2SA 4KUIA 2IVWA 2VGNA 3CMET 1UGQB 1AEYA 1WDXA 1NLPC 4M75A 4BI3A 3H6ZA 4A4GA 3NMZC 4X34A 4JJBA 4OMNA 4EPCA 5A2QE 3VRYA 3CMAQ 4X9DA 2HQHA 2DAQA 1ZA1B 3U23A 4E7KA 3PMTA 1PC0A 5CQXA 1VQ7T 1NYFA 2RQTA 2G3RA 1AWJA 2CZ1B 4EMKC 3WXMB 3OY9A 1YWPA 3FJ5A 3V7CA 1E7OA 3HKSA 2V8IA 3I5RA 3CC2T 1EFNA 1VQ9Q 2L89A 3C0CA 3M56A 1G3SA 3CXCA 1D0ZA 3M4GA 4IUVA 2ZAEA 4AFSC 4OGEA 4FT4A 2EYWA 3SWNA 1PCXA 4RTUA 3MO8A 3QDFA 4GY5A 4OMPA 3TREA 3G71Q 4M77A 2FZKB 1YIJT 1X6OA 2LNVA 1VYVA 4CC7A 2QAZA 2AZSA 2XKOC 2RJEA 4J83A 5GAN6 4IUPA 3VU3C 1QWFA 2J6FA 3CCVT 4DEYA 1QW1A 4ZNXA 4OMLA 2RK2A 4JRKA 1MV3A 1Q82C 1JB0E 4RCCA 1O75A 2K4YA 2VXFA 3CC7T 1MMDA 2YSQA 3QJ6A 3JV3A 2AKKA 1K8AR 4C92G 3PNWC 4BE0A 2RO0A 1BIAA 2I0NA 2RNAA 2KROA 2HD0A 4OB1B 2QEXT 4F17A 4M7DG 5CK9A 5GMKm 3MP6A 3HL8A 3J80E 4D8KA 3TEEA 4RTXA 2W10A 2EGCA 1QVPA 2FO0A 3RESA 4M7DD 1FMWA 2LDMA 3LX7A 2ROTA 4FCYA 2HQXA 2DJQA 5CKHA 4FL6A 1M30A 3JB9J 3QZ5B 1H3HA 3S3MA 3NTKA 1UEBA 2DIGA 3GPLA 1PHTA 1VQ5A 3NPFA 1M27C 1UGSB 4P5NA 2X4YA 4LN2A 1K0SA 2BZ8A 2PUOB 2CZ0B 4OVAA 3TVTA 1YITT 1GCQA 2LTOA 2RHZA 4C0GA 3NTHA 4GLMA 1H641 1R8OB 2QG9B 4XU0A 2RHYA 3EG9B 3VS2A 4X9CA 2YLBA 3R6OA 3RR6A 5GAN3 3BW1A 4XU2A 3QYGB 3EGUA 2DMOA 2QQSA 1S1NA 4NS5A 4F16A 2KI7A 3URGA 3JB9H 1U3OA 2EQIA 2XD0A 1K8AU 1M5Q1 3H41A 2L3PA 5GAN8 4QT7A 3QO3A 4C8QG 1YFNA 3MEUA 1IGUA
chains in the Genus database with same CATH topology
3CCUQ 1VQOQ 1Q82R 3CMAQ 1Q81R 1K8AR 1VQ6Q 1VQ4Q 1VQ8Q 1VQKQ 3CPWP 3CCEQ 1K73R 1Q86R 3CC4Q 1S72Q 1YHQQ 1NJIR 2QA4Q 3CCQQ 1JJ2P 2OTLQ 2OTJQ 3G4SQ 1KD1R 3CCVQ 1YJ9Q 1VQMQ 1W2BP 1KQSP 1QVGP 1Q7YR 3I56Q 1QVFP 1VQ7Q 3G71Q 3CCMQ 1N8RR 1K9MR 3CCSQ 3CCLQ 1VQNQ 3OW2P 1YITQ 1KC8R 3CXCP 1YI2Q 1YJWQ 1M90R 2QEXQ 1VQPQ 3CD6Q 1VQ5Q 1M1KR 3I55Q 3CMEQ 1YIJQ 1VQ9Q 3CC7Q 3CCRQ 3CCJQ 3G6EQ 1YJNQ 1VQLQ 3CC2Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU Q;  1VQO Q;  1Q82 R;  3CMA Q;  1Q81 R;  1K8A R;  1VQ6 Q;  1VQ4 Q;  1VQ8 Q;  1VQK Q;  3CPW P;  3CCE Q;  1K73 R;  1Q86 R;  3CC4 Q;  1S72 Q;  1YHQ Q;  1NJI R;  2QA4 Q;  3CCQ Q;  1JJ2 P;  2OTL Q;  2OTJ Q;  3G4S Q;  1KD1 R;  3CCV Q;  1YJ9 Q;  1VQM Q;  1W2B P;  1KQS P;  1QVG P;  1Q7Y R;  3I56 Q;  1QVF P;  1VQ7 Q;  3G71 Q;  3CCM Q;  1N8R R;  1K9M R;  3CCS Q;  3CCL Q;  1VQN Q;  3OW2 P;  1YIT Q;  1KC8 R;  3CXC P;  1YI2 Q;  1YJW Q;  1M90 R;  2QEX Q;  1VQP Q;  3CD6 Q;  1VQ5 Q;  1M1K R;  3I55 Q;  3CME Q;  1YIJ Q;  1VQ9 Q;  3CC7 Q;  3CCR Q;  3CCJ Q;  3G6E Q;  1YJN Q;  1VQL Q;  3CC2 Q; 
#chains in the Genus database with same CATH topology
 1K9M C;  1R0C B;  2RHX A;  4PFZ A;  1HYO A;  4ELY C;  4PFP A;  4VUB A;  3THK A;  4A54 A;  3OS2 A;  4PL6 A;  1TG0 A;  3UF4 A;  4L5G A;  3C95 A;  1Q7Y R;  3HFN A;  3PVL A;  1TOV A;  5GMK i;  3CXC S;  3PMI A;  1ARK A;  3CCS A;  1KQS A;  2XI9 A;  1ACM B;  4J7F A;  3I55 Q;  1SF9 A;  2RHU A;  2H8H A;  3QDR B;  2AHJ B;  1XOV A;  2CS7 A;  2K2V A;  2F1L A;  4M78 F;  2GGR A;  2L3R A;  3OYK A;  4M7A E;  3M0R A;  3M53 A;  4ELZ C;  5GAM h;  1BI3 A;  5J26 A;  2KY9 A;  3GBQ A;  1WX6 A;  4QW2 A;  1QVF S;  5HK3 A;  3DLM A;  3G4S A;  1FXX A;  1YJW T;  3M57 A;  1ZSZ C;  1Q81 U;  3CCJ T;  2KT8 A;  1CKB A;  2L3S A;  3EG9 A;  1OX8 A;  1ZUU A;  4A63 B;  4KRT A;  4M75 G;  3RDV A;  3V8L A;  1NBE B;  4MZT A;  3H0H A;  2C0O A;  4HKE A;  1RAA B;  1G8X A;  1YJ9 Q;  4JUV A;  2MCN A;  2CYZ B;  3VS3 A;  2HMA A;  4M75 D;  2X3W D;  2YXY A;  3CCR T;  4LDU A;  4CC3 A;  2DKG A;  5GAO n;  2V1Q A;  1BBZ A;  2NUP B;  2E10 A;  5GAN j;  3JSC A;  1SEM A;  4A4E A;  1N27 A;  4J9H A;  2P4T A;  2OTJ A;  1YCS B;  3LH0 A;  2L8D A;  1TUD A;  1C6V X;  1PKT A;  4HT8 A;  4PJO B;  2VC8 A;  2XHC A;  3HSB A;  1YNZ A;  2CT3 A;  2QGG A;  2LT4 A;  1KD1 C;  1OYX A;  4M77 G;  2JW4 A;  5CR2 A;  1Q7Y U;  3L2U A;  3GP8 A;  5A0D A;  1M1K C;  2COZ A;  5CQY A;  4WCI A;  4Z02 A;  3OB9 A;  3SD4 A;  2JM8 A;  2J6K A;  4FSS A;  1C0M A;  3G71 A;  5GAM d;  3EG3 A;  1QP2 A;  1UGV A;  1TSF A;  1VQK T;  1VQL Q;  2CGH A;  2C0I A;  1XTD A;  2YHT A;  3ULR B;  3GIB A;  1WA7 A;  4A4H A;  2HCK A;  3UPU A;  1MNE A;  1JJ2 P;  3UA6 A;  1M3C A;  1I5L A;  2B8A A;  1QCN A;  2VB6 A;  3CCL Q;  1GFC A;  4XAX B;  2LC4 A;  1AWW A;  1Q86 C;  5CKF A;  4QKU A;  1RAH B;  2D0Q B;  5LJ3 j;  2BUD A;  1OUL A;  2NUP A;  2EKO A;  2K79 A;  3QXE B;  5AT1 B;  4M7D F;  2DNU A;  1IO6 A;  1YBY A;  1OOT A;  3HFO A;  4HVU A;  1WLP B;  4Z88 A;  1VQM T;  1H3Z A;  5KYX B;  3X25 B;  2OTL Q;  2A7Y A;  3BDL A;  3FJP A;  4PJO A;  3EGD B;  4LE9 A;  4RTT A;  3VUB A;  5GAN 4;  2JNG A;  2LZ6 B;  1NPR A;  1WHJ A;  1M3B A;  4FYW B;  1BI0 A;  4KUL A;  1QP3 A;  4F7U B;  2RA2 A;  3CCQ T;  4C92 C;  1ZSG A;  4UC4 A;  1XQH A;  2RPN A;  3AHU A;  3QG1 A;  3C12 A;  2DXC A;  4XTV A;  1VYU A;  1WHH A;  2QDY B;  5DLQ E;  2A28 A;  1E6H A;  2LCS A;  2COY A;  4JLI A;  2DBK A;  4LUE A;  4F7U F;  1VQ8 T;  2ZGW A;  3M5A A;  1R0B G;  2PVG B;  2XIC A;  4B9W A;  2KK4 A;  2KRM A;  2O31 A;  3SEM A;  2IPO B;  4KH0 B;  4O6J A;  1IHV A;  4JS5 A;  1WQW A;  3GNF B;  3ZL7 C;  3INZ A;  2RD1 A;  5L8R E;  1FYN A;  2M16 A;  4EDU A;  1VQ5 Q;  1NJI C;  4L6V 5;  1YIJ Q;  2DL5 A;  4LD6 A;  5KYU B;  1K73 U;  1FMV A;  2MWO A;  3OS0 A;  2VAS A;  4R56 A;  1RL2 A;  2A36 A;  3G7Z A;  5KE3 A;  2EW3 A;  3F70 A;  3REB B;  5KYX A;  1BYM A;  5GAO l;  5LJ5 h;  1VQN T;  5KCH A;  2D0N A;  1JJ2 A;  2NYS A;  3OW2 P;  1PM3 A;  1N9R A;  4QVZ A;  2ATC B;  2OJ2 A;  1VQ4 T;  1T3S A;  3O8V A;  2KT1 A;  4F7U A;  1X2K A;  5GAO q;  3RKX A;  4RCB A;  2JT4 A;  4DOW A;  4PK4 A;  4C0D B;  3JCM f;  1P92 A;  1TXQ A;  2K2M A;  1NE8 A;  2KMT A;  1YI2 T;  4AG1 C;  2EYY A;  2K3Y A;  3QJY A;  4BUG A;  2X4J A;  2KXC A;  3CEY A;  2OAU A;  3I55 A;  1BKB A;  4C8Q C;  2GTO A;  3CPW P;  5FRO A;  1IRX A;  3M55 A;  3DB4 A;  1N9S A;  3V8K A;  5IXB A;  1SRL A;  2EYX A;  3V7S A;  3HRU A;  1JRI A;  1UJY A;  5FLX E;  1QVG P;  1RI9 A;  1XNI A;  2L2P A;  3RER A;  4J7I A;  4KGZ B;  4M75 F;  2E6Z A;  4M7A B;  3P8D A;  5IH2 A;  1KSW A;  5FWC A;  5KYU A;  1QMC A;  5GMK h;  4BD3 A;  4M78 E;  1UB4 A;  2HNI A;  3VS1 A;  3TCJ A;  1B3Q A;  5M9O A;  2BTT A;  1Q82 R;  1N8R C;  2PUK B;  5AYF A;  1YCY A;  3JCM b;  2CP6 A;  2HDA A;  4OMM A;  2DEU A;  2O88 A;  1RAD B;  4GLK A;  2W0Z A;  3UT1 A;  1NLO C;  1YJ9 A;  1QVF P;  4DEX A;  1YIT Q;  3H9N A;  2GF7 A;  3VS5 A;  4Z8A A;  4BE2 A;  5LJ5 d;  2BZY A;  4F04 B;  2LX7 A;  4D8D A;  1YHQ T;  1WHL A;  1UHF A;  4PKC C;  4L59 A;  4AT1 B;  1D3B B;  1TS9 A;  4DBR A;  2CH4 A;  4Y91 A;  1I8F A;  3BY7 A;  2ESW A;  2JVV A;  1TUG B;  4ZGD B;  4OP0 A;  2HKQ B;  2WSC E;  2DYB A;  1AWO A;  1RAF B;  4MZM A;  4BE1 A;  4CC2 A;  1M1F A;  2OTJ Q;  2QA4 Q;  2EFI A;  3JAM E;  2MF2 A;  1IXD A;  1WI7 A;  2Y4X A;  5GAN e;  4M7A A;  2LJ3 A;  2DX1 A;  2DJZ A;  3SWN C;  3PFS A;  2RK1 A;  3OYI A;  3JB9 D;  2RF0 A;  4N4H A;  4EMG A;  4A53 A;  3M54 A;  1VQL A;  4M77 C;  3FC3 A;  2MK5 A;  1G3T A;  2C0T A;  1U8R A;  1PWT A;  3QKJ A;  2JTF A;  5IHN A;  2ZPG B;  1YJW Q;  3CCL A;  1V1C A;  2JXB A;  3MEV A;  1W6X A;  4HA8 A;  2VYT A;  3HTR A;  3G6E A;  2DZC A;  1BB9 A;  4JS4 A;  2DD5 A;  1XJW B;  5I11 A;  4C92 E;  2OTL A;  1D3B A;  4PJO D;  1BIB A;  2O2O A;  4EIK A;  1K9M R;  4BDY A;  5GAN f;  3H8Z A;  2P0P A;  2GQV A;  1U5S A;  2LVM A;  3JCM P;  4M7D E;  3RUX A;  2CH4 W;  2FYK A;  3CCR Q;  2HZY A;  3H0F A;  2A3L A;  2K5F A;  1VQO Q;  5GAN 7;  3FIF A;  2RN8 A;  5IAY A;  2CP7 A;  2K5L A;  3QHS A;  4JLG A;  3RMS A;  1VIF A;  1U1S A;  1W2B S;  5LJ3 e;  5C0M A;  4JRP A;  3A8G B;  1DJ7 B;  2L3Q A;  3A1P A;  3OBW A;  2YRD A;  1VQ7 A;  1KJW A;  5A0L A;  4BY6 C;  4JJD A;  1YJN T;  3C94 A;  1ABO A;  4JDS A;  4R55 A;  4HCC A;  1Y96 B;  2GBQ A;  3CC2 A;  2EGE A;  2VGM A;  2YWW A;  2SRC A;  1M3A A;  4GBQ A;  3BE3 A;  2X3X D;  4LNP A;  3OA6 A;  2JZ2 A;  3ER0 A;  1U06 A;  3PIO A;  1ABQ A;  1V76 A;  2O01 E;  1FWZ A;  4XTZ A;  2LRQ A;  1JBM A;  1CSK A;  4E2F B;  1JXM A;  4J9E A;  2ENM A;  2DET A;  1YIJ A;  2DIL A;  5DY9 A;  1GCQ C;  2DYI A;  3LGF A;  4CC4 B;  1VQK Q;  1UFF A;  4O5V A;  3EHQ A;  4OMQ A;  3EFO B;  3P8H A;  1X01 A;  1JEG A;  2V8K A;  2M9U A;  4F7U G;  3CCM T;  5LJ3 f;  3CD6 T;  3P8B B;  4KT0 E;  2X35 A;  2DFU A;  5DM7 R;  4LDY A;  3QBY A;  4XU1 A;  4CI0 C;  2R58 A;  4OB0 B;  2RQW A;  2ZCF B;  4X1V A;  2LQK A;  1TU0 B;  3CCE T;  4C0Z A;  3NHN A;  4FT2 A;  2AKL A;  2HAX A;  3G4S T;  1K9M U;  2QQ9 A;  4C8Q E;  4V2S A;  3GOX A;  2EKH A;  2IG0 A;  1KD1 R;  1VQM Q;  3L2Z A;  3OS5 A;  1MGQ A;  3BFM A;  3A8H B;  2QEX A;  1UE9 A;  1M1K R;  1Y96 A;  1B7T A;  4FSX A;  3E1S A;  3VS0 A;  2EGA A;  2JOY A;  5CO7 A;  1ZSZ B;  3JCM g;  1VA7 A;  4A4F A;  1K4U S;  2KDS A;  4PJN A;  4C5I A;  1N5Z A;  1X6G A;  1OU9 A;  1WQ7 A;  2HBP A;  2J6O A;  5GAM j;  2K57 A;  5LL6 S;  1HD3 A;  3CMA T;  2VWF A;  3KUF A;  1X6B A;  1GCP A;  4PJM A;  2NLU A;  4J6Y A;  3MP8 A;  2CUD A;  1VQ8 Q;  4D6W A;  1W4S A;  1WNL A;  4HCZ A;  4AFU C;  1Q86 R;  2GNC A;  4AMC A;  4M75 E;  3DKM A;  1RAG B;  1GXI E;  4PJJ A;  1I07 A;  1WIE A;  1UGR B;  1D1B A;  2JJ9 A;  3SFM A;  2RH2 A;  4J9F A;  1VQ9 T;  3J7A F;  1M2V B;  1YIT A;  3PVQ A;  3L42 A;  2DXT A;  1QLY A;  8AT1 B;  4MZP A;  4DBF A;  3KXT A;  2E65 A;  1KIK A;  1B34 B;  2EWN A;  3MCA B;  3LYI A;  3Q1J A;  3L2V A;  3UA7 A;  4N0A A;  4C0F A;  2E3H A;  3G1J A;  3TSW A;  2PZ1 A;  1NEG A;  1PD1 A;  1G83 A;  2M02 A;  4M78 C;  3S3O A;  2E5Q A;  2HBW A;  3E9G A;  4LDW A;  3JB9 F;  1IRE B;  5FU6 C;  4XTX A;  3L2R A;  3CCU Q;  3EFR A;  1KD1 U;  2H3J A;  3FRN A;  5KE2 A;  4HCK A;  2CZ6 B;  2LMJ A;  3OYA A;  4M77 E;  2RJC A;  2D8J A;  2QA4 A;  2ZZD A;  4M7A D;  2PU9 B;  3NTI A;  1OEB A;  4ESR A;  5L23 A;  5IN1 A;  1Q81 C;  3EH1 A;  3CBO A;  3VV0 A;  4Q5W A;  1YI2 Q;  1VQP Q;  3WVE B;  2DVE A;  1HXD A;  1FX7 A;  1W70 A;  4NL3 A;  1VQ6 T;  5GJV B;  2DVJ A;  3RMQ A;  3CQT A;  5I22 A;  9ATC B;  1QKW A;  1NJI R;  4PJO F;  1B07 A;  1NPP A;  4J9C A;  1GRI A;  1Z9Q A;  5FU7 C;  2RJF A;  1M2V A;  2X51 A;  1BCM A;  1YJW A;  3E19 A;  1IHW A;  1RI0 A;  1Q86 U;  4HVV A;  1M4Z A;  2CUB A;  1PRM C;  4J6W A;  4ZGJ B;  1G3Y A;  2CSI A;  1B34 A;  2LX9 A;  3MJX A;  3HRS A;  4XK8 E;  3X28 B;  2EQU A;  2E3I A;  3L1A A;  2MWP A;  4R0K A;  4XU3 A;  1D1C A;  2ABL A;  3QZ9 B;  3SHW A;  4C92 B;  4MML A;  3EG2 A;  3RKY A;  4LDV A;  2OX7 A;  5GAO p;  3G6E Q;  3TQ7 P;  3CCR A;  5D6W A;  2BE7 D;  2R57 A;  2FVU A;  1VQO A;  1LCK A;  5A0G A;  3JCM X;  3X24 B;  4BB7 A;  3TSZ A;  2DRK A;  1TTH B;  1YHQ Q;  2Z0W A;  4JJN K;  2F2W A;  5KYN A;  3I56 Q;  2KAF A;  2F2X A;  3D7S B;  5GAN g;  2K9G A;  1E6G A;  2RI2 A;  5CKD A;  3CME Q;  2FPE A;  1YP5 A;  2QK0 A;  2FPD A;  4NL2 A;  3VRZ A;  1SRM A;  4K11 A;  4AFZ C;  2O9V A;  5FRM A;  1QCO A;  2EJ9 A;  1KQS S;  2O4X B;  2JTM A;  4C5H A;  1VQ7 Q;  3VS6 A;  4DA4 A;  1N8R R;  2EQK A;  3OMG A;  3MEA A;  3UAT A;  4M7D C;  4LXC A;  2QQA A;  2CDT A;  1NJI U;  1O9S A;  1OI1 A;  3KFV A;  4JJC A;  3CC2 Q;  3M4Y A;  3QWY A;  2RQU A;  3OYF A;  1ZQ1 A;  3VYG A;  3CC4 T;  1VQK A;  3M0T A;  2JTE A;  2EQJ A;  1X2Q A;  4FM4 B;  4YTL A;  3V8J A;  2DLP A;  2M0O A;  3A8M B;  4ORZ A;  1X69 A;  4PFO A;  2RI5 A;  1WXU A;  1RUW A;  2RQV A;  2DEQ A;  3I55 T;  2DXB A;  4J6X A;  1LPL A;  2EIF A;  5LJ5 j;  2LQN A;  1V29 B;  3I35 A;  4HVW A;  4RTV A;  1ZBJ A;  2YUO A;  3EAE A;  3EG1 A;  3CCV Q;  5HCK A;  1M2O A;  1RAI B;  3EGD A;  4B6M A;  5LJ3 g;  1VQM A;  1QWE A;  3KBG A;  3OYC A;  1MHN A;  4C8Q B;  1PNJ A;  3OSS C;  2ROL A;  1GL5 A;  3CC7 Q;  5HK0 A;  4JPB W;  4OB2 B;  1S72 T;  1KC8 C;  4DBH A;  1YJ9 T;  4RTW A;  1W1F A;  2O4X A;  5KYY B;  2JN0 A;  3CCQ A;  2X4W A;  4C5G A;  1AWX A;  4FYV B;  2G6F X;  2Y4Y A;  5CKE A;  2B86 A;  2QEX Q;  2C06 A;  4RKU E;  3JB9 I;  5KH6 A;  2DTH A;  1WPY A;  1YJN Q;  1MMN A;  1U1T A;  1WXB A;  2GTJ A;  3JCM Q;  4FW1 A;  3L2Q A;  2EBP A;  3A8L B;  1VQ8 A;  2D9T A;  5GMK j;  2MIO A;  2QYZ A;  1OPK A;  3CBP A;  1SHG A;  3LLR A;  3J81 E;  4LD9 K;  2KSS A;  2RHI A;  5I21 A;  1D0X A;  2O9S A;  7AT1 B;  1I0C A;  2DZ9 A;  2LCC A;  1ZLM A;  3CXC P;  2YRC A;  2XDB A;  2P4R A;  4E7L A;  1GBQ A;  1I4K 1;  2GFA A;  3FB9 A;  1K76 A;  2JM9 A;  3LWH A;  4DOV A;  1TUC A;  1SKU B;  5GAM e;  1J3T A;  2YUQ A;  1M8M A;  3OYE A;  1TWB A;  1H8K A;  1MMG A;  3EGX B;  1SSH A;  2COW A;  2CSQ A;  4M7A F;  4RMO A;  1M8V A;  2QAS A;  3CCM Q;  3A8O B;  4C0D C;  1VQN A;  2CP2 A;  2MPX C;  3CD6 Q;  2FG0 A;  2D6F A;  1IZ6 A;  3M0Q A;  5GAN 2;  3C4S A;  4XQ3 A;  3PTA A;  2EJG A;  1UG1 A;  3CCU A;  4EMK B;  1IGQ A;  4M75 C;  5CKB A;  5KYY A;  2DPP B;  4ANJ A;  3SWN B;  3JCM J;  2DTO A;  3CCL T;  1A0N B;  2QTV A;  5IT9 E;  2I2L A;  4RTZ A;  1HJD A;  4M77 B;  1WHM A;  4BDZ A;  1YI2 A;  1VQP A;  3HP9 A;  4RG8 A;  2DL3 A;  3NGP A;  1D09 B;  3OW2 A;  4E7Z A;  3SDZ A;  4QVD A;  3LH5 A;  1M90 C;  1C1A A;  2M1H A;  1JQQ A;  1KG1 A;  5CIU A;  2M0Y A;  1KHI A;  3OYN A;  5GAM f;  4HCB A;  4MMK A;  1IB8 A;  2NUZ A;  3JB9 G;  1EZZ B;  3OYL A;  3JCM c;  2F5K A;  2PNI A;  4E7S A;  2JMC A;  5GAO m;  2P84 A;  2NUT B;  3S6W A;  2DTI A;  3UDC A;  2QQB A;  1KFZ A;  2F69 A;  2ED0 A;  1OZ3 A;  1CKA A;  4IIM A;  2L0A A;  4AFQ C;  2FHD A;  2KBT A;  3L2W A;  4RTY A;  4PJO E;  2DIQ A;  4EMH A;  3EGX A;  3VKI A;  1NG2 A;  2XID A;  4FYX B;  3RNJ A;  2PVD B;  4B9X A;  3CPW A;  1AOJ A;  1WHK A;  5D7U A;  1UTI A;  1PG5 B;  4ZTJ A;  2RM4 A;  1Q82 U;  1QVG A;  1UHC A;  2CP3 A;  2EAY A;  1UGP B;  4PJO G;  3CCJ Q;  3M0U A;  4EMK A;  2EYZ A;  2D8H A;  1G2B A;  2EVR A;  2EQM A;  1JJ2 S;  4BY6 B;  4E47 A;  2F2V A;  2HKN A;  1YHQ A;  2CRE A;  1NM7 A;  4JZ4 A;  2NWM A;  5IHK A;  3I56 A;  2MYS A;  2V26 A;  1VQ5 T;  1BI1 A;  2DD4 A;  2XG8 D;  3DLL A;  1NEB A;  2E64 A;  1QVF A;  2ECZ A;  2M51 A;  3CME A;  2KNB B;  5FW9 A;  2ZPE B;  4CRI A;  5CVI A;  4PNO A;  3AT1 B;  3ZBD A;  1MUZ A;  5HKC A;  2MMP A;  1Z9Z A;  1GFD A;  2J7I A;  3ME9 A;  4PJL A;  3M0P A;  2EYQ A;  3CPF A;  2NUT A;  2E6N A;  1VYT A;  5EG2 A;  4J9D A;  4J9G A;  1FMK A;  2JMA A;  3FLG A;  3OYD A;  2DF6 A;  2QQR A;  3N5B B;  1VQ6 Q;  2V1R A;  3MEW A;  1MND A;  2YRV A;  1TH7 A;  2ZPF B;  3SB2 A;  2KXD A;  1R77 A;  2LT1 A;  2KR3 A;  1AZE A;  3ASK A;  1KQS P;  4XTU A;  4C92 D;  3TU4 K;  5FRN A;  1WGS A;  3EG0 A;  4J9I A;  1RAC B;  4F7U E;  2HQE A;  4J9B A;  1SG5 A;  2FRY A;  2VVK A;  1UJ0 A;  4RG2 A;  4E6R A;  2CT4 A;  2KVQ G;  4ZGE B;  6AT1 B;  3REA B;  4II1 A;  5GAO r;  2R5M A;  1I5O B;  4DBQ A;  1AD5 A;  3H0I A;  3JCM h;  1VUB A;  3LW5 E;  1T3L A;  1WZO A;  2E1H A;  3RIR A;  3CCS T;  3CCV A;  5D6X A;  4IUT A;  2QI2 A;  3O5Z A;  2MAM A;  3FDR A;  4Z89 A;  2K7A A;  4IUQ A;  3OMC A;  2ZPH B;  3HHT B;  3M58 A;  2BE9 B;  1LNX A;  1LOJ A;  3CC7 A;  1K1Z A;  1Q81 R;  1VIE A;  1ZX6 A;  3OYJ A;  4F14 A;  5LJ5 e;  4ZTF A;  2HL3 A;  2VXE A;  4IIO A;  3VJP A;  3OW2 S;  4IUU A;  2QTX A;  4LDX A;  3NFC A;  3QYH B;  1Y57 A;  2EJF A;  1BI2 A;  4AG2 C;  2KE9 A;  1ZUK A;  4OF1 A;  1YJN A;  2DER A;  4MDW A;  4HXJ A;  2LP5 A;  2WAC A;  8ATC B;  3M0S A;  3CCQ Q;  1QKX A;  4Y28 E;  2P0Q A;  4JZ3 A;  1F1B B;  4BAC A;  1PSE A;  1JO8 A;  3OQ5 A;  2RJD A;  1OX9 A;  3GF5 A;  2XMF A;  3CPW S;  1H92 A;  2QGF B;  2DA9 A;  2OTJ T;  2QA4 T;  3FEO A;  3EFO A;  2YUN A;  1UEC A;  3CC4 Q;  3IQL A;  4M78 B;  1QVG S;  4WF2 A;  5LJ5 f;  5D6Y A;  4C8Q D;  5FU6 B;  1K8A C;  2JUF A;  3LGL A;  4Y92 A;  1RAE B;  3JCM d;  4ZN3 A;  2K5I A;  2K3X A;  2RI3 A;  3CCM A;  2J05 A;  2BKD N;  4DQ2 A;  1AT1 B;  5GMK e;  3CD6 A;  2KQW A;  1WHG A;  2YDL A;  4N0A C;  1RLQ C;  2DXU A;  2CP5 A;  2FPF A;  2K6D A;  4QQ6 A;  5GJW B;  3CCE A;  1WYX A;  2BZX A;  1Y7X A;  4OB3 B;  1X27 A;  3G71 T;  4MDX A;  5C6S A;  2YUP A;  2BIV A;  3OYH A;  2WSE E;  1KK7 A;  1EX4 A;  1VQN Q;  1JXO A;  1KHC A;  1OPL A;  2XK0 A;  4OMF B;  1ZHI A;  2DL7 A;  4QQD A;  4M7A G;  2MOX A;  3RBB B;  3QUI A;  2LQW A;  5FU7 B;  1VQ4 Q;  1AZG B;  1K0X A;  1RLP C;  2JS0 A;  1ZSZ A;  2A08 A;  1S72 Q;  1NZ9 A;  2ZPI B;  2VKN A;  3X20 B;  3GLX A;  3ZEH A;  3JCM W;  2GFU A;  1M1K U;  4NOY A;  1Y71 A;  2DE0 X;  4PLI A;  2PQW A;  2FEI A;  3OSV A;  3QII A;  2ZPB B;  1VQO T;  2DO3 A;  2QDL A;  3MET A;  1WFW A;  5J3B A;  3I9Q A;  4JRQ A;  2LQ8 A;  2RB6 A;  3CMA A;  4M78 A;  1OU8 A;  2KEA A;  5GAM g;  4J8O A;  2QXF A;  4M4Z A;  5KCO A;  5GAN h;  2HEQ A;  2H3E B;  1YWO A;  4J5Y A;  3GNG A;  1BU1 A;  2D1X A;  1VQ9 A;  4XTW A;  2SEM A;  3T9N A;  3PGG A;  2RMO A;  3MPU B;  2E70 A;  3CCJ A;  4ATO A;  1MV0 B;  2JS2 A;  2OI3 A;  2R5A A;  3OYM A;  2J06 A;  3MHX A;  2KYB A;  4M77 D;  4OMO A;  1KC8 R;  3PIP A;  4KGV B;  3VUZ A;  4QVC A;  1YN8 A;  2X4X A;  2ED1 A;  1Q95 G;  2P0K A;  5GAN 5;  1Q7Y C;  1T0H A;  3QSU A;  4PJO C;  1PSF A;  1M9S A;  1K73 R;  4M7D B;  3M59 A;  3E9F A;  3HRT A;  3MKD A;  1EIF A;  3OYB A;  4C92 F;  2CZ7 B;  1ZA2 B;  3R6N A;  2HSP A;  1LVK A;  3QWX X;  1PKS A;  1SHF A;  1VQ6 A;  2WSF E;  3V7R A;  2PTK A;  2XU8 A;  2A0F B;  4IUR A;  5FWB A;  2AIR B;  2LNH B;  3OYY A;  5LJ3 h;  1W2B P;  5HY6 A;  5I2M A;  2XDP A;  4KH1 B;  3A5Z B;  2LJ0 A;  4QQG A;  5GAN d;  1QQJ A;  4N4G A;  2E4H A;  1N6A A;  1UDL A;  1PD0 A;  3DB3 A;  2DL8 A;  2KYM A;  2OAW A;  1OV3 A;  1BCO A;  3JCM V;  2A37 A;  2VV5 A;  2LCL A;  3EH2 A;  2GCX A;  2E12 A;  3VS4 A;  4C92 A;  5KYW B;  4FIB A;  2FZC B;  2VUB A;  3OS1 A;  1NYG A;  3JCM e;  2X9H A;  2XDD A;  3WVD B;  2DK3 A;  4M7D A;  1KQ2 A;  4IKF A;  3X26 B;  1X43 A;  1Y07 A;  3BDU A;  3M9Q A;  1KC8 U;  2FB7 A;  2F5T X;  3HPW A;  1WJQ A;  1BK2 A;  1M1G A;  2PVO B;  2L5Q A;  1OZ2 A;  1LJO A;  1M90 R;  4A4K A;  5ECA A;  1D0Y A;  1ZBX A;  3OYG A;  2HSE B;  2YT6 A;  3EFS A;  1KQ1 A;  2HL5 C;  2RQR A;  3CBM A;  2FL7 A;  4BI4 A;  1MMA A;  1T0J A;  3RKW A;  4C8Q F;  5EC7 A;  3PT9 A;  1AVZ C;  1ZUY A;  2FRW A;  4RUG A;  4E7J A;  2AZV A;  1K73 C;  2V8J A;  5LJ3 d;  3CCU T;  2LJ1 A;  4FYY B;  1I81 A;  1RAB B;  4KBM B;  1K9A A;  2YLC A;  3QPH A;  2AT1 B;  1QCF A;  1N8R U;  2E5K A;  3MP1 A;  3CC4 A;  1WJR A;  4TVR A;  2EPD A;  5J39 A;  1GBR A;  2KGT A;  1VQP T;  1UUE A;  1WXT A;  1W2B A;  5KYW A;  3A98 A;  4JRI A;  4LUD A;  3OBY A;  2DBM A;  4M75 B;  3VYH B;  2E41 A;  3JRZ A;  2GQI A;  2AK5 A;  2CP0 A;  2KRS A;  4FU6 A;  1G3W A;  3E2U A;  1SSF A;  2DM1 A;  1HK9 A;  3I5S A;  4KUD K;  1PRL C;  1I1J A;  3LWI A;  1WJS A;  5LJ5 g;  4ZN1 A;  4BI8 B;  4C8Q A;  2MI6 A;  3CCS Q;  3VS7 A;  3ZFJ A;  5DLO A;  1Y0M A;  4WTO B;  5CCA A;  1SPK A;  2CKK A;  2DRM A;  4E7I A;  2Y90 A;  1VQL T;  2K3B A;  4HT9 A;  3EHR A;  3S3N A;  1VQ4 A;  4C5E A;  3CCE Q;  1M90 U;  1X75 C;  1S72 A;  1D1A A;  2FZG B;  1HSQ A;  3PE0 A;  4N4I A;  3G4S Q;  2KRN A;  2DL4 A;  5GMK l;  4ME7 A;  4M78 G;  4OGC A;  4PLL A;  5CAI A;  3G6E T;  1OQK A;  3UWN A;  5IHI A;  4FW2 A;  1AHJ B;  4M7A C;  4M78 D;  4XTY A;  5IXF A;  4E7H A;  2OTL T;  2IIM A;  1JU5 C;  3I56 T;  4KGX B;  1VOM A;  4M77 F;  1G5V A;  5I2S A;  4KUI A;  2IVW A;  2VGN A;  3CME T;  1UGQ B;  1AEY A;  1WDX A;  1NLP C;  4M75 A;  4BI3 A;  3H6Z A;  4A4G A;  3NMZ C;  4X34 A;  4JJB A;  4OMN A;  4EPC A;  5A2Q E;  3VRY A;  3CMA Q;  4X9D A;  2HQH A;  2DAQ A;  1ZA1 B;  3U23 A;  4E7K A;  3PMT A;  1PC0 A;  5CQX A;  1VQ7 T;  1NYF A;  2RQT A;  2G3R A;  1AWJ A;  2CZ1 B;  4EMK C;  3WXM B;  3OY9 A;  1YWP A;  3FJ5 A;  3V7C A;  1E7O A;  3HKS A;  2V8I A;  3I5R A;  3CC2 T;  1EFN A;  1VQ9 Q;  2L89 A;  3C0C A;  3M56 A;  1G3S A;  3CXC A;  1D0Z A;  3M4G A;  4IUV A;  2ZAE A;  4AFS C;  4OGE A;  4FT4 A;  2EYW A;  3SWN A;  1PCX A;  4RTU A;  3MO8 A;  3QDF A;  4GY5 A;  4OMP A;  3TRE A;  3G71 Q;  4M77 A;  2FZK B;  1YIJ T;  1X6O A;  2LNV A;  1VYV A;  4CC7 A;  2QAZ A;  2AZS A;  2XKO C;  2RJE A;  4J83 A;  5GAN 6;  4IUP A;  3VU3 C;  1QWF A;  2J6F A;  3CCV T;  4DEY A;  1QW1 A;  4ZNX A;  4OML A;  2RK2 A;  4JRK A;  1MV3 A;  1Q82 C;  1JB0 E;  4RCC A;  1O75 A;  2K4Y A;  2VXF A;  3CC7 T;  1MMD A;  2YSQ A;  3QJ6 A;  3JV3 A;  2AKK A;  1K8A R;  4C92 G;  3PNW C;  4BE0 A;  2RO0 A;  1BIA A;  2I0N A;  2RNA A;  2KRO A;  2HD0 A;  4OB1 B;  2QEX T;  4F17 A;  4M7D G;  5CK9 A;  5GMK m;  3MP6 A;  3HL8 A;  3J80 E;  4D8K A;  3TEE A;  4RTX A;  2W10 A;  2EGC A;  1QVP A;  2FO0 A;  3RES A;  4M7D D;  1FMW A;  2LDM A;  3LX7 A;  2ROT A;  4FCY A;  2HQX A;  2DJQ A;  5CKH A;  4FL6 A;  1M30 A;  3JB9 J;  3QZ5 B;  1H3H A;  3S3M A;  3NTK A;  1UEB A;  2DIG A;  3GPL A;  1PHT A;  1VQ5 A;  3NPF A;  1M27 C;  1UGS B;  4P5N A;  2X4Y A;  4LN2 A;  1K0S A;  2BZ8 A;  2PUO B;  2CZ0 B;  4OVA A;  3TVT A;  1YIT T;  1GCQ A;  2LTO A;  2RHZ A;  4C0G A;  3NTH A;  4GLM A;  1H64 1;  1R8O B;  2QG9 B;  4XU0 A;  2RHY A;  3EG9 B;  3VS2 A;  4X9C A;  2YLB A;  3R6O A;  3RR6 A;  5GAN 3;  3BW1 A;  4XU2 A;  3QYG B;  3EGU A;  2DMO A;  2QQS A;  1S1N A;  4NS5 A;  4F16 A;  2KI7 A;  3URG A;  3JB9 H;  1U3O A;  2EQI A;  2XD0 A;  1K8A U;  1M5Q 1;  3H41 A;  2L3P A;  5GAN 8;  4QT7 A;  3QO3 A;  4C8Q G;  1YFN A;  3MEU A;  1IGU A; 
#chains in the Genus database with same CATH homology
 3CCU Q;  1VQO Q;  1Q82 R;  3CMA Q;  1Q81 R;  1K8A R;  1VQ6 Q;  1VQ4 Q;  1VQ8 Q;  1VQK Q;  3CPW P;  3CCE Q;  1K73 R;  1Q86 R;  3CC4 Q;  1S72 Q;  1YHQ Q;  1NJI R;  2QA4 Q;  3CCQ Q;  1JJ2 P;  2OTL Q;  2OTJ Q;  3G4S Q;  1KD1 R;  3CCV Q;  1YJ9 Q;  1VQM Q;  1W2B P;  1KQS P;  1QVG P;  1Q7Y R;  3I56 Q;  1QVF P;  1VQ7 Q;  3G71 Q;  3CCM Q;  1N8R R;  1K9M R;  3CCS Q;  3CCL Q;  1VQN Q;  3OW2 P;  1YIT Q;  1KC8 R;  3CXC P;  1YI2 Q;  1YJW Q;  1M90 R;  2QEX Q;  1VQP Q;  3CD6 Q;  1VQ5 Q;  1M1K R;  3I55 Q;  3CME Q;  1YIJ Q;  1VQ9 Q;  3CC7 Q;  3CCR Q;  3CCJ Q;  3G6E Q;  1YJN Q;  1VQL Q;  3CC2 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...