3CCMQ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
molecule tags Ribosome
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3ccmQ00
3CPWP 3CCMQ 2QA4Q 3I56Q 1YITQ 1VQ9Q 3CMEQ 1M90R 3CC2Q 1VQ6Q 1VQPQ 3CCLQ 3CC4Q 3CMAQ 1Q82R 1QVGP 1KC8R 1QVFP 3CCVQ 1YJNQ 1NJIR 3CXCP 1VQ4Q 1VQNQ 1W2BP 3G71Q 1YHQQ 1VQLQ 1Q86R 1VQOQ 1K9MR 3CCRQ 1N8RR 1Q81R 1KD1R 3I55Q 3CCQQ 3CD6Q 1VQKQ 1KQSP 3CCJQ 1S72Q 3CCUQ 1VQ8Q 1VQ5Q 1YI2Q 1VQMQ 1YJWQ 1K73R 1JJ2P 1YJ9Q 3CCEQ 3G4SQ 3CC7Q 2OTJQ 1VQ7Q 1K8AR 2OTLQ 3G6EQ 1YIJQ 2QEXQ 3OW2P 1M1KR 1Q7YR 3CCSQ
chains in the Genus database with same CATH superfamily
2X3WD 4NOYA 1VQPQ 1UDLA 2RJCA 1RAGB 4A53A 4C5HA 4HT8A 2W0ZA 3OYEA 4M75D 3G4SA 2D8HA 4C0DC 1KD1R 1E6HA 2RI2A 4EIKA 2FZGB 5IT9E 2DJQA 3I56A 9ATCB 3VKIA 3OS2A 3OYJA 2ZPIB 2EKHA 4NS5A 3WXMB 3TSZA 3SEMA 2C0OA 2XU8A 2KYMA 5FROA 5FU7C 3PIPA 1M8VA 4PFZA 4IUVA 2ZCFB 2A0FB 2E3IA 4XTYA 2LNVA 2LCLA 1QKXA 1QWFA 2YHTA 3M58A 4C92D 2JT4A 3CCLA 7AT1B 1PKTA 1BU1A 3ULRB 1GCQA 5IXBA 1N5ZA 1NEGA 1E7OA 4O6JA 4CI0C 2RO0A 1HSQA 1TTHB 2DBMA 2ZPGB 2J6FA 1I81A 3PVQA 3I56Q 4A63B 2HBPA 2NUPA 3TU4K 1QVFA 2CT4A 5IXFA 1WPYA 2VWFA 2RHXA 3JCMg 2JTMA 5A0DA 4JZ4A 1VQ6T 1IRXA 4HVWA 5CAIA 1Y71A 5FW9A 4E7SA 1AT1B 3MEAA 4M77D 3EG3A 3KFVA 1AHJB 2JS0A 3M0TA 1HJDA 2VUBA 2AZVA 1KSWA 3CCEA 1PRMC 3A8OB 2FYKA 5CK9A 3HPWA 4AMCA 2COYA 3OMGA 4Z02A 4Z8AA 1NM7A 3X20B 1KQSA 1WZOA 2X9HA 1N8RU 2JNGA 2M1HA 1VOMA 3MO8A 2DIGA 2XIDA 1SG5A 3CCQQ 1K9MC 2DYIA 3JV3A 1VQ7T 4J9EA 2VYTA 4LXCA 3CCEQ 2FVUA 1BCOA 4B6MA 2DFUA 1K8AU 2FPFA 5KCHA 1Q82C 1GCPA 2K7AA 3OBYA 2HZYA 3M53A 1PNJA 5GAOl 2G6FX 4PKCC 2V8JA 2MPXC 2MI6A 2GTJA 4XU2A 2EFIA 1HK9A 1T0HA 5KYXB 2CP7A 4RTVA 1K76A 6AT1B 3RKXA 5DLOA 2YRVA 2K57A 4ZGDB 1BKBA 1FYNA 3OB9A 4M4ZA 1TUGB 4IUPA 3VYGA 3PTAA 3OYFA 4D8DA 1D1CA 5A2QE 3HFNA 4C5IA 1BYMA 2JM9A 5GAN6 4J8OA 3KBGA 4E7HA 4XTZA 2DL8A 3J80E 2VC8A 3I55T 2EQJA 2W10A 1M5Q1 2A36A 2KXCA 5CKHA 2BZYA 3JRZA 2RQWA 4J83A 1UGPB 2DLPA 3MP6A 3LX7A 1UHCA 4FW2A 2L3SA 3VUBA 2L2PA 3H0IA 3L2VA 1X01A 2AKKA 3ZBDA 3NFCA 4LDXA 3SWNB 2E41A 2K3BA 1M1KC 1WQWA 1AEYA 3OYNA 4F17A 1Q81R 3M59A 4AG2C 3RKYA 3M54A 3INZA 3V8KA 1MHNA 2PVDB 2DKGA 2EQMA 1UECA 2NWMA 3M0QA 2AKLA 4M77B 5LJ3e 4A4GA 1V29B 1X2QA 1RAFB 2RK1A 3CC4T 1PKSA 2DYBA 4LN2A 1VQKT 5FU7B 2IIMA 2D0QB 2DTHA 2ED1A 5GJWB 2QXFA 2X4WA 2XK0A 4N4HA 2E5QA 2DXBA 3FC3A 2L8DA 4BACA 4ESRA 2P84A 4XTVA 4M7DF 1BBZA 4M7AE 1IGQA 5CKEA 4C0DB 1WHLA 1WHJA 4OMPA 1VQMT 1XOVA 4J7FA 2FRWA 2VASA 2VKNA 4J7IA 2HDAA 4EMKB 5KE3A 2EW3A 1XJWB 3CC2T 1RL2A 1X6BA 2E6NA 4M7DC 2KI7A 3VS5A 4R56A 2CYZB 5FU6C 1M90U 2RK2A 1ZSGA 2K3YA 2GQIA 1BI0A 5IAYA 4ZN1A 1OQKA 2YUQA 2OI3A 3CD6T 4AFZC 5GANg 2NUTB 3JCMb 2G3RA 2MMPA 1QQJA 4WCIA 3QIIA 1QP2A 3CCVQ 2FRYA 5GANd 4M7AC 3DB4A 1MV3A 2GF7A 2KQWA 4M7DG 1FXXA 3FDRA 1BI3A 2RA2A 5LJ5j 3LWIA 4ZNXA 4JRKA 3CC7A 2QDYB 2QEXQ 2EWNA 4N0AC 1VIEA 2HCKA 1G3TA 3H0FA 3MPUB 3LGFA 2EAYA 1VQ8A 3EGDA 3TSWA 5KYYA 5GANj 2ZPHB 3VS4A 4LUEA 1K8AR 4F7UF 1K0SA 2O9VA 5D7UA 2K5LA 2KGTA 2LX9A 2RI5A 2MF2A 3CBPA 1M1FA 2DNUA 1T0JA 2YUNA 3L2UA 3VS1A 4R55A 2CKKA 3CMAA 1ZUYA 2YRCA 3CCJQ 2BE9B 5I22A 2RJEA 2CT3A 2Y4YA 2O01E 4FT2A 4GLKA 5HK3A 2SRCA 1PCXA 2QASA 1UTIA 4BY6C 2LT1A 4JZ3A 5KYNA 1WFWA 2B86A 4ZTJA 4ZTFA 2EGAA 2I0NA 3CC7T 2EQIA 1M27C 1MMGA 2KY9A 2OAUA 3LLRA 2CH4W 1NE8A 8ATCB 4PNOA 3PNWC 4LD9K 2LQWA 3QWYA 3CCRT 2GNCA 1TWBA 5GAOq 2RPNA 3C4SA 1PRLC 4OB2B 1GCQC 2RHIA 3MP1A 3RNJA 2WSEE 3A1PA 1N6AA 4OB3B 1QVFS 2D1XA 4FW1A 4M78A 3CEYA 2RHZA 1UGRB 2KBTA 2O4XA 1VQ5Q 4R0KA 2C06A 2PNIA 4TVRA 4JDSA 4L6V5 3TREA 1KIKA 2AZSA 4EMGA 3REBB 3CPWP 5KYUA 1CKAA 1U3OA 2ROTA 2KR3A 2DTIA 5KYYB 1EZZB 3CCSA 1WGSA 3BY7A 1H641 4QQDA 1BI2A 1WJQA 5IHKA 4N4IA 3S3NA 2HAXA 4M77F 3E1SA 3V8JA 2XDDA 2BZ8A 1VQOA 4XK8E 2LDMA 2VV5A 3MKDA 2MCNA 2JS2A 2L3RA 4M78G 1VQKA 4XTWA 1SPKA 3R6OA 2YLBA 2VGMA 1UGSB 5GANh 3UATA 1IB8A 2RQTA 4M77A 2HQHA 3OYLA 4LNPA 3OYHA 1MUZA 4C92F 3CCMA 1W4SA 2CZ1B 2EQKA 3EGXA 2YT6A 1PWTA 1ZSZA 3CMET 4M75C 4M78B 2LCCA 2X4JA 5CKDA 3CC4Q 3SB2A 1QVFP 2DL4A 1RAIB 3L2ZA 2LVMA 3O8VA 4ZGJB 2HQXA 4XU0A 1D3BA 2J06A 4JS4A 1CSKA 4XU1A 1UFFA 5KYUB 3CC7Q 3HSBA 1VQ5A 3BDUA 4A54A 4HCKA 2VVKA 4J9FA 1ZBXA 2MAMA 5IH2A 3JAME 3MCAB 2BTTA 3G71T 2MWPA 4FSXA 2DZ9A 4FIBA 4OMOA 4M75E 1OPKA 3REAB 1D1AA 2EPDA 2FHDA 2JTFA 4M75B 4KULA 4PJOC 2F2WA 2ZPFB 5GAN5 1OYXA 1S72A 3EH2A 2NUZA 2A3LA 2JTEA 3QXEB 2FZCB 2IG0A 5CQYA 3PIOA 3M4YA 2QQBA 3H9NA 4C8QE 2E5KA 1TUCA 1I8FA 5J39A 4MDXA 3JCMV 2JUFA 3M57A 4L59A 4OF1A 1JJ2P 2FPDA 5KYWB 1A0NB 4J9GA 4A4HA 3CCMQ 4KH0B 3G7ZA 2WSCE 2EYZA 2QYZA 2LX7A 5FWCA 1IO6A 3CCET 3WVDB 2COZA 4RTXA 4HKEA 4EMKC 1VQNA 3LH0A 4J6YA 5HKCA 2YXYA 1GBRA 1JU5C 4F7UG 4QKUA 2XHCA 5CQXA 3NTKA 4OB0B 5DM7R 3G71Q 3NHNA 2LQKA 1UG1A 1Q7YC 3H6ZA 4J5YA 1JQQA 2QK0A 4ATOA 4BY6B 2L0AA 3FJPA 1NJIC 2KE9A 3DLLA 5EG2A 5CO7A 2QTXA 3CCMT 4DQ2A 1K0XA 4PJNA 1ZA1B 4C8QG 1MGQA 1G2BA 2BKDN 2V26A 4RMOA 2H8HA 2L3QA 5LJ5f 1ZUUA 4IKFA 1I1JA 3SWNC 1TUDA 1K4US 4BB7A 1YI2Q 4C92G 5GAMd 2GGRA 1G5VA 2M0OA 3X25B 1K73C 1N27A 3D7SB 4CC3A 2FZKB 4OMQA 3VS7A 1YJNQ 1LCKA 4J6WA 4ELYC 2YUPA 4J9IA 1H3HA 3V7CA 2E3HA 1UE9A 2CUBA 1M30A 2AHJB 3VV0A 2KRSA 3OYIA 1Q81C 1G3WA 5GAN7 3ASKA 3U23A 5HY6A 1OU9A 1QMCA 2HEQA 1T3SA 4L5GA 3TVTA 3CCQT 2GFUA 4KH1B 1PM3A 2CZ6B 3G1JA 4FU6A 3JCMW 1TH7A 4DA4A 1Y57A 4DEYA 1OULA 2QQ9A 3H0HA 3VRZA 3OW2S 3BE3A 1U1TA 1YBYA 3I9QA 3ZEHA 3V7SA 2OTJT 3NTIA 4PJOD 3QWXX 4O5VA 4HA8A 4A4EA 5GAN4 2DD4A 5I2MA 1ARKA 1LJOA 2QGFB 4GY5A 1U1SA 1YIJA 1OPLA 1RADB 2O31A 4JRIA 1WYXA 4FCYA 3RMQA 1S72Q 2ZZDA 3H41A 4C92E 4M7DB 5C6SA 5LJ5e 1D0YA 2DVJA 2AIRB 2RM4A 4J9DA 1JB0E 4KT0E 2RQVA 5D6XA 5AT1B 2ATCB 5D6WA 1TS9A 4JRQA 3L2RA 4M7DE 1K9MU 1TXQA 1Y0MA 4RTYA 1XTDA 2OTLA 3BW1A 4LDVA 1NJIU 2X4YA 1VUBA 2IVWA 1M2VB 3E19A 3HTRA 3EG9A 1D0ZA 1ZA2B 4M77E 1UUEA 3RBBB 1JXOA 4C5EA 3G6EQ 1X6GA 1I5OB 4MZTA 4AG1C 1W6XA 3CPWA 3HRSA 3OS1A 3I5RA 1PD0A 4FYXB 1Z9ZA 3EFRA 3IQLA 2LCSA 3EHRA 2E65A 2BE7D 4FM4B 3OYMA 2JVVA 1EFNA 1DJ7B 3PE0A 3VU3C 2E10A 4HT9A 1PSFA 3QJYA 5LJ3f 4M75G 2R5AA 1YJNA 1YJWA 1WNLA 1YCYA 4M7DA 4HCCA 3M55A 3JB9J 3M0UA 1QVPA 1YITT 5DY9A 3I55A 3QBYA 1WXTA 4PJLA 4A4KA 1Y96B 3HHTB 3X26B 1LVKA 5I21A 2OTLT 3OSVA 1M8MA 3A8GB 1SSHA 1X69A 1G3SA 2PUKB 1JRIA 2HD0A 1SRMA 2L3PA 1N9SA 4BI3A 3TCJA 1VQ6Q 1B34A 3RESA 3GP8A 3V7RA 1VQNQ 2ZPBB 3SWNA 2K5FA 2M51A 3NPFA 3FEOA 2X35A 3UWNA 3OYCA 2DBKA 4M75F 2QAZA 2QDLA 2RN8A 5CKBA 1OU8A 2HKNA 1WI7A 1OEBA 4AFQC 2OTJA 3MEUA 4GLMA 1YIJQ 3META 3RMSA 3H8ZA 1S72T 2DXCA 1YNZA 3N5BB 3QDRB 1WXUA 1BIAA 1AWJA 1NLPC 1R0BG 5GAOn 1YCSB 3CCRQ 5KCOA 2LP5A 3QG1A 2R57A 3OSSC 1B7TA 4F14A 1KQSP 3CCQA 1VQ9T 2OAWA 1M90C 1RUWA 1BK2A 2OTJQ 2CP0A 3A8MB 3JCMX 5ECAA 3OW2P 4E7IA 2ROLA 3AHUA 4JLGA 2XI9A 4HCBA 1VQ5T 3RDVA 3OYBA 5IHIA 3EH1A 1HXDA 5KH6A 3UF4A 5CVIA 3SHWA 2ECZA 3G6ET 1ABQA 2F5TX 2SEMA 3PMTA 4C8QF 5GMKe 1UGVA 1VQMA 4RCCA 2XMFA 2E12A 2JM8A 2YUOA 1YWOA 3A5ZB 1ZBJA 5LJ3h 3QDFA 1VQ8Q 3ZL7C 2ZPEB 1ZX6A 3ER0A 3RIRA 2CZ0B 4QVDA 3JB9I 1KHCA 2EKOA 3SDZA 1PG5B 1H92A 1ZLMA 1SKUB 2M02A 3QYHB 1VYVA 4OB1B 3CXCP 2Z0WA 4QVZA 2NYSA 2E64A 1GXIE 3VS0A 3HRUA 3OY9A 4LUDA 4CC7A 1HD3A 2EYXA 3JSCA 4B9XA 4UC4A 2XKOC 1MNEA 2RQUA 3C95A 3UA6A 3JCMJ 4PJOF 2KDSA 2EYQA 4DBRA 3QO3A 2QEXT 2EQUA 1RAAB 3LW5E 3R6NA 4FL6A 2QQAA 1K73R 2BZXA 3VS2A 3G6EA 1M1KU 3E9FA 2CP6A 2P4RA 3HP9A 4HXJA 3BDLA 1IHVA 1YITQ 1RLQC 3CMEQ 3C0CA 2E6ZA 3DLMA 2FL7A 1YJ9A 3CXCA 3VS6A 5LJ3j 2M0YA 4D8KA 2DL5A 3CCVT 2OJ2A 2H3EB 4Z89A 1VQMQ 1I07A 4XTXA 3VJPA 2MYSA 2DVEA 3A8LB 1M3AA 1YHQA 2IPOB 2JN0A 2RI3A 1O75A 3HKSA 1RAEB 4M75A 1UJ0A 4LDYA 3SD4A 4PJOG 2X3XD 1ZUKA 2D9TA 2XDPA 3GNFB 4KBMB 3CCJT 2EJFA 1VQ6A 3EGXB 4V2SA 1YJ9Q 2DE0X 4JRPA 3WVEB 3I5SA 4C92A 4FYVB 1F1BB 1ACMB 2QA4A 1C6VX 1RACB 4EMKA 1GL5A 1YP5A 2CSQA 4RG2A 4RTTA 1VYUA 3PVLA 4FYYB 2JOYA 1I5LA 1YJWQ 5FRNA 1QKWA 5GAMg 2CREA 3RERA 3JCMP 5CIUA 1EX4A 1VQPA 4JS5A 1AVZC 1KG1A 1ZSZB 4M78C 2E70A 1VQ8T 1Q82U 1XNIA 3DB3A 4JUVA 3VS3A 1AZGB 2QA4T 4JJCA 1D0XA 3TEEA 2DRKA 3CCLT 1WXBA 2EYYA 4C92B 3Q1JA 3A98A 1Q7YR 2KAFA 1JJ2S 3QJ6A 4PJOA 2JJ9A 1QCOA 3FJ5A 2MWOA 2MIOA 1VQ4Q 1FMWA 4N4GA 2AT1B 3UPUA 1QVGA 4YTLA 3JB9D 4MDWA 3EG2A 2COWA 5L23A 1QCNA 2XG8D 5C0MA 2YSQA 5KYWA 3UT1A 3GIBA 1YN8A 3P8HA 4C8QD 2QA4Q 2WSFE 1CKBA 3CC2Q 4LD6A 3CD6A 1PHTA 2KYBA 1WHMA 4E7LA 3OA6A 3E2UA 3L42A 4Y91A 3JCMe 1YI2A 3MJXA 4RG8A 4AT1B 4B9WA 2CUDA 2GCXA 1M1GA 2KMTA 2J05A 3FLGA 1YFNA 1PSEA 2VXFA 5CKFA 2KNBB 1P92A 1VQ9Q 1G3YA 1WDXA 1NG2A 4IUQA 1AOJA 3HL8A 2QQSA 1ABOA 2LQNA 4C8QA 1MMAA 1OX8A 2VXEA 1QWEA 1YHQT 1W70A 4M77C 4DEXA 3JCMQ 4ANJA 1BI1A 4K11A 2DO3A 4IIOA 4C0GA 2KROA 4DBFA 4CRIA 3CCRA 4KGVB 2R58A 2KK4A 5GJVB 1YJ9T 2HMAA 3GBQA 4N0AA 1M3BA 4OP0A 2LMJA 1KFZA 3MEWA 2F1LA 1WJSA 2QG9B 5GAN3 1X27A 2CZ7B 3PT9A 3QHSA 2FB7A 2K2MA 4CC4B 1ZHIA 3EFOB 1VQLT 2L89A 3V8LA 2M9UA 4PL6A 3URGA 1GBQA 1UEBA 1B34B 3OYDA 1I4K1 5HK0A 1W2BS 3CMAT 2DL3A 2ZAEA 2K4YA 1VQPT 4BE0A 2VGNA 1Y07A 3CCJA 1KC8C 2PZ1A 2JMAA 1VQNT 3JB9G 1IHWA 2QTVA 2LJ1A 2DTOA 4J6XA 2DERA 2EIFA 4PFPA 3GOXA 4VUBA 1SRLA 4IUUA 3NGPA 2OX7A 3OW2A 1Q82R 4C5GA 1VQOQ 2ED0A 5DLQE 3LH5A 4OMFB 2ESWA 4RCBA 2HL3A 4HVUA 4CC2A 4QQGA 1U06A 4JJBA 4JLIA 4MMLA 4E7KA 1Y7XA 1BB9A 1WJRA 2LNHB 1VQ7A 1Y96A 4LE9A 4Y92A 1VQ4T 2RQRA 4PJOE 2CDTA 2F69A 2HSEB 3I55Q 2RHUA 1X2KA 3JB9F 1VQ9A 2HL5C 1BCMA 3EG0A 3G4SQ 2J7IA 1H8KA 2RH2A 1U5SA 4DOWA 1OX9A 4M78D 2JW4A 3QUIA 2CS7A 5FU6B 1KC8R 2PU9B 3E9GA 5I11A 4NL2A 2P0PA 3OS0A 1G8XA 4OGEA 3CC2A 1X6OA 1RI9A 1IGUA 5GAMh 3SFMA 2ABLA 3NTHA 1SEMA 5LJ5g 2GQVA 1YJNT 4F16A 3UA7A 4F7UB 4BD3A 3EAEA 2BUDA 4XTUA 2E1HA 4J9BA 4GBQA 1NJIR 1PD1A 5GMKj 1K9MR 3RR6A 2O9SA 2RJDA 2FPEA 2PUOB 4IUTA 8AT1B 4WTOB 4M7AA 1AD5A 2EYWA 4QT7A 1KJWA 4II1A 4XAXB 1FWZA 4P5NA 2J6OA 4RTWA 4J9HA 1X43A 3L1AA 1WIEA 1WLPB 3M0PA 4ZN3A 1M1KR 2DXTA 1FMVA 3JCMd 3TQ7P 3RUXA 2XICA 3I35A 2FO0A 2MK5A 1FMKA 2RD1A 4BDYA 1W2BP 1Q86R 4PLLA 1YJWT 2LT4A 2O2OA 1N8RR 1O9SA 3S3MA 2XDBA 2DPPB 1QLYA 3MP8A 4ZGEB 1OOTA 3LWHA 1AWOA 4E2FB 2YDLA 1M3CA 4MZPA 3AT1B 4KGXB 3OYKA 4X9CA 3X24B 1NLOC 2YWWA 4PJMA 1LOJA 1QVGP 1RABB 2H3JA 1M9SA 1AZEA 4JPBW 1B3QA 3FRNA 4IIMA 1NPRA 2PQWA 3EG9B 4E6RA 5GAMj 1S1NA 1LNXA 1AWWA 1H3ZA 2RF0A 2X51A 1D3BB 3PMIA 4PLIA 1C1AA 2K6DA 1J3TA 1OV3A 3G4ST 4LDUA 1VQOT 2JXBA 1V76A 3CXCS 2DETA 1NPPA 3CPFA 2EJ9A 2DEQA 4BE2A 3CD6Q 2DEUA 1WHHA 1UGQB 2LQ8A 5GAOp 3X28B 5FRMA 2RHYA 2J6KA 4FT4A 2DK3A 4QQ6A 1V1CA 5IHNA 3F70A 1Q86U 4ORZA 4M78F 1TSFA 3ZFJA 5FLXE 3CCLQ 3QYGB 2B8AA 2KRMA 1UHFA 2LZ6B 3L2QA 3P8DA 4AFSC 2YRDA 4BDZA 3OMCA 3O5ZA 1VYTA 3ME9A 3EGUA 1KD1C 2DA9A 4AFUC 5KYXA 1VQ7Q 2ZGWA 4DBQA 2KT1A 1QVGS 2V8IA 1RI0A 5LJ3g 3LGLA 3M4GA 1RLPC 2EGCA 5GAOr 2HNIA 4XQ3A 2HSPA 1KQ2A 1FX7A 3P8BB 4MZMA 1KQ1A 1XQHA 2CP3A 2RNAA 4HVVA 3GLXA 4FYWB 5FWBA 2V1QA 3QZ5B 5GAN8 2HKQB 2CGHA 2E4HA 1KC8U 2AK5A 4ME7A 1K8AC 3VRYA 2P4TA 3J7AF 4RTZA 3THKA 2K2VA 2L5QA 4Q5WA 1U8RA 1M2OA 1SHFA 2KT8A 4M78E 5HCKA 1VQKQ 3L2WA 4QW2A 1WA7A 1RAHB 4X34A 2CP2A 2FEIA 2RMOA 1YIJT 1NYFA 1N8RC 2DM1A 4RTUA 2OTLQ 3JCMc 3CCUT 1M2VA 1Q7YU 2VB6A 2HQEA 2BIVA 3VYHB 3EGDB 4KUDK 5GMKi 2NUTA 2KXDA 2X4XA 4EPCA 1W2BA 4FSSA 2DD5A 1T3LA 4E47A 3OQ5A 1B07A 2P0QA 4E7ZA 1WQ7A 1KQSS 5GANe 2O88A 1GFCA 2DIQA 5GMKm 1EIFA 2RJFA 5KE2A 2YLCA 3C12A 1HYOA 2LC4A 1KK7A 1GFDA 1KD1U 4F7UA 2CP5A 2A7YA 1AWXA 3J81E 1R0CB 3LYIA 3VUZA 5GAOm 4PJJA 1Q81U 4A4FA 4X1VA 5EC7A 2DXUA 1YWPA 3CCSQ 3QZ9B 4IURA 3OS5A 4OMNA 1D1BA 2EVRA 1WHGA 1IZ6A 3CBOA 5CR2A 2KRNA 3EFSA 1ZSZC 5LJ5h 2LTOA 3CC4A 2CSIA 3S6WA 1OZ2A 1MNDA 2R5MA 4C0ZA 2PVOB 4XU3A 3JCMf 4Z88A 3A8HB 1C0MA 4C92C 4C8QC 4X9DA 2QEXA 4J9CA 2F5KA 4QVCA 1M4ZA 3GF5A 3MHXA 5LJ3d 1G83A 1MMDA 4M77G 4BI8B 5I2SA 1Z9QA 2KSSA 2A28A 1VQLA 1NBEB 4HCZA 5IN1A 3G71A 3HRTA 1GRIA 4EDUA 4JJDA 5AYFA 3JB9H 5LL6S 2PTKA 2EGEA 3UDCA 1Q95G 1VA7A 3KUFA 1VQLQ 4ELZC 1OZ3A 1WHKA 3FIFA 5J26A 4F7UE 3JCMh 1LPLA 1NYGA 2PVGB 4JJNK 3I56T 5GAMe 5GMKh 4OVAA 2V1RA 4PK4A 2NLUA 3RKWA 2HBWA 3OYGA 4F04B 4RKUE 1K1ZA 2D8JA 1VQ4A 2QI2A 1KHIA 3T9NA 4BI4A 2CH4A 2QGGA 5A0GA 2DAQA 2EJGA 2K5IA 3GNGA 2WACA 2F2VA 5M9OA 1QP3A 4OMLA 2LJ0A 1QW1A 1VIFA 4MMKA 2M16A 3M0RA 1NZ9A 1YI2T 3M5AA 2NUPB 4Y28E 3BFMA 3EHQA 2KEAA 3QSUA 1UJYA 4C0FA 1JJ2A 2JMCA 2DRMA 3MEVA 4KRTA 2MOXA 5LJ5d 1R77A 2DMOA 3CCST 3QPHA 2A08A 4PJOB 1YITA 2A37A 2EBPA 3CMAQ 1TOVA 2QQRA 3M56A 3FB9A 1JEGA 2DILA 3EG1A 1BIBA 4D6WA 2Y90A 5GANf 1R8OB 2JZ2A 4M7AD 3CCUQ 1SF9A 1W1FA 3CQTA 1IXDA 5A0LA 4LDWA 1UB4A 1SSFA 3OBWA 2Y4XA 3CBMA 2K9GA 5J3BA 3OYYA 4C8QB 4KGZB 2LRQA 1JBMA 4KUIA 3CCUA 5GAMf 4M7DD 1PC0A 3HFOA 4PFOA 2DJZA 4BUGA 4M7AF 2DZCA 4E7JA 4WF2A 1ZQ1A 1TU0B 2GBQA 1K9AA 2D0NA 1D09B 1Q86C 3S3OA 4NL3A 4RUGA 4EMHA 3KXTA 2RB6A 2DX1A 2O4XB 3CMEA 2ENMA 1WX6A 1NEBA 4M7AB 3C94A 3EFOA 4OGCA 2C0IA 3M0SA 5CCAA 1JO8A 2C0TA 1M90R 1X75C 1I0CA 3QKJA 1MMNA 4DBHA 3CPWS 2V8KA 2F2XA 3DKMA 1YHQQ 5L8RE 2XD0A 3PGGA 1OI1A 2DF6A 2D6FA 1E6GA 1K73U 2K79A 4M7AG 1TG0A 3M9QA 3PFSA 2I2LA 5GMKl 4BE1A 5GAN2 3GPLA 3CCVA 2K3XA 1QCFA 4DOVA 2P0KA 2GTOA 2LJ3A 5D6YA 2KVQG 4OMMA 1IREB 1MV0B 2FG0A 3OYAA 1N9RA 1SHGA 2DL7A 2GFAA 1JXMA 3NMZC
chains in the Genus database with same CATH topology
3CPWP 3CCMQ 2QA4Q 3I56Q 1YITQ 1VQ9Q 3CMEQ 1M90R 3CC2Q 1VQ6Q 1VQPQ 3CCLQ 3CC4Q 3CMAQ 1Q82R 1QVGP 1KC8R 1QVFP 3CCVQ 1YJNQ 1NJIR 3CXCP 1VQ4Q 1VQNQ 1W2BP 3G71Q 1YHQQ 1VQLQ 1Q86R 1VQOQ 1K9MR 3CCRQ 1N8RR 1Q81R 1KD1R 3I55Q 3CCQQ 3CD6Q 1VQKQ 1KQSP 3CCJQ 1S72Q 3CCUQ 1VQ8Q 1VQ5Q 1YI2Q 1VQMQ 1YJWQ 1K73R 1JJ2P 1YJ9Q 3CCEQ 3G4SQ 3CC7Q 2OTJQ 1VQ7Q 1K8AR 2OTLQ 3G6EQ 1YIJQ 2QEXQ 3OW2P 1M1KR 1Q7YR 3CCSQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPW P;  3CCM Q;  2QA4 Q;  3I56 Q;  1YIT Q;  1VQ9 Q;  3CME Q;  1M90 R;  3CC2 Q;  1VQ6 Q;  1VQP Q;  3CCL Q;  3CC4 Q;  3CMA Q;  1Q82 R;  1QVG P;  1KC8 R;  1QVF P;  3CCV Q;  1YJN Q;  1NJI R;  3CXC P;  1VQ4 Q;  1VQN Q;  1W2B P;  3G71 Q;  1YHQ Q;  1VQL Q;  1Q86 R;  1VQO Q;  1K9M R;  3CCR Q;  1N8R R;  1Q81 R;  1KD1 R;  3I55 Q;  3CCQ Q;  3CD6 Q;  1VQK Q;  1KQS P;  3CCJ Q;  1S72 Q;  3CCU Q;  1VQ8 Q;  1VQ5 Q;  1YI2 Q;  1VQM Q;  1YJW Q;  1K73 R;  1JJ2 P;  1YJ9 Q;  3CCE Q;  3G4S Q;  3CC7 Q;  2OTJ Q;  1VQ7 Q;  1K8A R;  2OTL Q;  3G6E Q;  1YIJ Q;  2QEX Q;  3OW2 P;  1M1K R;  1Q7Y R;  3CCS Q; 
#chains in the Genus database with same CATH topology
 2X3W D;  4NOY A;  1VQP Q;  1UDL A;  2RJC A;  1RAG B;  4A53 A;  4C5H A;  4HT8 A;  2W0Z A;  3OYE A;  4M75 D;  3G4S A;  2D8H A;  4C0D C;  1KD1 R;  1E6H A;  2RI2 A;  4EIK A;  2FZG B;  5IT9 E;  2DJQ A;  3I56 A;  9ATC B;  3VKI A;  3OS2 A;  3OYJ A;  2ZPI B;  2EKH A;  4NS5 A;  3WXM B;  3TSZ A;  3SEM A;  2C0O A;  2XU8 A;  2KYM A;  5FRO A;  5FU7 C;  3PIP A;  1M8V A;  4PFZ A;  4IUV A;  2ZCF B;  2A0F B;  2E3I A;  4XTY A;  2LNV A;  2LCL A;  1QKX A;  1QWF A;  2YHT A;  3M58 A;  4C92 D;  2JT4 A;  3CCL A;  7AT1 B;  1PKT A;  1BU1 A;  3ULR B;  1GCQ A;  5IXB A;  1N5Z A;  1NEG A;  1E7O A;  4O6J A;  4CI0 C;  2RO0 A;  1HSQ A;  1TTH B;  2DBM A;  2ZPG B;  2J6F A;  1I81 A;  3PVQ A;  3I56 Q;  4A63 B;  2HBP A;  2NUP A;  3TU4 K;  1QVF A;  2CT4 A;  5IXF A;  1WPY A;  2VWF A;  2RHX A;  3JCM g;  2JTM A;  5A0D A;  4JZ4 A;  1VQ6 T;  1IRX A;  4HVW A;  5CAI A;  1Y71 A;  5FW9 A;  4E7S A;  1AT1 B;  3MEA A;  4M77 D;  3EG3 A;  3KFV A;  1AHJ B;  2JS0 A;  3M0T A;  1HJD A;  2VUB A;  2AZV A;  1KSW A;  3CCE A;  1PRM C;  3A8O B;  2FYK A;  5CK9 A;  3HPW A;  4AMC A;  2COY A;  3OMG A;  4Z02 A;  4Z8A A;  1NM7 A;  3X20 B;  1KQS A;  1WZO A;  2X9H A;  1N8R U;  2JNG A;  2M1H A;  1VOM A;  3MO8 A;  2DIG A;  2XID A;  1SG5 A;  3CCQ Q;  1K9M C;  2DYI A;  3JV3 A;  1VQ7 T;  4J9E A;  2VYT A;  4LXC A;  3CCE Q;  2FVU A;  1BCO A;  4B6M A;  2DFU A;  1K8A U;  2FPF A;  5KCH A;  1Q82 C;  1GCP A;  2K7A A;  3OBY A;  2HZY A;  3M53 A;  1PNJ A;  5GAO l;  2G6F X;  4PKC C;  2V8J A;  2MPX C;  2MI6 A;  2GTJ A;  4XU2 A;  2EFI A;  1HK9 A;  1T0H A;  5KYX B;  2CP7 A;  4RTV A;  1K76 A;  6AT1 B;  3RKX A;  5DLO A;  2YRV A;  2K57 A;  4ZGD B;  1BKB A;  1FYN A;  3OB9 A;  4M4Z A;  1TUG B;  4IUP A;  3VYG A;  3PTA A;  3OYF A;  4D8D A;  1D1C A;  5A2Q E;  3HFN A;  4C5I A;  1BYM A;  2JM9 A;  5GAN 6;  4J8O A;  3KBG A;  4E7H A;  4XTZ A;  2DL8 A;  3J80 E;  2VC8 A;  3I55 T;  2EQJ A;  2W10 A;  1M5Q 1;  2A36 A;  2KXC A;  5CKH A;  2BZY A;  3JRZ A;  2RQW A;  4J83 A;  1UGP B;  2DLP A;  3MP6 A;  3LX7 A;  1UHC A;  4FW2 A;  2L3S A;  3VUB A;  2L2P A;  3H0I A;  3L2V A;  1X01 A;  2AKK A;  3ZBD A;  3NFC A;  4LDX A;  3SWN B;  2E41 A;  2K3B A;  1M1K C;  1WQW A;  1AEY A;  3OYN A;  4F17 A;  1Q81 R;  3M59 A;  4AG2 C;  3RKY A;  3M54 A;  3INZ A;  3V8K A;  1MHN A;  2PVD B;  2DKG A;  2EQM A;  1UEC A;  2NWM A;  3M0Q A;  2AKL A;  4M77 B;  5LJ3 e;  4A4G A;  1V29 B;  1X2Q A;  1RAF B;  2RK1 A;  3CC4 T;  1PKS A;  2DYB A;  4LN2 A;  1VQK T;  5FU7 B;  2IIM A;  2D0Q B;  2DTH A;  2ED1 A;  5GJW B;  2QXF A;  2X4W A;  2XK0 A;  4N4H A;  2E5Q A;  2DXB A;  3FC3 A;  2L8D A;  4BAC A;  4ESR A;  2P84 A;  4XTV A;  4M7D F;  1BBZ A;  4M7A E;  1IGQ A;  5CKE A;  4C0D B;  1WHL A;  1WHJ A;  4OMP A;  1VQM T;  1XOV A;  4J7F A;  2FRW A;  2VAS A;  2VKN A;  4J7I A;  2HDA A;  4EMK B;  5KE3 A;  2EW3 A;  1XJW B;  3CC2 T;  1RL2 A;  1X6B A;  2E6N A;  4M7D C;  2KI7 A;  3VS5 A;  4R56 A;  2CYZ B;  5FU6 C;  1M90 U;  2RK2 A;  1ZSG A;  2K3Y A;  2GQI A;  1BI0 A;  5IAY A;  4ZN1 A;  1OQK A;  2YUQ A;  2OI3 A;  3CD6 T;  4AFZ C;  5GAN g;  2NUT B;  3JCM b;  2G3R A;  2MMP A;  1QQJ A;  4WCI A;  3QII A;  1QP2 A;  3CCV Q;  2FRY A;  5GAN d;  4M7A C;  3DB4 A;  1MV3 A;  2GF7 A;  2KQW A;  4M7D G;  1FXX A;  3FDR A;  1BI3 A;  2RA2 A;  5LJ5 j;  3LWI A;  4ZNX A;  4JRK A;  3CC7 A;  2QDY B;  2QEX Q;  2EWN A;  4N0A C;  1VIE A;  2HCK A;  1G3T A;  3H0F A;  3MPU B;  3LGF A;  2EAY A;  1VQ8 A;  3EGD A;  3TSW A;  5KYY A;  5GAN j;  2ZPH B;  3VS4 A;  4LUE A;  1K8A R;  4F7U F;  1K0S A;  2O9V A;  5D7U A;  2K5L A;  2KGT A;  2LX9 A;  2RI5 A;  2MF2 A;  3CBP A;  1M1F A;  2DNU A;  1T0J A;  2YUN A;  3L2U A;  3VS1 A;  4R55 A;  2CKK A;  3CMA A;  1ZUY A;  2YRC A;  3CCJ Q;  2BE9 B;  5I22 A;  2RJE A;  2CT3 A;  2Y4Y A;  2O01 E;  4FT2 A;  4GLK A;  5HK3 A;  2SRC A;  1PCX A;  2QAS A;  1UTI A;  4BY6 C;  2LT1 A;  4JZ3 A;  5KYN A;  1WFW A;  2B86 A;  4ZTJ A;  4ZTF A;  2EGA A;  2I0N A;  3CC7 T;  2EQI A;  1M27 C;  1MMG A;  2KY9 A;  2OAU A;  3LLR A;  2CH4 W;  1NE8 A;  8ATC B;  4PNO A;  3PNW C;  4LD9 K;  2LQW A;  3QWY A;  3CCR T;  2GNC A;  1TWB A;  5GAO q;  2RPN A;  3C4S A;  1PRL C;  4OB2 B;  1GCQ C;  2RHI A;  3MP1 A;  3RNJ A;  2WSE E;  3A1P A;  1N6A A;  4OB3 B;  1QVF S;  2D1X A;  4FW1 A;  4M78 A;  3CEY A;  2RHZ A;  1UGR B;  2KBT A;  2O4X A;  1VQ5 Q;  4R0K A;  2C06 A;  2PNI A;  4TVR A;  4JDS A;  4L6V 5;  3TRE A;  1KIK A;  2AZS A;  4EMG A;  3REB B;  3CPW P;  5KYU A;  1CKA A;  1U3O A;  2ROT A;  2KR3 A;  2DTI A;  5KYY B;  1EZZ B;  3CCS A;  1WGS A;  3BY7 A;  1H64 1;  4QQD A;  1BI2 A;  1WJQ A;  5IHK A;  4N4I A;  3S3N A;  2HAX A;  4M77 F;  3E1S A;  3V8J A;  2XDD A;  2BZ8 A;  1VQO A;  4XK8 E;  2LDM A;  2VV5 A;  3MKD A;  2MCN A;  2JS2 A;  2L3R A;  4M78 G;  1VQK A;  4XTW A;  1SPK A;  3R6O A;  2YLB A;  2VGM A;  1UGS B;  5GAN h;  3UAT A;  1IB8 A;  2RQT A;  4M77 A;  2HQH A;  3OYL A;  4LNP A;  3OYH A;  1MUZ A;  4C92 F;  3CCM A;  1W4S A;  2CZ1 B;  2EQK A;  3EGX A;  2YT6 A;  1PWT A;  1ZSZ A;  3CME T;  4M75 C;  4M78 B;  2LCC A;  2X4J A;  5CKD A;  3CC4 Q;  3SB2 A;  1QVF P;  2DL4 A;  1RAI B;  3L2Z A;  2LVM A;  3O8V A;  4ZGJ B;  2HQX A;  4XU0 A;  1D3B A;  2J06 A;  4JS4 A;  1CSK A;  4XU1 A;  1UFF A;  5KYU B;  3CC7 Q;  3HSB A;  1VQ5 A;  3BDU A;  4A54 A;  4HCK A;  2VVK A;  4J9F A;  1ZBX A;  2MAM A;  5IH2 A;  3JAM E;  3MCA B;  2BTT A;  3G71 T;  2MWP A;  4FSX A;  2DZ9 A;  4FIB A;  4OMO A;  4M75 E;  1OPK A;  3REA B;  1D1A A;  2EPD A;  2FHD A;  2JTF A;  4M75 B;  4KUL A;  4PJO C;  2F2W A;  2ZPF B;  5GAN 5;  1OYX A;  1S72 A;  3EH2 A;  2NUZ A;  2A3L A;  2JTE A;  3QXE B;  2FZC B;  2IG0 A;  5CQY A;  3PIO A;  3M4Y A;  2QQB A;  3H9N A;  4C8Q E;  2E5K A;  1TUC A;  1I8F A;  5J39 A;  4MDX A;  3JCM V;  2JUF A;  3M57 A;  4L59 A;  4OF1 A;  1JJ2 P;  2FPD A;  5KYW B;  1A0N B;  4J9G A;  4A4H A;  3CCM Q;  4KH0 B;  3G7Z A;  2WSC E;  2EYZ A;  2QYZ A;  2LX7 A;  5FWC A;  1IO6 A;  3CCE T;  3WVD B;  2COZ A;  4RTX A;  4HKE A;  4EMK C;  1VQN A;  3LH0 A;  4J6Y A;  5HKC A;  2YXY A;  1GBR A;  1JU5 C;  4F7U G;  4QKU A;  2XHC A;  5CQX A;  3NTK A;  4OB0 B;  5DM7 R;  3G71 Q;  3NHN A;  2LQK A;  1UG1 A;  1Q7Y C;  3H6Z A;  4J5Y A;  1JQQ A;  2QK0 A;  4ATO A;  4BY6 B;  2L0A A;  3FJP A;  1NJI C;  2KE9 A;  3DLL A;  5EG2 A;  5CO7 A;  2QTX A;  3CCM T;  4DQ2 A;  1K0X A;  4PJN A;  1ZA1 B;  4C8Q G;  1MGQ A;  1G2B A;  2BKD N;  2V26 A;  4RMO A;  2H8H A;  2L3Q A;  5LJ5 f;  1ZUU A;  4IKF A;  1I1J A;  3SWN C;  1TUD A;  1K4U S;  4BB7 A;  1YI2 Q;  4C92 G;  5GAM d;  2GGR A;  1G5V A;  2M0O A;  3X25 B;  1K73 C;  1N27 A;  3D7S B;  4CC3 A;  2FZK B;  4OMQ A;  3VS7 A;  1YJN Q;  1LCK A;  4J6W A;  4ELY C;  2YUP A;  4J9I A;  1H3H A;  3V7C A;  2E3H A;  1UE9 A;  2CUB A;  1M30 A;  2AHJ B;  3VV0 A;  2KRS A;  3OYI A;  1Q81 C;  1G3W A;  5GAN 7;  3ASK A;  3U23 A;  5HY6 A;  1OU9 A;  1QMC A;  2HEQ A;  1T3S A;  4L5G A;  3TVT A;  3CCQ T;  2GFU A;  4KH1 B;  1PM3 A;  2CZ6 B;  3G1J A;  4FU6 A;  3JCM W;  1TH7 A;  4DA4 A;  1Y57 A;  4DEY A;  1OUL A;  2QQ9 A;  3H0H A;  3VRZ A;  3OW2 S;  3BE3 A;  1U1T A;  1YBY A;  3I9Q A;  3ZEH A;  3V7S A;  2OTJ T;  3NTI A;  4PJO D;  3QWX X;  4O5V A;  4HA8 A;  4A4E A;  5GAN 4;  2DD4 A;  5I2M A;  1ARK A;  1LJO A;  2QGF B;  4GY5 A;  1U1S A;  1YIJ A;  1OPL A;  1RAD B;  2O31 A;  4JRI A;  1WYX A;  4FCY A;  3RMQ A;  1S72 Q;  2ZZD A;  3H41 A;  4C92 E;  4M7D B;  5C6S A;  5LJ5 e;  1D0Y A;  2DVJ A;  2AIR B;  2RM4 A;  4J9D A;  1JB0 E;  4KT0 E;  2RQV A;  5D6X A;  5AT1 B;  2ATC B;  5D6W A;  1TS9 A;  4JRQ A;  3L2R A;  4M7D E;  1K9M U;  1TXQ A;  1Y0M A;  4RTY A;  1XTD A;  2OTL A;  3BW1 A;  4LDV A;  1NJI U;  2X4Y A;  1VUB A;  2IVW A;  1M2V B;  3E19 A;  3HTR A;  3EG9 A;  1D0Z A;  1ZA2 B;  4M77 E;  1UUE A;  3RBB B;  1JXO A;  4C5E A;  3G6E Q;  1X6G A;  1I5O B;  4MZT A;  4AG1 C;  1W6X A;  3CPW A;  3HRS A;  3OS1 A;  3I5R A;  1PD0 A;  4FYX B;  1Z9Z A;  3EFR A;  3IQL A;  2LCS A;  3EHR A;  2E65 A;  2BE7 D;  4FM4 B;  3OYM A;  2JVV A;  1EFN A;  1DJ7 B;  3PE0 A;  3VU3 C;  2E10 A;  4HT9 A;  1PSF A;  3QJY A;  5LJ3 f;  4M75 G;  2R5A A;  1YJN A;  1YJW A;  1WNL A;  1YCY A;  4M7D A;  4HCC A;  3M55 A;  3JB9 J;  3M0U A;  1QVP A;  1YIT T;  5DY9 A;  3I55 A;  3QBY A;  1WXT A;  4PJL A;  4A4K A;  1Y96 B;  3HHT B;  3X26 B;  1LVK A;  5I21 A;  2OTL T;  3OSV A;  1M8M A;  3A8G B;  1SSH A;  1X69 A;  1G3S A;  2PUK B;  1JRI A;  2HD0 A;  1SRM A;  2L3P A;  1N9S A;  4BI3 A;  3TCJ A;  1VQ6 Q;  1B34 A;  3RES A;  3GP8 A;  3V7R A;  1VQN Q;  2ZPB B;  3SWN A;  2K5F A;  2M51 A;  3NPF A;  3FEO A;  2X35 A;  3UWN A;  3OYC A;  2DBK A;  4M75 F;  2QAZ A;  2QDL A;  2RN8 A;  5CKB A;  1OU8 A;  2HKN A;  1WI7 A;  1OEB A;  4AFQ C;  2OTJ A;  3MEU A;  4GLM A;  1YIJ Q;  3MET A;  3RMS A;  3H8Z A;  1S72 T;  2DXC A;  1YNZ A;  3N5B B;  3QDR B;  1WXU A;  1BIA A;  1AWJ A;  1NLP C;  1R0B G;  5GAO n;  1YCS B;  3CCR Q;  5KCO A;  2LP5 A;  3QG1 A;  2R57 A;  3OSS C;  1B7T A;  4F14 A;  1KQS P;  3CCQ A;  1VQ9 T;  2OAW A;  1M90 C;  1RUW A;  1BK2 A;  2OTJ Q;  2CP0 A;  3A8M B;  3JCM X;  5ECA A;  3OW2 P;  4E7I A;  2ROL A;  3AHU A;  4JLG A;  2XI9 A;  4HCB A;  1VQ5 T;  3RDV A;  3OYB A;  5IHI A;  3EH1 A;  1HXD A;  5KH6 A;  3UF4 A;  5CVI A;  3SHW A;  2ECZ A;  3G6E T;  1ABQ A;  2F5T X;  2SEM A;  3PMT A;  4C8Q F;  5GMK e;  1UGV A;  1VQM A;  4RCC A;  2XMF A;  2E12 A;  2JM8 A;  2YUO A;  1YWO A;  3A5Z B;  1ZBJ A;  5LJ3 h;  3QDF A;  1VQ8 Q;  3ZL7 C;  2ZPE B;  1ZX6 A;  3ER0 A;  3RIR A;  2CZ0 B;  4QVD A;  3JB9 I;  1KHC A;  2EKO A;  3SDZ A;  1PG5 B;  1H92 A;  1ZLM A;  1SKU B;  2M02 A;  3QYH B;  1VYV A;  4OB1 B;  3CXC P;  2Z0W A;  4QVZ A;  2NYS A;  2E64 A;  1GXI E;  3VS0 A;  3HRU A;  3OY9 A;  4LUD A;  4CC7 A;  1HD3 A;  2EYX A;  3JSC A;  4B9X A;  4UC4 A;  2XKO C;  1MNE A;  2RQU A;  3C95 A;  3UA6 A;  3JCM J;  4PJO F;  2KDS A;  2EYQ A;  4DBR A;  3QO3 A;  2QEX T;  2EQU A;  1RAA B;  3LW5 E;  3R6N A;  4FL6 A;  2QQA A;  1K73 R;  2BZX A;  3VS2 A;  3G6E A;  1M1K U;  3E9F A;  2CP6 A;  2P4R A;  3HP9 A;  4HXJ A;  3BDL A;  1IHV A;  1YIT Q;  1RLQ C;  3CME Q;  3C0C A;  2E6Z A;  3DLM A;  2FL7 A;  1YJ9 A;  3CXC A;  3VS6 A;  5LJ3 j;  2M0Y A;  4D8K A;  2DL5 A;  3CCV T;  2OJ2 A;  2H3E B;  4Z89 A;  1VQM Q;  1I07 A;  4XTX A;  3VJP A;  2MYS A;  2DVE A;  3A8L B;  1M3A A;  1YHQ A;  2IPO B;  2JN0 A;  2RI3 A;  1O75 A;  3HKS A;  1RAE B;  4M75 A;  1UJ0 A;  4LDY A;  3SD4 A;  4PJO G;  2X3X D;  1ZUK A;  2D9T A;  2XDP A;  3GNF B;  4KBM B;  3CCJ T;  2EJF A;  1VQ6 A;  3EGX B;  4V2S A;  1YJ9 Q;  2DE0 X;  4JRP A;  3WVE B;  3I5S A;  4C92 A;  4FYV B;  1F1B B;  1ACM B;  2QA4 A;  1C6V X;  1RAC B;  4EMK A;  1GL5 A;  1YP5 A;  2CSQ A;  4RG2 A;  4RTT A;  1VYU A;  3PVL A;  4FYY B;  2JOY A;  1I5L A;  1YJW Q;  5FRN A;  1QKW A;  5GAM g;  2CRE A;  3RER A;  3JCM P;  5CIU A;  1EX4 A;  1VQP A;  4JS5 A;  1AVZ C;  1KG1 A;  1ZSZ B;  4M78 C;  2E70 A;  1VQ8 T;  1Q82 U;  1XNI A;  3DB3 A;  4JUV A;  3VS3 A;  1AZG B;  2QA4 T;  4JJC A;  1D0X A;  3TEE A;  2DRK A;  3CCL T;  1WXB A;  2EYY A;  4C92 B;  3Q1J A;  3A98 A;  1Q7Y R;  2KAF A;  1JJ2 S;  3QJ6 A;  4PJO A;  2JJ9 A;  1QCO A;  3FJ5 A;  2MWO A;  2MIO A;  1VQ4 Q;  1FMW A;  4N4G A;  2AT1 B;  3UPU A;  1QVG A;  4YTL A;  3JB9 D;  4MDW A;  3EG2 A;  2COW A;  5L23 A;  1QCN A;  2XG8 D;  5C0M A;  2YSQ A;  5KYW A;  3UT1 A;  3GIB A;  1YN8 A;  3P8H A;  4C8Q D;  2QA4 Q;  2WSF E;  1CKB A;  3CC2 Q;  4LD6 A;  3CD6 A;  1PHT A;  2KYB A;  1WHM A;  4E7L A;  3OA6 A;  3E2U A;  3L42 A;  4Y91 A;  3JCM e;  1YI2 A;  3MJX A;  4RG8 A;  4AT1 B;  4B9W A;  2CUD A;  2GCX A;  1M1G A;  2KMT A;  2J05 A;  3FLG A;  1YFN A;  1PSE A;  2VXF A;  5CKF A;  2KNB B;  1P92 A;  1VQ9 Q;  1G3Y A;  1WDX A;  1NG2 A;  4IUQ A;  1AOJ A;  3HL8 A;  2QQS A;  1ABO A;  2LQN A;  4C8Q A;  1MMA A;  1OX8 A;  2VXE A;  1QWE A;  1YHQ T;  1W70 A;  4M77 C;  4DEX A;  3JCM Q;  4ANJ A;  1BI1 A;  4K11 A;  2DO3 A;  4IIO A;  4C0G A;  2KRO A;  4DBF A;  4CRI A;  3CCR A;  4KGV B;  2R58 A;  2KK4 A;  5GJV B;  1YJ9 T;  2HMA A;  3GBQ A;  4N0A A;  1M3B A;  4OP0 A;  2LMJ A;  1KFZ A;  3MEW A;  2F1L A;  1WJS A;  2QG9 B;  5GAN 3;  1X27 A;  2CZ7 B;  3PT9 A;  3QHS A;  2FB7 A;  2K2M A;  4CC4 B;  1ZHI A;  3EFO B;  1VQL T;  2L89 A;  3V8L A;  2M9U A;  4PL6 A;  3URG A;  1GBQ A;  1UEB A;  1B34 B;  3OYD A;  1I4K 1;  5HK0 A;  1W2B S;  3CMA T;  2DL3 A;  2ZAE A;  2K4Y A;  1VQP T;  4BE0 A;  2VGN A;  1Y07 A;  3CCJ A;  1KC8 C;  2PZ1 A;  2JMA A;  1VQN T;  3JB9 G;  1IHW A;  2QTV A;  2LJ1 A;  2DTO A;  4J6X A;  2DER A;  2EIF A;  4PFP A;  3GOX A;  4VUB A;  1SRL A;  4IUU A;  3NGP A;  2OX7 A;  3OW2 A;  1Q82 R;  4C5G A;  1VQO Q;  2ED0 A;  5DLQ E;  3LH5 A;  4OMF B;  2ESW A;  4RCB A;  2HL3 A;  4HVU A;  4CC2 A;  4QQG A;  1U06 A;  4JJB A;  4JLI A;  4MML A;  4E7K A;  1Y7X A;  1BB9 A;  1WJR A;  2LNH B;  1VQ7 A;  1Y96 A;  4LE9 A;  4Y92 A;  1VQ4 T;  2RQR A;  4PJO E;  2CDT A;  2F69 A;  2HSE B;  3I55 Q;  2RHU A;  1X2K A;  3JB9 F;  1VQ9 A;  2HL5 C;  1BCM A;  3EG0 A;  3G4S Q;  2J7I A;  1H8K A;  2RH2 A;  1U5S A;  4DOW A;  1OX9 A;  4M78 D;  2JW4 A;  3QUI A;  2CS7 A;  5FU6 B;  1KC8 R;  2PU9 B;  3E9G A;  5I11 A;  4NL2 A;  2P0P A;  3OS0 A;  1G8X A;  4OGE A;  3CC2 A;  1X6O A;  1RI9 A;  1IGU A;  5GAM h;  3SFM A;  2ABL A;  3NTH A;  1SEM A;  5LJ5 g;  2GQV A;  1YJN T;  4F16 A;  3UA7 A;  4F7U B;  4BD3 A;  3EAE A;  2BUD A;  4XTU A;  2E1H A;  4J9B A;  4GBQ A;  1NJI R;  1PD1 A;  5GMK j;  1K9M R;  3RR6 A;  2O9S A;  2RJD A;  2FPE A;  2PUO B;  4IUT A;  8AT1 B;  4WTO B;  4M7A A;  1AD5 A;  2EYW A;  4QT7 A;  1KJW A;  4II1 A;  4XAX B;  1FWZ A;  4P5N A;  2J6O A;  4RTW A;  4J9H A;  1X43 A;  3L1A A;  1WIE A;  1WLP B;  3M0P A;  4ZN3 A;  1M1K R;  2DXT A;  1FMV A;  3JCM d;  3TQ7 P;  3RUX A;  2XIC A;  3I35 A;  2FO0 A;  2MK5 A;  1FMK A;  2RD1 A;  4BDY A;  1W2B P;  1Q86 R;  4PLL A;  1YJW T;  2LT4 A;  2O2O A;  1N8R R;  1O9S A;  3S3M A;  2XDB A;  2DPP B;  1QLY A;  3MP8 A;  4ZGE B;  1OOT A;  3LWH A;  1AWO A;  4E2F B;  2YDL A;  1M3C A;  4MZP A;  3AT1 B;  4KGX B;  3OYK A;  4X9C A;  3X24 B;  1NLO C;  2YWW A;  4PJM A;  1LOJ A;  1QVG P;  1RAB B;  2H3J A;  1M9S A;  1AZE A;  4JPB W;  1B3Q A;  3FRN A;  4IIM A;  1NPR A;  2PQW A;  3EG9 B;  4E6R A;  5GAM j;  1S1N A;  1LNX A;  1AWW A;  1H3Z A;  2RF0 A;  2X51 A;  1D3B B;  3PMI A;  4PLI A;  1C1A A;  2K6D A;  1J3T A;  1OV3 A;  3G4S T;  4LDU A;  1VQO T;  2JXB A;  1V76 A;  3CXC S;  2DET A;  1NPP A;  3CPF A;  2EJ9 A;  2DEQ A;  4BE2 A;  3CD6 Q;  2DEU A;  1WHH A;  1UGQ B;  2LQ8 A;  5GAO p;  3X28 B;  5FRM A;  2RHY A;  2J6K A;  4FT4 A;  2DK3 A;  4QQ6 A;  1V1C A;  5IHN A;  3F70 A;  1Q86 U;  4ORZ A;  4M78 F;  1TSF A;  3ZFJ A;  5FLX E;  3CCL Q;  3QYG B;  2B8A A;  2KRM A;  1UHF A;  2LZ6 B;  3L2Q A;  3P8D A;  4AFS C;  2YRD A;  4BDZ A;  3OMC A;  3O5Z A;  1VYT A;  3ME9 A;  3EGU A;  1KD1 C;  2DA9 A;  4AFU C;  5KYX A;  1VQ7 Q;  2ZGW A;  4DBQ A;  2KT1 A;  1QVG S;  2V8I A;  1RI0 A;  5LJ3 g;  3LGL A;  3M4G A;  1RLP C;  2EGC A;  5GAO r;  2HNI A;  4XQ3 A;  2HSP A;  1KQ2 A;  1FX7 A;  3P8B B;  4MZM A;  1KQ1 A;  1XQH A;  2CP3 A;  2RNA A;  4HVV A;  3GLX A;  4FYW B;  5FWB A;  2V1Q A;  3QZ5 B;  5GAN 8;  2HKQ B;  2CGH A;  2E4H A;  1KC8 U;  2AK5 A;  4ME7 A;  1K8A C;  3VRY A;  2P4T A;  3J7A F;  4RTZ A;  3THK A;  2K2V A;  2L5Q A;  4Q5W A;  1U8R A;  1M2O A;  1SHF A;  2KT8 A;  4M78 E;  5HCK A;  1VQK Q;  3L2W A;  4QW2 A;  1WA7 A;  1RAH B;  4X34 A;  2CP2 A;  2FEI A;  2RMO A;  1YIJ T;  1NYF A;  1N8R C;  2DM1 A;  4RTU A;  2OTL Q;  3JCM c;  3CCU T;  1M2V A;  1Q7Y U;  2VB6 A;  2HQE A;  2BIV A;  3VYH B;  3EGD B;  4KUD K;  5GMK i;  2NUT A;  2KXD A;  2X4X A;  4EPC A;  1W2B A;  4FSS A;  2DD5 A;  1T3L A;  4E47 A;  3OQ5 A;  1B07 A;  2P0Q A;  4E7Z A;  1WQ7 A;  1KQS S;  5GAN e;  2O88 A;  1GFC A;  2DIQ A;  5GMK m;  1EIF A;  2RJF A;  5KE2 A;  2YLC A;  3C12 A;  1HYO A;  2LC4 A;  1KK7 A;  1GFD A;  1KD1 U;  4F7U A;  2CP5 A;  2A7Y A;  1AWX A;  3J81 E;  1R0C B;  3LYI A;  3VUZ A;  5GAO m;  4PJJ A;  1Q81 U;  4A4F A;  4X1V A;  5EC7 A;  2DXU A;  1YWP A;  3CCS Q;  3QZ9 B;  4IUR A;  3OS5 A;  4OMN A;  1D1B A;  2EVR A;  1WHG A;  1IZ6 A;  3CBO A;  5CR2 A;  2KRN A;  3EFS A;  1ZSZ C;  5LJ5 h;  2LTO A;  3CC4 A;  2CSI A;  3S6W A;  1OZ2 A;  1MND A;  2R5M A;  4C0Z A;  2PVO B;  4XU3 A;  3JCM f;  4Z88 A;  3A8H B;  1C0M A;  4C92 C;  4C8Q C;  4X9D A;  2QEX A;  4J9C A;  2F5K A;  4QVC A;  1M4Z A;  3GF5 A;  3MHX A;  5LJ3 d;  1G83 A;  1MMD A;  4M77 G;  4BI8 B;  5I2S A;  1Z9Q A;  2KSS A;  2A28 A;  1VQL A;  1NBE B;  4HCZ A;  5IN1 A;  3G71 A;  3HRT A;  1GRI A;  4EDU A;  4JJD A;  5AYF A;  3JB9 H;  5LL6 S;  2PTK A;  2EGE A;  3UDC A;  1Q95 G;  1VA7 A;  3KUF A;  1VQL Q;  4ELZ C;  1OZ3 A;  1WHK A;  3FIF A;  5J26 A;  4F7U E;  3JCM h;  1LPL A;  1NYG A;  2PVG B;  4JJN K;  3I56 T;  5GAM e;  5GMK h;  4OVA A;  2V1R A;  4PK4 A;  2NLU A;  3RKW A;  2HBW A;  3OYG A;  4F04 B;  4RKU E;  1K1Z A;  2D8J A;  1VQ4 A;  2QI2 A;  1KHI A;  3T9N A;  4BI4 A;  2CH4 A;  2QGG A;  5A0G A;  2DAQ A;  2EJG A;  2K5I A;  3GNG A;  2WAC A;  2F2V A;  5M9O A;  1QP3 A;  4OML A;  2LJ0 A;  1QW1 A;  1VIF A;  4MMK A;  2M16 A;  3M0R A;  1NZ9 A;  1YI2 T;  3M5A A;  2NUP B;  4Y28 E;  3BFM A;  3EHQ A;  2KEA A;  3QSU A;  1UJY A;  4C0F A;  1JJ2 A;  2JMC A;  2DRM A;  3MEV A;  4KRT A;  2MOX A;  5LJ5 d;  1R77 A;  2DMO A;  3CCS T;  3QPH A;  2A08 A;  4PJO B;  1YIT A;  2A37 A;  2EBP A;  3CMA Q;  1TOV A;  2QQR A;  3M56 A;  3FB9 A;  1JEG A;  2DIL A;  3EG1 A;  1BIB A;  4D6W A;  2Y90 A;  5GAN f;  1R8O B;  2JZ2 A;  4M7A D;  3CCU Q;  1SF9 A;  1W1F A;  3CQT A;  1IXD A;  5A0L A;  4LDW A;  1UB4 A;  1SSF A;  3OBW A;  2Y4X A;  3CBM A;  2K9G A;  5J3B A;  3OYY A;  4C8Q B;  4KGZ B;  2LRQ A;  1JBM A;  4KUI A;  3CCU A;  5GAM f;  4M7D D;  1PC0 A;  3HFO A;  4PFO A;  2DJZ A;  4BUG A;  4M7A F;  2DZC A;  4E7J A;  4WF2 A;  1ZQ1 A;  1TU0 B;  2GBQ A;  1K9A A;  2D0N A;  1D09 B;  1Q86 C;  3S3O A;  4NL3 A;  4RUG A;  4EMH A;  3KXT A;  2RB6 A;  2DX1 A;  2O4X B;  3CME A;  2ENM A;  1WX6 A;  1NEB A;  4M7A B;  3C94 A;  3EFO A;  4OGC A;  2C0I A;  3M0S A;  5CCA A;  1JO8 A;  2C0T A;  1M90 R;  1X75 C;  1I0C A;  3QKJ A;  1MMN A;  4DBH A;  3CPW S;  2V8K A;  2F2X A;  3DKM A;  1YHQ Q;  5L8R E;  2XD0 A;  3PGG A;  1OI1 A;  2DF6 A;  2D6F A;  1E6G A;  1K73 U;  2K79 A;  4M7A G;  1TG0 A;  3M9Q A;  3PFS A;  2I2L A;  5GMK l;  4BE1 A;  5GAN 2;  3GPL A;  3CCV A;  2K3X A;  1QCF A;  4DOV A;  2P0K A;  2GTO A;  2LJ3 A;  5D6Y A;  2KVQ G;  4OMM A;  1IRE B;  1MV0 B;  2FG0 A;  3OYA A;  1N9R A;  1SHG A;  2DL7 A;  2GFA A;  1JXM A;  3NMZ C; 
#chains in the Genus database with same CATH homology
 3CPW P;  3CCM Q;  2QA4 Q;  3I56 Q;  1YIT Q;  1VQ9 Q;  3CME Q;  1M90 R;  3CC2 Q;  1VQ6 Q;  1VQP Q;  3CCL Q;  3CC4 Q;  3CMA Q;  1Q82 R;  1QVG P;  1KC8 R;  1QVF P;  3CCV Q;  1YJN Q;  1NJI R;  3CXC P;  1VQ4 Q;  1VQN Q;  1W2B P;  3G71 Q;  1YHQ Q;  1VQL Q;  1Q86 R;  1VQO Q;  1K9M R;  3CCR Q;  1N8R R;  1Q81 R;  1KD1 R;  3I55 Q;  3CCQ Q;  3CD6 Q;  1VQK Q;  1KQS P;  3CCJ Q;  1S72 Q;  3CCU Q;  1VQ8 Q;  1VQ5 Q;  1YI2 Q;  1VQM Q;  1YJW Q;  1K73 R;  1JJ2 P;  1YJ9 Q;  3CCE Q;  3G4S Q;  3CC7 Q;  2OTJ Q;  1VQ7 Q;  1K8A R;  2OTL Q;  3G6E Q;  1YIJ Q;  2QEX Q;  3OW2 P;  1M1K R;  1Q7Y R;  3CCS Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...