3CCMQ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3ccmQ00
3CCVQ 1VQ4Q 1YI2Q 1JJ2P 1KQSP 1VQ6Q 3G71Q 1YJ9Q 1M1KR 1VQ7Q 3CCRQ 1Q7YR 1YHQQ 3CMEQ 1VQOQ 1K73R 3CD6Q 1VQ8Q 1Q82R 1VQLQ 3CCQQ 1W2BP 1N8RR 1VQKQ 1QVFP 1S72Q 1YJWQ 2QEXQ 1NJIR 3CCLQ 1VQ5Q 3CMAQ 1VQMQ 3CCEQ 3CCUQ 3OW2P 1QVGP 1K8AR 3I56Q 1YITQ 1KC8R 1K9MR 3G6EQ 1YJNQ 3I55Q 1VQ9Q 2OTJQ 1VQNQ 3CCSQ 3CXCP 1Q86R 1KD1R 1VQPQ 3CC4Q 3CCJQ 1M90R 3CC7Q 1YIJQ 3CPWP 2QA4Q 3CCMQ 2OTLQ 3CC2Q 1Q81R 3G4SQ
chains in the Genus database with same CATH superfamily
3OMCA 4FSXA 5EC7A 2QGGA 2V26A 2YHTA 5GAOn 4KT0E 1TXQA 2OJ2A 4O5VA 5DLOA 3CBMA 1LOJA 4AFQC 3I5RA 4KH1B 1MNEA 2KT8A 1S72A 4RCCA 1PD0A 4MZMA 4LE9A 4NL3A 3J80E 1VUBA 2DXUA 1VQ7A 2JMCA 3RNJA 3LW5E 4BY6C 1IREB 4DBHA 2QQRA 1SHGA 2X3XD 2YWWA 3GP8A 2L3SA 4JLIA 4GBQA 2EBPA 2FZCB 2YUNA 5GAN6 4BDZA 4CI0C 2DETA 3VS4A 3PMIA 1PCXA 1EIFA 3KUFA 4KBMB 1WIEA 3OW2P 4C0GA 4M78G 4IURA 1YJ9T 1N9SA 1PD1A 1VQ4T 1RL2A 2EYZA 5A0DA 1GBQA 4DOVA 1R0BG 3QZ9B 1TWBA 1VQNT 4KUIA 1JJ2P 3PGGA 2ZPHB 1WLPB 1RAGB 4HCKA 1Q86C 4J5YA 2LZ6B 3RKWA 3CCQT 4E2FB 1GFCA 2V8KA 1Q81U 2DE0X 2EKOA 4QQDA 1D1BA 3OYHA 1UHFA 4PNOA 3CEYA 4PLIA 2AKLA 2E1HA 2MWPA 1AEYA 3FJ5A 2F5TX 3UPUA 5KH6A 2OAWA 4C8QG 4BD3A 1UGQB 2CSIA 2O31A 2QDYB 3ME9A 2CZ6B 4EIKA 3OW2A 4FW1A 5A2QE 4AFSC 1YJNQ 1PRLC 5LJ3e 2NUTB 1VQ4A 3M5AA 4Z02A 2DERA 2JJ9A 5IH2A 1OEBA 8AT1B 2EQUA 1OU8A 2H3EB 3QDRB 5J3BA 2ZCFB 2A3LA 1NYFA 4C5HA 2KAFA 4KGZB 4ORZA 3G4SA 3KFVA 1BK2A 4C0FA 2RK2A 1E6HA 1YWPA 2LT4A 4C92C 2HZYA 1PSEA 4C92F 3OS0A 2DPPB 1W6XA 5C6SA 1C1AA 4M7DD 1ZSZA 1ZQ1A 1M1GA 1NJIU 4B9XA 2LQNA 2J7IA 2EYYA 3OYCA 4DBQA 4ELZC 5D6XA 1WHHA 1G83A 1ZUYA 1MMDA 1PKSA 2VUBA 3UWNA 4M7AG 4M7DF 3PFSA 1WDXA 2I2LA 1R0CB 4C92A 2E41A 1ZA1B 2DIQA 2RPNA 1K73R 4J9EA 1GXIE 2JVVA 2M1HA 3NTKA 1NPPA 2RHZA 2JM9A 2O9VA 2LQ8A 5I2SA 1VQ9Q 1PHTA 2BKDN 3F70A 2HQXA 1UGPB 2E65A 1FMKA 1I1JA 2Y90A 2KVQG 2L0AA 1M90U 4JRKA 4WTOB 4RMOA 2K5LA 4JDSA 4WCIA 2EQIA 3RUXA 2EQJA 1SSFA 4C8QB 3JB9H 1AD5A 1NJIR 2A7YA 4PJMA 2C06A 4PJLA 2DBKA 2F2VA 3OYLA 4J9BA 1SF9A 4XTYA 4RTWA 4OB1B 3CCEA 1XJWB 3META 1O75A 2DF6A 4M78D 2P0KA 3DLLA 1PSFA 2EJ9A 2EYXA 3P8BB 1AVZC 2CP5A 1YHQA 4M78A 3CCVT 2P4TA 4M7AF 1Y96B 1M1FA 2ZPEB 4XTXA 2DTHA 1UB4A 1QVGA 2HCKA 3UDCA 2LQKA 4ZNXA 1X6BA 4FCYA 2ATCB 3PMTA 2JNGA 4M7DG 4LXCA 4J9FA 1JO8A 1S1NA 5EG2A 3CC2Q 2FPDA 3LGFA 1MNDA 4LN2A 1PC0A 1VQ8T 1N27A 1Y7XA 2PUOB 1VQ7Q 3JCMb 3CCQA 4MDWA 3I55A 1KQ1A 2K4YA 4AFUC 1H8KA 1WJSA 2P4RA 2RH2A 2RF0A 5LJ3h 4OB2B 2IIMA 1K4US 5CKDA 3EG3A 3X24B 1M1KU 2RK1A 3M4GA 1JXOA 1VQNA 4CC3A 1TS9A 4M78C 3T9NA 2HEQA 2KYMA 4C8QA 1JJ2S 5IN1A 2L3PA 2RHXA 1YJ9A 1Q81R 2G3RA 4M77D 4AT1B 4BI3A 3M54A 1UGVA 1QQJA 2GCXA 4B6MA 3JCMV 2DVEA 8ATCB 5LJ5h 3RERA 2MIOA 4FT2A 2K3YA 2SEMA 1QVFS 5I11A 1TUDA 1YWOA 3QO3A 3CC4Q 1WI7A 2B86A 1MMAA 2XG8D 2ZPGB 4XAXB 1Q82R 2ZAEA 5KCOA 1VQ6T 2A28A 2FB7A 1M27C 3CMAQ 6AT1B 3L1AA 2X4XA 3OYEA 1NG2A 4M77B 1G8XA 2RJCA 1XTDA 2GF7A 2HQEA 3CC2T 2XMFA 2CREA 2HMAA 3CBOA 2ABLA 3V8LA 1OV3A 1NEGA 2E5QA 3R6NA 3MEVA 4BE1A 2KI7A 1LVKA 5GAMe 2OTLA 2EAYA 2RA2A 4XQ3A 2ENMA 5GANj 1W4SA 1WQ7A 1XOVA 2KQWA 4X9DA 5D6YA 3JCMd 2CP2A 2F2XA 2KRNA 1T0JA 2YLBA 3HFOA 4XTUA 1KK7A 3J81E 1Q82U 3QDFA 2Z0WA 4LDVA 3CCLQ 1WGSA 3A8HB 2YLCA 3OBWA 3E9GA 2D8JA 4M7DB 2LJ3A 2PUKB 3OB9A 4IUVA 4M7DE 3TEEA 3A8GB 2K3XA 4JJBA 1OOTA 2XD0A 1WJRA 1VQLA 1VQMT 2C0TA 1VQ8Q 5GJWB 1UJYA 4LDYA 2V8JA 1BI3A 4A4KA 1Y0MA 3GF5A 1G3WA 2DNUA 1M1KC 4BACA 1NZ9A 1VA7A 5HCKA 1RUWA 2QG9B 1T3LA 1I81A 1Q7YR 1QMCA 2G6FX 3CCVQ 1VQ7T 1D0YA 4LD9K 4HCZA 3EGXA 1M1KR 4C92D 1I07A 4Z8AA 4PK4A 3FDRA 1X27A 4MDXA 1S72T 5GAMd 5LJ3d 1YITT 2O4XB 4FT4A 3QXEB 3G71T 2L89A 3VRYA 1VQPT 4QVCA 1QW1A 3OY9A 3E1SA 4A53A 5GAN2 2KR3A 2KGTA 3O8VA 1OQKA 1SPKA 4ANJA 2VB6A 1M30A 1O9SA 1YHQQ 3CCRT 2XIDA 4JRIA 2KDSA 2K9GA 2RQTA 3WVDB 1TG0A 1UHCA 1QVGP 1VIEA 3M59A 3GNGA 5CCAA 2D6FA 4E7ZA 3REAB 2QEXT 1H641 2CP3A 3CCMQ 3C12A 3LX7A 5GMKj 2QTVA 3E2UA 2M16A 4PFPA 1M5Q1 4BY6B 2A08A 3VS2A 1JJ2A 2YSQA 2V1RA 2D9TA 3JB9I 1BIAA 1UEBA 3OYFA 4E7JA 3CCLA 1UGRB 2CP7A 3OQ5A 3TQ7P 1PKTA 2CUDA 2NWMA 1ZUKA 1YIJQ 1WYXA 4M75D 3S6WA 2HNIA 1VQ6Q 2RHUA 1HYOA 4K11A 3VS6A 1OZ2A 1K73U 2DAQA 4BE2A 5HY6A 3SWNB 2VV5A 1AWWA 4KRTA 4RTXA 2AHJB 2ZGWA 2HBPA 1JB0E 2Y4XA 1VQ4Q 1H92A 1X6OA 2Y4YA 3HHTB 4C8QF 2LTOA 4IKFA 1QP2A 2VWFA 1TTHB 1SKUB 2J6FA 4PJNA 1YBYA 4QVZA 3S3OA 5IXFA 1VQOT 2FRYA 2RQVA 3CBPA 2IVWA 3KBGA 4IUTA 3CCMA 2JTFA 5FU7B 2COZA 1NEBA 2MPXC 2QDLA 2LCSA 1B7TA 3H0FA 2FPFA 1ABQA 1QVFA 2EJFA 2YUPA 1NJIC 3CD6T 2VKNA 2QQAA 2ESWA 4RCBA 1T3SA 5GMKe 3CCUT 1M3AA 3V7SA 1YIJA 1RAAB 3OYKA 5KYNA 4MZTA 2XICA 4D8KA 4OVAA 2CZ7B 3CMEA 2XK0A 1YJWT 1TSFA 3LH5A 5C0MA 2BTTA 3M9QA 2OTJT 3QIIA 1FX7A 1TH7A 2ROTA 1YJNT 2NLUA 3L42A 1X2KA 5GAOl 1LCKA 3M0QA 2DZ9A 3EH1A 4PFOA 4ZGJB 1Q86U 1KQSP 3LH0A 2FVUA 1W2BS 2DRKA 1A0NB 5LJ5e 1B3QA 4FIBA 4JRPA 4J9DA 4HXJA 3HRUA 4M7AB 1CKAA 1MMNA 2DL5A 2DL7A 3THKA 4FL6A 5HK3A 4JJNK 5CAIA 3O5ZA 4DEXA 4XTZA 4N4GA 4QQGA 2OTLQ 2AT1B 4RKUE 1RI0A 3MP8A 3X28B 4P5NA 2L3RA 4M7DA 2HSEB 1H3HA 1SRLA 3MJXA 2FG0A 1BI0A 4M77G 3RMSA 4EMGA 2O01E 3I56Q 3DLMA 2DK3A 4DA4A 4Y91A 1YIJT 1X01A 4QKUA 2D0QB 3P8DA 2D1XA 4JS4A 1KQ2A 2DD5A 2QI2A 4LDXA 2FO0A 5I2MA 5I22A 1QWFA 4JLGA 5KE3A 4E7IA 2K57A 1Q82C 3CCRA 4TVRA 2MI6A 3EHRA 1BKBA 3CCUQ 1RI9A 2HL5C 3BE3A 5GAN7 5GMKi 2YXYA 4L59A 2W0ZA 1IB8A 2M9UA 3QJYA 1JU5C 1Y57A 1UGSB 3RKXA 3G71A 1VQKT 2DRMA 1K0XA 3PNWC 1VQOQ 3EAEA 3GLXA 3OYJA 3I55T 2ECZA 2EGAA 3I9QA 1ZBJA 5DM7R 4MMKA 5CQXA 1HSQA 2MYSA 1KD1R 1M3BA 3PVQA 4PJOD 2FYKA 1FXXA 1XQHA 3JCMe 4E7LA 2FL7A 1GCQC 2LT1A 1IRXA 4N4HA 4F16A 5GAMj 4HVVA 2KSSA 3I35A 1VQLT 3FIFA 1VYTA 1XNIA 3VUBA 3JCMh 4CC7A 5CR2A 2HSPA 4FM4B 2BZXA 3CCET 1HD3A 4C0DC 1C6VX 2NUTA 2RHYA 2D0NA 3M0SA 4ME7A 1M2VB 1KG1A 2F69A 3C4SA 1ZLMA 3CD6Q 1KHIA 2DVJA 1N8RU 3L2RA 1WXUA 2RD1A 1D09B 1YJWQ 3VJPA 4PLLA 4C92E 3S3NA 4F17A 1K8AR 2E4HA 2X3WD 1ABOA 2FZGB 2JM8A 4V2SA 3DB4A 3QYGB 1JEGA 1N6AA 2O2OA 3VUZA 4XTWA 1M9SA 3G7ZA 1ZA2B 5KYWB 3EGXB 3NFCA 5AYFA 2HDAA 2EVRA 5GAMg 1NM7A 3HL8A 1G5VA 2GQVA 2LC4A 4IIOA 3M0TA 3X20B 3JCMX 2CS7A 1KHCA 3ZL7C 5LJ3j 2L3QA 3VRZA 2DO3A 3EH2A 3VS5A 2CUBA 1K9AA 4M7DC 2MCNA 1BI2A 2COWA 1VQPA 3QHSA 4ZTJA 1WNLA 1T0HA 2RB6A 1LNXA 4Z89A 2XDDA 1VQLQ 2EGEA 1CSKA 1NPRA 3TCJA 2DJZA 4J9IA 3WVEB 1WHKA 5FU6C 1AZGB 2CKKA 4J6WA 1K9MR 4PJJA 2KRMA 5HKCA 1M2VA 2JS0A 2DL3A 2HL3A 1R8OB 2MAMA 4XK8E 3JB9D 3CCUA 1KQSS 4WF2A 1UJ0A 7AT1B 3G4ST 4L5GA 5FW9A 3NMZC 2MWOA 3RKYA 3CD6A 4M7AE 2JTEA 4JS5A 4OMLA 1ARKA 3SWNA 3RBBB 4HT9A 2JW4A 1D3BB 5IXBA 4J7IA 4M77F 1VQOA 1W1FA 4IUPA 5KYXB 4N4IA 3EG2A 3HSBA 1KJWA 1F1BB 1SEMA 3D7SB 4YTLA 4JPBW 3C94A 2KXDA 4PJOG 4CC2A 3JCMQ 3JB9J 1B34A 4A4FA 5KYYA 3FJPA 3CXCP 2DL4A 1IZ6A 2BZ8A 1I5OB 3DKMA 2P0PA 2DM1A 1MV3A 4DEYA 4DBFA 1KC8U 1KSWA 3LLRA 5FROA 3CC4T 1K8AC 4E47A 2K3BA 2CH4A 2YRVA 2OTLT 3FRNA 3BW1A 2WSCE 1BB9A 4XU0A 3EGUA 2DZCA 3PVLA 4ESRA 5GANe 2CT3A 4FYXB 2E10A 2OI3A 3EFSA 4M78B 3OMGA 3OYAA 1JXMA 3MEAA 4HA8A 3CC2A 3PIOA 3CC7A 4M75F 5FWBA 2KNBB 2QQBA 4IUQA 4M75C 2LRQA 1DJ7B 1WPYA 3X26B 4OMPA 1VQ6A 4J83A 2E6ZA 1X69A 2KE9A 2J05A 1K73C 3VKIA 4OP0A 1OULA 2ED0A 4NOYA 2KRSA 3HTRA 2QEXA 1V76A 2DD4A 1UECA 5AT1B 1QCNA 3GPLA 1UG1A 4Y28E 3CCJT 1MHNA 4FYVB 3REBB 1GBRA 2XDBA 1FMVA 2FZKB 2AK5A 2HAXA 2E64A 3NGPA 3CCSQ 4KUDK 2K79A 2QGFB 3P8HA 4F7UF 2XKOC 3FC3A 3JCMP 4Z88A 3HPWA 3OYIA 1U1SA 4C8QC 4R0KA 1YITA 5FLXE 1GFDA 3EG0A 3X25B 1ZX6A 3QWXX 3M0UA 1VQ8A 4RTUA 4PKCC 2JZ2A 2DXCA 1RAEB 4OGEA 1W2BA 5IT9E 1AZEA 1PNJA 1QCFA 2R58A 4D8DA 1U1TA 3SFMA 1VQ5Q 3CC7T 4X1VA 2V1QA 4J9HA 3HFNA 1YHQT 4PL6A 1M8MA 3EHQA 4A54A 1IXDA 1WFWA 3VS1A 3L2VA 2HKNA 1QVPA 2YUOA 2VGNA 1VQPQ 5CQYA 2YT6A 4C5EA 4L6V5 4LDUA 2XDPA 4EPCA 2NUZA 5L23A 1VQ9A 2E5KA 2CGHA 2KROA 4PFZA 1KQSA 4M77A 3H9NA 1Q81C 3CC4A 1HJDA 2RHIA 2EYQA 1IGUA 5GMKh 1G2BA 1QVGS 1QKWA 3C95A 4M4ZA 3QZ5B 1OZ3A 3ASKA 2PNIA 4FW2A 2DTOA 1GRIA 2X4WA 3CMEQ 1OPKA 1WHLA 3OS1A 2CSQA 3NTHA 4RTVA 2GTJA 3V8KA 2A36A 5GANg 4Q5WA 1ZSZC 1I0CA 4ZN3A 1JRIA 2LX9A 1Z9QA 2C0IA 2QTXA 1Q86R 3JCMc 4XU1A 2EQKA 2ZPFB 3CPWA 1AWJA 1D1AA 2KY9A 2JUFA 2RJDA 1RLQC 2DBMA 3S3MA 2V8IA 3M0RA 1K76A 1D0ZA 4EMKA 3EFOA 1NBEB 1VQ5T 1ZHIA 2RMOA 3HKSA 4C5GA 3VS7A 4JJDA 3VYHB 3JB9F 3SHWA 3VU3C 3CCJA 1X43A 3L2UA 3OBYA 2P84A 5LJ3f 2DYBA 1FMWA 2M0YA 3PT9A 1WJQA 2K7AA 2JOYA 4RUGA 3MP6A 3OYNA 1NLPC 1WHMA 2E3HA 1HXDA 4RG8A 1W70A 1VQ5A 2XU8A 4LUDA 2HKQB 4J9GA 4OF1A 1OX8A 4A4GA 5KYWA 3JRZA 3M4YA 4M77E 3V7CA 1EZZB 3QUIA 1WXTA 3CXCA 2O4XA 1WHGA 2RI3A 3A98A 1X75C 5DY9A 1EX4A 1D1CA 5I21A 1QKXA 2AIRB 2IPOB 1QP3A 5GAOp 2NYSA 2DJQA 4F7UA 2VYTA 3EFRA 2DLPA 1M90C 2E3IA 3EFOB 4C0ZA 2BIVA 2RQUA 1PWTA 4GY5A 3JSCA 4CC4B 2XHCA 1VQKQ 2WSEE 2JXBA 1Q95G 3JAME 4M75E 4E7KA 2NUPB 3CCVA 4PJOE 3J7AF 2DXBA 5KYUA 3GOXA 3CCSA 1OPLA 1K9MC 3SB2A 3I55Q 2OTJQ 1IHWA 3FEOA 4QQ6A 1U3OA 1M2OA 3MEUA 2KYBA 1P92A 2LDMA 1M8VA 3EGDA 4AMCA 4DQ2A 3PIPA 4EMKB 3VYGA 4OMFB 3LWHA 3OS5A 2A37A 4J8OA 2QQ9A 2CZ1B 2WSFE 3U23A 1N8RC 2DFUA 2VXFA 2FEIA 2C0OA 2RQRA 3SEMA 2QXFA 3H6ZA 3H41A 2VASA 4M75G 3HP9A 2DL8A 3URGA 5LL6S 5GANf 2XI9A 4OB3B 3A1PA 1YI2A 1K0SA 3JV3A 3NTIA 5KYUB 1X6GA 2NUPA 3GIBA 4II1A 3KXTA 1HK9A 2R5MA 2ZZDA 5LJ5f 5LJ3g 2QEXQ 3QG1A 1OU9A 5KYYB 5GANh 2CT4A 1SRMA 1VQNQ 1U5SA 5ECAA 2M0OA 3OYDA 1M3CA 4EMKC 2DYIA 2JTMA 3PE0A 2RN8A 4KGXB 1SSHA 4F7UE 1RLPC 5CIUA 5GAN5 3CCQQ 5KYXA 2K6DA 1RAFB 2KT1A 9ATCB 3EG1A 1G3SA 3BDUA 3CCEQ 1I4K1 3TU4K 4ZN1A 4M7AA 3OYMA 2LP5A 3TSWA 1MUZA 1TOVA 2F2WA 3H8ZA 3NPFA 2EW3A 1N9RA 4PJOA 2RO0A 3FLGA 3RMQA 4UC4A 3LGLA 4M7AD 1YJ9Q 2CDTA 2LNVA 2X4YA 5GAMh 5FRMA 2LCCA 3A8LB 5GAOr 4HT8A 4IUUA 4N0AC 4C8QD 2PZ1A 3UF4A 1Z9ZA 1MMGA 2H8HA 2LJ1A 2DTIA 2AKKA 2DX1A 4HKEA 1Y71A 2DKGA 2R5AA 3QJ6A 2E6NA 3E9FA 1K9MU 1E7OA 1M4ZA 2FPEA 5FU7C 2W10A 4KULA 4AG1C 3OYYA 4ZGDB 1I8FA 2QK0A 2QYZA 1VQMQ 1SG5A 2K5IA 1ZUUA 1OYXA 3QPHA 4X34A 5IAYA 1BBZA 4QT7A 4AFZC 4BB7A 4CRIA 2MF2A 2PVGB 4F04B 2SRCA 5IHIA 4HVUA 3M57A 3ER0A 1YI2Q 4DBRA 1BCMA 1UTIA 4FSSA 2L8DA 5A0LA 4A4HA 1JQQA 3AHUA 5GANd 2HD0A 2L2PA 2YDLA 1ACMB 2OX7A 4JUVA 3SWNC 2VXEA 2RQWA 2KBTA 2A0FB 3M53A 1TU0B 2JN0A 4PJOB 3Q1JA 5IHKA 1RACB 1BIBA 2DIGA 2B8AA 3BDLA 1QCOA 2FHDA 1GL5A 5LJ5j 3BFMA 5D7UA 3N5BB 3OSSC 2K2MA 3G6EA 3L2ZA 1I5LA 1WXBA 4XU3A 1N5ZA 4FYYB 1B34B 1S72Q 4HCBA 2M02A 2JMAA 2DEUA 3TREA 3JCMg 2J6OA 1YITQ 1UUEA 2ZPIB 2L5QA 4IIMA 2PVOB 3ZFJA 2JS2A 2EYWA 5GJVB 1RABB 1IO6A 2LJ0A 2F5KA 2EQMA 1OI1A 1QVFP 2R57A 1CKBA 3A8MB 2GNCA 1MGQA 1VQKA 5CKHA 2BE7D 2GGRA 3LYIA 2LX7A 4M78E 4B9WA 4E7SA 2MK5A 1MV0B 4OMQA 2EPDA 1W2BP 1Q7YC 4NL2A 4R55A 3VS0A 3M0PA 1R77A 4OB0B 2GQIA 2DMOA 3OA6A 3BY7A 3I5SA 5IHNA 5CKFA 4PJOC 3H0HA 1FYNA 1PRMC 3IQLA 3ULRB 4ATOA 5CKEA 1AOJA 2CZ0B 4KH0B 3G4SQ 2KK4A 4FU6A 2RJFA 3INZA 2DILA 2FRWA 4N0AA 2BE9B 4JZ4A 2AZSA 2RI2A 5M9OA 2CP0A 2CH4W 1Y96A 3RDVA 4C8QE 4E6RA 1B07A 4O6JA 3GBQA 3RESA 2ZPBB 3V8JA 1UE9A 4FYWB 4F7UB 3GNFB 3RIRA 5CKBA 1KD1U 3MPUB 3QKJA 1V29B 1YCYA 3UATA 5GAOm 3ZEHA 4ZTFA 1BU1A 1UFFA 2DEQA 2ROLA 2YRCA 3OYGA 5DLQE 2LNHB 3I56T 4KGVB 4X9CA 3H0IA 5J39A 3G6EQ 1WA7A 4A4EA 1YJNA 5GAN8 3MO8A 3CCJQ 2E12A 5KCHA 1YJWA 2BUDA 3CXCS 1BYMA 2RM4A 3L2QA 2I0NA 5L8RE 4DOWA 2K5FA 1WQWA 4ZGEB 5GMKl 1U06A 1X2QA 2GFUA 2QASA 3UA6A 4BUGA 1AHJB 2KXCA 4QVDA 5KE2A 1YI2T 2MOXA 4M75B 1OX9A 2D8HA 2RJEA 2VGMA 1AWXA 2DXTA 1ZSGA 1PM3A 2DA9A 4MZPA 4C0DB 3ZBDA 1ZBXA 3M58A 1VQMA 2GFAA 2YRDA 5LJ5g 2HBWA 3NHNA 3EG9B 4M77C 3VS3A 1Q7YU 1J3TA 2EWNA 4OGCA 3FB9A 4XU2A 4BI8B 5GAN4 3CCST 2AZVA 2LCLA 1LJOA 3EGDB 2QA4A 1VYVA 5CK9A 4F7UG 4AG2C 3VV0A 4MMLA 2EJGA 4ELYC 2HQHA 3CPWS 1V1CA 3CCLT 4J6YA 1RAHB 3AT1B 2QAZA 2VC8A 1C0MA 2GBQA 3HRSA 1KC8R 4C92B 1LPLA 5GAOq 1SHFA 1GCQA 4C5IA 2RNAA 2O9SA 3CC7Q 4J7FA 3C0CA 2OAUA 3RR6A 1NLOC 1IGQA 4BDYA 3M56A 1VYUA 3CPFA 5FWCA 3OSVA 1KD1C 3CMAT 3CMAA 2P0QA 1YP5A 1D0XA 4A63B 5HK0A 3DB3A 3QWYA 4M78F 4GLKA 1WX6A 3L2WA 1AWOA 1TUCA 3SD4A 1D3BA 2PU9B 3JB9G 2MMPA 2OTJA 1IHVA 2H3JA 4C92G 4E7HA 1EFNA 4BE0A 5FU6B 3TVTA 5LJ5d 3CMET 2EGCA 1K1ZA 3EG9A 3MCAB 4LD6A 3A8OB 4GLMA 4RG2A 2QA4T 2PQWA 1RAIB 2COYA 2EIFA 4J6XA 2CP6A 2O88A 2KMTA 4LNPA 4Y92A 1U8RA 5J26A 1RADB 4HVWA 4EMHA 1E6GA 3QYHB 4J9CA 3V7RA 2J06A 4EDUA 4RTZA 4D6WA 3MP1A 4M7AC 2X4JA 4RTTA 3MHXA 3G6ET 1H3ZA 1JBMA 1TUGB 3CCMT 1FWZA 4XTVA 1M90R 4RTYA 2X51A 5CO7A 2F1LA 3OYBA 5GMKm 1Y07A 3G71Q 1UDLA 4QW2A 3QSUA 3A5ZB 4F14A 2LQWA 1BCOA 3JCMJ 1QWEA 2GTOA 3WXMB 5GAMf 4JJCA 3CQTA 3JCMf 2K2VA 4OMMA 2LVMA 1KIKA 1KC8C 1K8AU 5GAN3 1VIFA 2BZYA 1YNZA 4OMOA 2EKHA 2CYZB 3I56A 1KFZA 1N8RR 4JZ3A 1VQ9T 5CVIA 3UA7A 3G1JA 1G3TA 1YFNA 2KEAA 1NE8A 1PG5B 3PTAA 4BI4A 1ZSZB 2YUQA 4OMNA 4JRQA 1VOMA 3MKDA 1QLYA 3CCRQ 2VVKA 4R56A 3LWIA 1AT1B 2EFIA 1BI1A 2J6KA 4VUBA 3TSZA 2PTKA 2JT4A 3OS2A 3SDZA 2X9HA 1G3YA 3HRTA 3CPWP 2QQSA 4NS5A 3MEWA 2ED1A 2WACA 1WHJA 2RI5A 1YCSB 2M51A 4LDWA 5D6WA 2X35A 2IG0A 2LMJA 4PJOF 3E19A 1GCPA 3QBYA 3OW2S 4LUEA 1YN8A 3UT1A 3M55A 4HCCA 1WZOA 2E70A 3JCMW 4M75A 5FRNA 5A0GA 2QA4Q 2PVDB 3R6OA 1NYGA
chains in the Genus database with same CATH topology
3CCVQ 1VQ4Q 1YI2Q 1JJ2P 1KQSP 1VQ6Q 3G71Q 1YJ9Q 1M1KR 1VQ7Q 3CCRQ 1Q7YR 1YHQQ 3CMEQ 1VQOQ 1K73R 3CD6Q 1VQ8Q 1Q82R 1VQLQ 3CCQQ 1W2BP 1N8RR 1VQKQ 1QVFP 1S72Q 1YJWQ 2QEXQ 1NJIR 3CCLQ 1VQ5Q 3CMAQ 1VQMQ 3CCEQ 3CCUQ 3OW2P 1QVGP 1K8AR 3I56Q 1YITQ 1KC8R 1K9MR 3G6EQ 1YJNQ 3I55Q 1VQ9Q 2OTJQ 1VQNQ 3CCSQ 3CXCP 1Q86R 1KD1R 1VQPQ 3CC4Q 3CCJQ 1M90R 3CC7Q 1YIJQ 3CPWP 2QA4Q 3CCMQ 2OTLQ 3CC2Q 1Q81R 3G4SQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCV Q;  1VQ4 Q;  1YI2 Q;  1JJ2 P;  1KQS P;  1VQ6 Q;  3G71 Q;  1YJ9 Q;  1M1K R;  1VQ7 Q;  3CCR Q;  1Q7Y R;  1YHQ Q;  3CME Q;  1VQO Q;  1K73 R;  3CD6 Q;  1VQ8 Q;  1Q82 R;  1VQL Q;  3CCQ Q;  1W2B P;  1N8R R;  1VQK Q;  1QVF P;  1S72 Q;  1YJW Q;  2QEX Q;  1NJI R;  3CCL Q;  1VQ5 Q;  3CMA Q;  1VQM Q;  3CCE Q;  3CCU Q;  3OW2 P;  1QVG P;  1K8A R;  3I56 Q;  1YIT Q;  1KC8 R;  1K9M R;  3G6E Q;  1YJN Q;  3I55 Q;  1VQ9 Q;  2OTJ Q;  1VQN Q;  3CCS Q;  3CXC P;  1Q86 R;  1KD1 R;  1VQP Q;  3CC4 Q;  3CCJ Q;  1M90 R;  3CC7 Q;  1YIJ Q;  3CPW P;  2QA4 Q;  3CCM Q;  2OTL Q;  3CC2 Q;  1Q81 R;  3G4S Q; 
#chains in the Genus database with same CATH topology
 3OMC A;  4FSX A;  5EC7 A;  2QGG A;  2V26 A;  2YHT A;  5GAO n;  4KT0 E;  1TXQ A;  2OJ2 A;  4O5V A;  5DLO A;  3CBM A;  1LOJ A;  4AFQ C;  3I5R A;  4KH1 B;  1MNE A;  2KT8 A;  1S72 A;  4RCC A;  1PD0 A;  4MZM A;  4LE9 A;  4NL3 A;  3J80 E;  1VUB A;  2DXU A;  1VQ7 A;  2JMC A;  3RNJ A;  3LW5 E;  4BY6 C;  1IRE B;  4DBH A;  2QQR A;  1SHG A;  2X3X D;  2YWW A;  3GP8 A;  2L3S A;  4JLI A;  4GBQ A;  2EBP A;  2FZC B;  2YUN A;  5GAN 6;  4BDZ A;  4CI0 C;  2DET A;  3VS4 A;  3PMI A;  1PCX A;  1EIF A;  3KUF A;  4KBM B;  1WIE A;  3OW2 P;  4C0G A;  4M78 G;  4IUR A;  1YJ9 T;  1N9S A;  1PD1 A;  1VQ4 T;  1RL2 A;  2EYZ A;  5A0D A;  1GBQ A;  4DOV A;  1R0B G;  3QZ9 B;  1TWB A;  1VQN T;  4KUI A;  1JJ2 P;  3PGG A;  2ZPH B;  1WLP B;  1RAG B;  4HCK A;  1Q86 C;  4J5Y A;  2LZ6 B;  3RKW A;  3CCQ T;  4E2F B;  1GFC A;  2V8K A;  1Q81 U;  2DE0 X;  2EKO A;  4QQD A;  1D1B A;  3OYH A;  1UHF A;  4PNO A;  3CEY A;  4PLI A;  2AKL A;  2E1H A;  2MWP A;  1AEY A;  3FJ5 A;  2F5T X;  3UPU A;  5KH6 A;  2OAW A;  4C8Q G;  4BD3 A;  1UGQ B;  2CSI A;  2O31 A;  2QDY B;  3ME9 A;  2CZ6 B;  4EIK A;  3OW2 A;  4FW1 A;  5A2Q E;  4AFS C;  1YJN Q;  1PRL C;  5LJ3 e;  2NUT B;  1VQ4 A;  3M5A A;  4Z02 A;  2DER A;  2JJ9 A;  5IH2 A;  1OEB A;  8AT1 B;  2EQU A;  1OU8 A;  2H3E B;  3QDR B;  5J3B A;  2ZCF B;  2A3L A;  1NYF A;  4C5H A;  2KAF A;  4KGZ B;  4ORZ A;  3G4S A;  3KFV A;  1BK2 A;  4C0F A;  2RK2 A;  1E6H A;  1YWP A;  2LT4 A;  4C92 C;  2HZY A;  1PSE A;  4C92 F;  3OS0 A;  2DPP B;  1W6X A;  5C6S A;  1C1A A;  4M7D D;  1ZSZ A;  1ZQ1 A;  1M1G A;  1NJI U;  4B9X A;  2LQN A;  2J7I A;  2EYY A;  3OYC A;  4DBQ A;  4ELZ C;  5D6X A;  1WHH A;  1G83 A;  1ZUY A;  1MMD A;  1PKS A;  2VUB A;  3UWN A;  4M7A G;  4M7D F;  3PFS A;  1WDX A;  2I2L A;  1R0C B;  4C92 A;  2E41 A;  1ZA1 B;  2DIQ A;  2RPN A;  1K73 R;  4J9E A;  1GXI E;  2JVV A;  2M1H A;  3NTK A;  1NPP A;  2RHZ A;  2JM9 A;  2O9V A;  2LQ8 A;  5I2S A;  1VQ9 Q;  1PHT A;  2BKD N;  3F70 A;  2HQX A;  1UGP B;  2E65 A;  1FMK A;  1I1J A;  2Y90 A;  2KVQ G;  2L0A A;  1M90 U;  4JRK A;  4WTO B;  4RMO A;  2K5L A;  4JDS A;  4WCI A;  2EQI A;  3RUX A;  2EQJ A;  1SSF A;  4C8Q B;  3JB9 H;  1AD5 A;  1NJI R;  2A7Y A;  4PJM A;  2C06 A;  4PJL A;  2DBK A;  2F2V A;  3OYL A;  4J9B A;  1SF9 A;  4XTY A;  4RTW A;  4OB1 B;  3CCE A;  1XJW B;  3MET A;  1O75 A;  2DF6 A;  4M78 D;  2P0K A;  3DLL A;  1PSF A;  2EJ9 A;  2EYX A;  3P8B B;  1AVZ C;  2CP5 A;  1YHQ A;  4M78 A;  3CCV T;  2P4T A;  4M7A F;  1Y96 B;  1M1F A;  2ZPE B;  4XTX A;  2DTH A;  1UB4 A;  1QVG A;  2HCK A;  3UDC A;  2LQK A;  4ZNX A;  1X6B A;  4FCY A;  2ATC B;  3PMT A;  2JNG A;  4M7D G;  4LXC A;  4J9F A;  1JO8 A;  1S1N A;  5EG2 A;  3CC2 Q;  2FPD A;  3LGF A;  1MND A;  4LN2 A;  1PC0 A;  1VQ8 T;  1N27 A;  1Y7X A;  2PUO B;  1VQ7 Q;  3JCM b;  3CCQ A;  4MDW A;  3I55 A;  1KQ1 A;  2K4Y A;  4AFU C;  1H8K A;  1WJS A;  2P4R A;  2RH2 A;  2RF0 A;  5LJ3 h;  4OB2 B;  2IIM A;  1K4U S;  5CKD A;  3EG3 A;  3X24 B;  1M1K U;  2RK1 A;  3M4G A;  1JXO A;  1VQN A;  4CC3 A;  1TS9 A;  4M78 C;  3T9N A;  2HEQ A;  2KYM A;  4C8Q A;  1JJ2 S;  5IN1 A;  2L3P A;  2RHX A;  1YJ9 A;  1Q81 R;  2G3R A;  4M77 D;  4AT1 B;  4BI3 A;  3M54 A;  1UGV A;  1QQJ A;  2GCX A;  4B6M A;  3JCM V;  2DVE A;  8ATC B;  5LJ5 h;  3RER A;  2MIO A;  4FT2 A;  2K3Y A;  2SEM A;  1QVF S;  5I11 A;  1TUD A;  1YWO A;  3QO3 A;  3CC4 Q;  1WI7 A;  2B86 A;  1MMA A;  2XG8 D;  2ZPG B;  4XAX B;  1Q82 R;  2ZAE A;  5KCO A;  1VQ6 T;  2A28 A;  2FB7 A;  1M27 C;  3CMA Q;  6AT1 B;  3L1A A;  2X4X A;  3OYE A;  1NG2 A;  4M77 B;  1G8X A;  2RJC A;  1XTD A;  2GF7 A;  2HQE A;  3CC2 T;  2XMF A;  2CRE A;  2HMA A;  3CBO A;  2ABL A;  3V8L A;  1OV3 A;  1NEG A;  2E5Q A;  3R6N A;  3MEV A;  4BE1 A;  2KI7 A;  1LVK A;  5GAM e;  2OTL A;  2EAY A;  2RA2 A;  4XQ3 A;  2ENM A;  5GAN j;  1W4S A;  1WQ7 A;  1XOV A;  2KQW A;  4X9D A;  5D6Y A;  3JCM d;  2CP2 A;  2F2X A;  2KRN A;  1T0J A;  2YLB A;  3HFO A;  4XTU A;  1KK7 A;  3J81 E;  1Q82 U;  3QDF A;  2Z0W A;  4LDV A;  3CCL Q;  1WGS A;  3A8H B;  2YLC A;  3OBW A;  3E9G A;  2D8J A;  4M7D B;  2LJ3 A;  2PUK B;  3OB9 A;  4IUV A;  4M7D E;  3TEE A;  3A8G B;  2K3X A;  4JJB A;  1OOT A;  2XD0 A;  1WJR A;  1VQL A;  1VQM T;  2C0T A;  1VQ8 Q;  5GJW B;  1UJY A;  4LDY A;  2V8J A;  1BI3 A;  4A4K A;  1Y0M A;  3GF5 A;  1G3W A;  2DNU A;  1M1K C;  4BAC A;  1NZ9 A;  1VA7 A;  5HCK A;  1RUW A;  2QG9 B;  1T3L A;  1I81 A;  1Q7Y R;  1QMC A;  2G6F X;  3CCV Q;  1VQ7 T;  1D0Y A;  4LD9 K;  4HCZ A;  3EGX A;  1M1K R;  4C92 D;  1I07 A;  4Z8A A;  4PK4 A;  3FDR A;  1X27 A;  4MDX A;  1S72 T;  5GAM d;  5LJ3 d;  1YIT T;  2O4X B;  4FT4 A;  3QXE B;  3G71 T;  2L89 A;  3VRY A;  1VQP T;  4QVC A;  1QW1 A;  3OY9 A;  3E1S A;  4A53 A;  5GAN 2;  2KR3 A;  2KGT A;  3O8V A;  1OQK A;  1SPK A;  4ANJ A;  2VB6 A;  1M30 A;  1O9S A;  1YHQ Q;  3CCR T;  2XID A;  4JRI A;  2KDS A;  2K9G A;  2RQT A;  3WVD B;  1TG0 A;  1UHC A;  1QVG P;  1VIE A;  3M59 A;  3GNG A;  5CCA A;  2D6F A;  4E7Z A;  3REA B;  2QEX T;  1H64 1;  2CP3 A;  3CCM Q;  3C12 A;  3LX7 A;  5GMK j;  2QTV A;  3E2U A;  2M16 A;  4PFP A;  1M5Q 1;  4BY6 B;  2A08 A;  3VS2 A;  1JJ2 A;  2YSQ A;  2V1R A;  2D9T A;  3JB9 I;  1BIA A;  1UEB A;  3OYF A;  4E7J A;  3CCL A;  1UGR B;  2CP7 A;  3OQ5 A;  3TQ7 P;  1PKT A;  2CUD A;  2NWM A;  1ZUK A;  1YIJ Q;  1WYX A;  4M75 D;  3S6W A;  2HNI A;  1VQ6 Q;  2RHU A;  1HYO A;  4K11 A;  3VS6 A;  1OZ2 A;  1K73 U;  2DAQ A;  4BE2 A;  5HY6 A;  3SWN B;  2VV5 A;  1AWW A;  4KRT A;  4RTX A;  2AHJ B;  2ZGW A;  2HBP A;  1JB0 E;  2Y4X A;  1VQ4 Q;  1H92 A;  1X6O A;  2Y4Y A;  3HHT B;  4C8Q F;  2LTO A;  4IKF A;  1QP2 A;  2VWF A;  1TTH B;  1SKU B;  2J6F A;  4PJN A;  1YBY A;  4QVZ A;  3S3O A;  5IXF A;  1VQO T;  2FRY A;  2RQV A;  3CBP A;  2IVW A;  3KBG A;  4IUT A;  3CCM A;  2JTF A;  5FU7 B;  2COZ A;  1NEB A;  2MPX C;  2QDL A;  2LCS A;  1B7T A;  3H0F A;  2FPF A;  1ABQ A;  1QVF A;  2EJF A;  2YUP A;  1NJI C;  3CD6 T;  2VKN A;  2QQA A;  2ESW A;  4RCB A;  1T3S A;  5GMK e;  3CCU T;  1M3A A;  3V7S A;  1YIJ A;  1RAA B;  3OYK A;  5KYN A;  4MZT A;  2XIC A;  4D8K A;  4OVA A;  2CZ7 B;  3CME A;  2XK0 A;  1YJW T;  1TSF A;  3LH5 A;  5C0M A;  2BTT A;  3M9Q A;  2OTJ T;  3QII A;  1FX7 A;  1TH7 A;  2ROT A;  1YJN T;  2NLU A;  3L42 A;  1X2K A;  5GAO l;  1LCK A;  3M0Q A;  2DZ9 A;  3EH1 A;  4PFO A;  4ZGJ B;  1Q86 U;  1KQS P;  3LH0 A;  2FVU A;  1W2B S;  2DRK A;  1A0N B;  5LJ5 e;  1B3Q A;  4FIB A;  4JRP A;  4J9D A;  4HXJ A;  3HRU A;  4M7A B;  1CKA A;  1MMN A;  2DL5 A;  2DL7 A;  3THK A;  4FL6 A;  5HK3 A;  4JJN K;  5CAI A;  3O5Z A;  4DEX A;  4XTZ A;  4N4G A;  4QQG A;  2OTL Q;  2AT1 B;  4RKU E;  1RI0 A;  3MP8 A;  3X28 B;  4P5N A;  2L3R A;  4M7D A;  2HSE B;  1H3H A;  1SRL A;  3MJX A;  2FG0 A;  1BI0 A;  4M77 G;  3RMS A;  4EMG A;  2O01 E;  3I56 Q;  3DLM A;  2DK3 A;  4DA4 A;  4Y91 A;  1YIJ T;  1X01 A;  4QKU A;  2D0Q B;  3P8D A;  2D1X A;  4JS4 A;  1KQ2 A;  2DD5 A;  2QI2 A;  4LDX A;  2FO0 A;  5I2M A;  5I22 A;  1QWF A;  4JLG A;  5KE3 A;  4E7I A;  2K57 A;  1Q82 C;  3CCR A;  4TVR A;  2MI6 A;  3EHR A;  1BKB A;  3CCU Q;  1RI9 A;  2HL5 C;  3BE3 A;  5GAN 7;  5GMK i;  2YXY A;  4L59 A;  2W0Z A;  1IB8 A;  2M9U A;  3QJY A;  1JU5 C;  1Y57 A;  1UGS B;  3RKX A;  3G71 A;  1VQK T;  2DRM A;  1K0X A;  3PNW C;  1VQO Q;  3EAE A;  3GLX A;  3OYJ A;  3I55 T;  2ECZ A;  2EGA A;  3I9Q A;  1ZBJ A;  5DM7 R;  4MMK A;  5CQX A;  1HSQ A;  2MYS A;  1KD1 R;  1M3B A;  3PVQ A;  4PJO D;  2FYK A;  1FXX A;  1XQH A;  3JCM e;  4E7L A;  2FL7 A;  1GCQ C;  2LT1 A;  1IRX A;  4N4H A;  4F16 A;  5GAM j;  4HVV A;  2KSS A;  3I35 A;  1VQL T;  3FIF A;  1VYT A;  1XNI A;  3VUB A;  3JCM h;  4CC7 A;  5CR2 A;  2HSP A;  4FM4 B;  2BZX A;  3CCE T;  1HD3 A;  4C0D C;  1C6V X;  2NUT A;  2RHY A;  2D0N A;  3M0S A;  4ME7 A;  1M2V B;  1KG1 A;  2F69 A;  3C4S A;  1ZLM A;  3CD6 Q;  1KHI A;  2DVJ A;  1N8R U;  3L2R A;  1WXU A;  2RD1 A;  1D09 B;  1YJW Q;  3VJP A;  4PLL A;  4C92 E;  3S3N A;  4F17 A;  1K8A R;  2E4H A;  2X3W D;  1ABO A;  2FZG B;  2JM8 A;  4V2S A;  3DB4 A;  3QYG B;  1JEG A;  1N6A A;  2O2O A;  3VUZ A;  4XTW A;  1M9S A;  3G7Z A;  1ZA2 B;  5KYW B;  3EGX B;  3NFC A;  5AYF A;  2HDA A;  2EVR A;  5GAM g;  1NM7 A;  3HL8 A;  1G5V A;  2GQV A;  2LC4 A;  4IIO A;  3M0T A;  3X20 B;  3JCM X;  2CS7 A;  1KHC A;  3ZL7 C;  5LJ3 j;  2L3Q A;  3VRZ A;  2DO3 A;  3EH2 A;  3VS5 A;  2CUB A;  1K9A A;  4M7D C;  2MCN A;  1BI2 A;  2COW A;  1VQP A;  3QHS A;  4ZTJ A;  1WNL A;  1T0H A;  2RB6 A;  1LNX A;  4Z89 A;  2XDD A;  1VQL Q;  2EGE A;  1CSK A;  1NPR A;  3TCJ A;  2DJZ A;  4J9I A;  3WVE B;  1WHK A;  5FU6 C;  1AZG B;  2CKK A;  4J6W A;  1K9M R;  4PJJ A;  2KRM A;  5HKC A;  1M2V A;  2JS0 A;  2DL3 A;  2HL3 A;  1R8O B;  2MAM A;  4XK8 E;  3JB9 D;  3CCU A;  1KQS S;  4WF2 A;  1UJ0 A;  7AT1 B;  3G4S T;  4L5G A;  5FW9 A;  3NMZ C;  2MWO A;  3RKY A;  3CD6 A;  4M7A E;  2JTE A;  4JS5 A;  4OML A;  1ARK A;  3SWN A;  3RBB B;  4HT9 A;  2JW4 A;  1D3B B;  5IXB A;  4J7I A;  4M77 F;  1VQO A;  1W1F A;  4IUP A;  5KYX B;  4N4I A;  3EG2 A;  3HSB A;  1KJW A;  1F1B B;  1SEM A;  3D7S B;  4YTL A;  4JPB W;  3C94 A;  2KXD A;  4PJO G;  4CC2 A;  3JCM Q;  3JB9 J;  1B34 A;  4A4F A;  5KYY A;  3FJP A;  3CXC P;  2DL4 A;  1IZ6 A;  2BZ8 A;  1I5O B;  3DKM A;  2P0P A;  2DM1 A;  1MV3 A;  4DEY A;  4DBF A;  1KC8 U;  1KSW A;  3LLR A;  5FRO A;  3CC4 T;  1K8A C;  4E47 A;  2K3B A;  2CH4 A;  2YRV A;  2OTL T;  3FRN A;  3BW1 A;  2WSC E;  1BB9 A;  4XU0 A;  3EGU A;  2DZC A;  3PVL A;  4ESR A;  5GAN e;  2CT3 A;  4FYX B;  2E10 A;  2OI3 A;  3EFS A;  4M78 B;  3OMG A;  3OYA A;  1JXM A;  3MEA A;  4HA8 A;  3CC2 A;  3PIO A;  3CC7 A;  4M75 F;  5FWB A;  2KNB B;  2QQB A;  4IUQ A;  4M75 C;  2LRQ A;  1DJ7 B;  1WPY A;  3X26 B;  4OMP A;  1VQ6 A;  4J83 A;  2E6Z A;  1X69 A;  2KE9 A;  2J05 A;  1K73 C;  3VKI A;  4OP0 A;  1OUL A;  2ED0 A;  4NOY A;  2KRS A;  3HTR A;  2QEX A;  1V76 A;  2DD4 A;  1UEC A;  5AT1 B;  1QCN A;  3GPL A;  1UG1 A;  4Y28 E;  3CCJ T;  1MHN A;  4FYV B;  3REB B;  1GBR A;  2XDB A;  1FMV A;  2FZK B;  2AK5 A;  2HAX A;  2E64 A;  3NGP A;  3CCS Q;  4KUD K;  2K79 A;  2QGF B;  3P8H A;  4F7U F;  2XKO C;  3FC3 A;  3JCM P;  4Z88 A;  3HPW A;  3OYI A;  1U1S A;  4C8Q C;  4R0K A;  1YIT A;  5FLX E;  1GFD A;  3EG0 A;  3X25 B;  1ZX6 A;  3QWX X;  3M0U A;  1VQ8 A;  4RTU A;  4PKC C;  2JZ2 A;  2DXC A;  1RAE B;  4OGE A;  1W2B A;  5IT9 E;  1AZE A;  1PNJ A;  1QCF A;  2R58 A;  4D8D A;  1U1T A;  3SFM A;  1VQ5 Q;  3CC7 T;  4X1V A;  2V1Q A;  4J9H A;  3HFN A;  1YHQ T;  4PL6 A;  1M8M A;  3EHQ A;  4A54 A;  1IXD A;  1WFW A;  3VS1 A;  3L2V A;  2HKN A;  1QVP A;  2YUO A;  2VGN A;  1VQP Q;  5CQY A;  2YT6 A;  4C5E A;  4L6V 5;  4LDU A;  2XDP A;  4EPC A;  2NUZ A;  5L23 A;  1VQ9 A;  2E5K A;  2CGH A;  2KRO A;  4PFZ A;  1KQS A;  4M77 A;  3H9N A;  1Q81 C;  3CC4 A;  1HJD A;  2RHI A;  2EYQ A;  1IGU A;  5GMK h;  1G2B A;  1QVG S;  1QKW A;  3C95 A;  4M4Z A;  3QZ5 B;  1OZ3 A;  3ASK A;  2PNI A;  4FW2 A;  2DTO A;  1GRI A;  2X4W A;  3CME Q;  1OPK A;  1WHL A;  3OS1 A;  2CSQ A;  3NTH A;  4RTV A;  2GTJ A;  3V8K A;  2A36 A;  5GAN g;  4Q5W A;  1ZSZ C;  1I0C A;  4ZN3 A;  1JRI A;  2LX9 A;  1Z9Q A;  2C0I A;  2QTX A;  1Q86 R;  3JCM c;  4XU1 A;  2EQK A;  2ZPF B;  3CPW A;  1AWJ A;  1D1A A;  2KY9 A;  2JUF A;  2RJD A;  1RLQ C;  2DBM A;  3S3M A;  2V8I A;  3M0R A;  1K76 A;  1D0Z A;  4EMK A;  3EFO A;  1NBE B;  1VQ5 T;  1ZHI A;  2RMO A;  3HKS A;  4C5G A;  3VS7 A;  4JJD A;  3VYH B;  3JB9 F;  3SHW A;  3VU3 C;  3CCJ A;  1X43 A;  3L2U A;  3OBY A;  2P84 A;  5LJ3 f;  2DYB A;  1FMW A;  2M0Y A;  3PT9 A;  1WJQ A;  2K7A A;  2JOY A;  4RUG A;  3MP6 A;  3OYN A;  1NLP C;  1WHM A;  2E3H A;  1HXD A;  4RG8 A;  1W70 A;  1VQ5 A;  2XU8 A;  4LUD A;  2HKQ B;  4J9G A;  4OF1 A;  1OX8 A;  4A4G A;  5KYW A;  3JRZ A;  3M4Y A;  4M77 E;  3V7C A;  1EZZ B;  3QUI A;  1WXT A;  3CXC A;  2O4X A;  1WHG A;  2RI3 A;  3A98 A;  1X75 C;  5DY9 A;  1EX4 A;  1D1C A;  5I21 A;  1QKX A;  2AIR B;  2IPO B;  1QP3 A;  5GAO p;  2NYS A;  2DJQ A;  4F7U A;  2VYT A;  3EFR A;  2DLP A;  1M90 C;  2E3I A;  3EFO B;  4C0Z A;  2BIV A;  2RQU A;  1PWT A;  4GY5 A;  3JSC A;  4CC4 B;  2XHC A;  1VQK Q;  2WSE E;  2JXB A;  1Q95 G;  3JAM E;  4M75 E;  4E7K A;  2NUP B;  3CCV A;  4PJO E;  3J7A F;  2DXB A;  5KYU A;  3GOX A;  3CCS A;  1OPL A;  1K9M C;  3SB2 A;  3I55 Q;  2OTJ Q;  1IHW A;  3FEO A;  4QQ6 A;  1U3O A;  1M2O A;  3MEU A;  2KYB A;  1P92 A;  2LDM A;  1M8V A;  3EGD A;  4AMC A;  4DQ2 A;  3PIP A;  4EMK B;  3VYG A;  4OMF B;  3LWH A;  3OS5 A;  2A37 A;  4J8O A;  2QQ9 A;  2CZ1 B;  2WSF E;  3U23 A;  1N8R C;  2DFU A;  2VXF A;  2FEI A;  2C0O A;  2RQR A;  3SEM A;  2QXF A;  3H6Z A;  3H41 A;  2VAS A;  4M75 G;  3HP9 A;  2DL8 A;  3URG A;  5LL6 S;  5GAN f;  2XI9 A;  4OB3 B;  3A1P A;  1YI2 A;  1K0S A;  3JV3 A;  3NTI A;  5KYU B;  1X6G A;  2NUP A;  3GIB A;  4II1 A;  3KXT A;  1HK9 A;  2R5M A;  2ZZD A;  5LJ5 f;  5LJ3 g;  2QEX Q;  3QG1 A;  1OU9 A;  5KYY B;  5GAN h;  2CT4 A;  1SRM A;  1VQN Q;  1U5S A;  5ECA A;  2M0O A;  3OYD A;  1M3C A;  4EMK C;  2DYI A;  2JTM A;  3PE0 A;  2RN8 A;  4KGX B;  1SSH A;  4F7U E;  1RLP C;  5CIU A;  5GAN 5;  3CCQ Q;  5KYX A;  2K6D A;  1RAF B;  2KT1 A;  9ATC B;  3EG1 A;  1G3S A;  3BDU A;  3CCE Q;  1I4K 1;  3TU4 K;  4ZN1 A;  4M7A A;  3OYM A;  2LP5 A;  3TSW A;  1MUZ A;  1TOV A;  2F2W A;  3H8Z A;  3NPF A;  2EW3 A;  1N9R A;  4PJO A;  2RO0 A;  3FLG A;  3RMQ A;  4UC4 A;  3LGL A;  4M7A D;  1YJ9 Q;  2CDT A;  2LNV A;  2X4Y A;  5GAM h;  5FRM A;  2LCC A;  3A8L B;  5GAO r;  4HT8 A;  4IUU A;  4N0A C;  4C8Q D;  2PZ1 A;  3UF4 A;  1Z9Z A;  1MMG A;  2H8H A;  2LJ1 A;  2DTI A;  2AKK A;  2DX1 A;  4HKE A;  1Y71 A;  2DKG A;  2R5A A;  3QJ6 A;  2E6N A;  3E9F A;  1K9M U;  1E7O A;  1M4Z A;  2FPE A;  5FU7 C;  2W10 A;  4KUL A;  4AG1 C;  3OYY A;  4ZGD B;  1I8F A;  2QK0 A;  2QYZ A;  1VQM Q;  1SG5 A;  2K5I A;  1ZUU A;  1OYX A;  3QPH A;  4X34 A;  5IAY A;  1BBZ A;  4QT7 A;  4AFZ C;  4BB7 A;  4CRI A;  2MF2 A;  2PVG B;  4F04 B;  2SRC A;  5IHI A;  4HVU A;  3M57 A;  3ER0 A;  1YI2 Q;  4DBR A;  1BCM A;  1UTI A;  4FSS A;  2L8D A;  5A0L A;  4A4H A;  1JQQ A;  3AHU A;  5GAN d;  2HD0 A;  2L2P A;  2YDL A;  1ACM B;  2OX7 A;  4JUV A;  3SWN C;  2VXE A;  2RQW A;  2KBT A;  2A0F B;  3M53 A;  1TU0 B;  2JN0 A;  4PJO B;  3Q1J A;  5IHK A;  1RAC B;  1BIB A;  2DIG A;  2B8A A;  3BDL A;  1QCO A;  2FHD A;  1GL5 A;  5LJ5 j;  3BFM A;  5D7U A;  3N5B B;  3OSS C;  2K2M A;  3G6E A;  3L2Z A;  1I5L A;  1WXB A;  4XU3 A;  1N5Z A;  4FYY B;  1B34 B;  1S72 Q;  4HCB A;  2M02 A;  2JMA A;  2DEU A;  3TRE A;  3JCM g;  2J6O A;  1YIT Q;  1UUE A;  2ZPI B;  2L5Q A;  4IIM A;  2PVO B;  3ZFJ A;  2JS2 A;  2EYW A;  5GJV B;  1RAB B;  1IO6 A;  2LJ0 A;  2F5K A;  2EQM A;  1OI1 A;  1QVF P;  2R57 A;  1CKB A;  3A8M B;  2GNC A;  1MGQ A;  1VQK A;  5CKH A;  2BE7 D;  2GGR A;  3LYI A;  2LX7 A;  4M78 E;  4B9W A;  4E7S A;  2MK5 A;  1MV0 B;  4OMQ A;  2EPD A;  1W2B P;  1Q7Y C;  4NL2 A;  4R55 A;  3VS0 A;  3M0P A;  1R77 A;  4OB0 B;  2GQI A;  2DMO A;  3OA6 A;  3BY7 A;  3I5S A;  5IHN A;  5CKF A;  4PJO C;  3H0H A;  1FYN A;  1PRM C;  3IQL A;  3ULR B;  4ATO A;  5CKE A;  1AOJ A;  2CZ0 B;  4KH0 B;  3G4S Q;  2KK4 A;  4FU6 A;  2RJF A;  3INZ A;  2DIL A;  2FRW A;  4N0A A;  2BE9 B;  4JZ4 A;  2AZS A;  2RI2 A;  5M9O A;  2CP0 A;  2CH4 W;  1Y96 A;  3RDV A;  4C8Q E;  4E6R A;  1B07 A;  4O6J A;  3GBQ A;  3RES A;  2ZPB B;  3V8J A;  1UE9 A;  4FYW B;  4F7U B;  3GNF B;  3RIR A;  5CKB A;  1KD1 U;  3MPU B;  3QKJ A;  1V29 B;  1YCY A;  3UAT A;  5GAO m;  3ZEH A;  4ZTF A;  1BU1 A;  1UFF A;  2DEQ A;  2ROL A;  2YRC A;  3OYG A;  5DLQ E;  2LNH B;  3I56 T;  4KGV B;  4X9C A;  3H0I A;  5J39 A;  3G6E Q;  1WA7 A;  4A4E A;  1YJN A;  5GAN 8;  3MO8 A;  3CCJ Q;  2E12 A;  5KCH A;  1YJW A;  2BUD A;  3CXC S;  1BYM A;  2RM4 A;  3L2Q A;  2I0N A;  5L8R E;  4DOW A;  2K5F A;  1WQW A;  4ZGE B;  5GMK l;  1U06 A;  1X2Q A;  2GFU A;  2QAS A;  3UA6 A;  4BUG A;  1AHJ B;  2KXC A;  4QVD A;  5KE2 A;  1YI2 T;  2MOX A;  4M75 B;  1OX9 A;  2D8H A;  2RJE A;  2VGM A;  1AWX A;  2DXT A;  1ZSG A;  1PM3 A;  2DA9 A;  4MZP A;  4C0D B;  3ZBD A;  1ZBX A;  3M58 A;  1VQM A;  2GFA A;  2YRD A;  5LJ5 g;  2HBW A;  3NHN A;  3EG9 B;  4M77 C;  3VS3 A;  1Q7Y U;  1J3T A;  2EWN A;  4OGC A;  3FB9 A;  4XU2 A;  4BI8 B;  5GAN 4;  3CCS T;  2AZV A;  2LCL A;  1LJO A;  3EGD B;  2QA4 A;  1VYV A;  5CK9 A;  4F7U G;  4AG2 C;  3VV0 A;  4MML A;  2EJG A;  4ELY C;  2HQH A;  3CPW S;  1V1C A;  3CCL T;  4J6Y A;  1RAH B;  3AT1 B;  2QAZ A;  2VC8 A;  1C0M A;  2GBQ A;  3HRS A;  1KC8 R;  4C92 B;  1LPL A;  5GAO q;  1SHF A;  1GCQ A;  4C5I A;  2RNA A;  2O9S A;  3CC7 Q;  4J7F A;  3C0C A;  2OAU A;  3RR6 A;  1NLO C;  1IGQ A;  4BDY A;  3M56 A;  1VYU A;  3CPF A;  5FWC A;  3OSV A;  1KD1 C;  3CMA T;  3CMA A;  2P0Q A;  1YP5 A;  1D0X A;  4A63 B;  5HK0 A;  3DB3 A;  3QWY A;  4M78 F;  4GLK A;  1WX6 A;  3L2W A;  1AWO A;  1TUC A;  3SD4 A;  1D3B A;  2PU9 B;  3JB9 G;  2MMP A;  2OTJ A;  1IHV A;  2H3J A;  4C92 G;  4E7H A;  1EFN A;  4BE0 A;  5FU6 B;  3TVT A;  5LJ5 d;  3CME T;  2EGC A;  1K1Z A;  3EG9 A;  3MCA B;  4LD6 A;  3A8O B;  4GLM A;  4RG2 A;  2QA4 T;  2PQW A;  1RAI B;  2COY A;  2EIF A;  4J6X A;  2CP6 A;  2O88 A;  2KMT A;  4LNP A;  4Y92 A;  1U8R A;  5J26 A;  1RAD B;  4HVW A;  4EMH A;  1E6G A;  3QYH B;  4J9C A;  3V7R A;  2J06 A;  4EDU A;  4RTZ A;  4D6W A;  3MP1 A;  4M7A C;  2X4J A;  4RTT A;  3MHX A;  3G6E T;  1H3Z A;  1JBM A;  1TUG B;  3CCM T;  1FWZ A;  4XTV A;  1M90 R;  4RTY A;  2X51 A;  5CO7 A;  2F1L A;  3OYB A;  5GMK m;  1Y07 A;  3G71 Q;  1UDL A;  4QW2 A;  3QSU A;  3A5Z B;  4F14 A;  2LQW A;  1BCO A;  3JCM J;  1QWE A;  2GTO A;  3WXM B;  5GAM f;  4JJC A;  3CQT A;  3JCM f;  2K2V A;  4OMM A;  2LVM A;  1KIK A;  1KC8 C;  1K8A U;  5GAN 3;  1VIF A;  2BZY A;  1YNZ A;  4OMO A;  2EKH A;  2CYZ B;  3I56 A;  1KFZ A;  1N8R R;  4JZ3 A;  1VQ9 T;  5CVI A;  3UA7 A;  3G1J A;  1G3T A;  1YFN A;  2KEA A;  1NE8 A;  1PG5 B;  3PTA A;  4BI4 A;  1ZSZ B;  2YUQ A;  4OMN A;  4JRQ A;  1VOM A;  3MKD A;  1QLY A;  3CCR Q;  2VVK A;  4R56 A;  3LWI A;  1AT1 B;  2EFI A;  1BI1 A;  2J6K A;  4VUB A;  3TSZ A;  2PTK A;  2JT4 A;  3OS2 A;  3SDZ A;  2X9H A;  1G3Y A;  3HRT A;  3CPW P;  2QQS A;  4NS5 A;  3MEW A;  2ED1 A;  2WAC A;  1WHJ A;  2RI5 A;  1YCS B;  2M51 A;  4LDW A;  5D6W A;  2X35 A;  2IG0 A;  2LMJ A;  4PJO F;  3E19 A;  1GCP A;  3QBY A;  3OW2 S;  4LUE A;  1YN8 A;  3UT1 A;  3M55 A;  4HCC A;  1WZO A;  2E70 A;  3JCM W;  4M75 A;  5FRN A;  5A0G A;  2QA4 Q;  2PVD B;  3R6O A;  1NYG A; 
#chains in the Genus database with same CATH homology
 3CCV Q;  1VQ4 Q;  1YI2 Q;  1JJ2 P;  1KQS P;  1VQ6 Q;  3G71 Q;  1YJ9 Q;  1M1K R;  1VQ7 Q;  3CCR Q;  1Q7Y R;  1YHQ Q;  3CME Q;  1VQO Q;  1K73 R;  3CD6 Q;  1VQ8 Q;  1Q82 R;  1VQL Q;  3CCQ Q;  1W2B P;  1N8R R;  1VQK Q;  1QVF P;  1S72 Q;  1YJW Q;  2QEX Q;  1NJI R;  3CCL Q;  1VQ5 Q;  3CMA Q;  1VQM Q;  3CCE Q;  3CCU Q;  3OW2 P;  1QVG P;  1K8A R;  3I56 Q;  1YIT Q;  1KC8 R;  1K9M R;  3G6E Q;  1YJN Q;  3I55 Q;  1VQ9 Q;  2OTJ Q;  1VQN Q;  3CCS Q;  3CXC P;  1Q86 R;  1KD1 R;  1VQP Q;  3CC4 Q;  3CCJ Q;  1M90 R;  3CC7 Q;  1YIJ Q;  3CPW P;  2QA4 Q;  3CCM Q;  2OTL Q;  3CC2 Q;  1Q81 R;  3G4S Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...