3CCMV

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ccmV00
4WF9V 1VQPV 1S72V 1VQ8V 1K8AW 3CCMV 1NJIW 3CC7V 1VQ4V 5DM6V 3CXCU 3G6EV 3G4SV 1VQKV 2QA4V 2D3OW 4WFBV 3CCLV 3CPWU 1YHQV 1YJWV 1Q82W 1Q81W 1QVGU 1N8RW 1M90W 1KD1W 1VQ6V 3CCUV 1YJNV 1R73A 2OTLV 3CCRV 3G71V 4WCEV 1K73W 3CCSV 1VQLV 1VQ5V 3I55V 1Q7YW 3CCEV 3CCQV 1YITV 3CCVV 1W2BU 1KQSU 1VQOV 1K9MW 1VQ7V 1YI2V 3CC4V 3OW2U 1VQMV 1VQ9V 1YJ9V 3CD6V 1KC8W 4WFAV 1M1KW 1YIJV 1JJ2U 1VQNV 3I56V 1Q86W 3CC2V 3CCJV 3CMEV 2OTJV 1QVFU 2QEXV 3CMAV
chains in the Genus database with same CATH superfamily
1AB3A 1SQGA 3ASNC 3QF7A 5DM6V 3K04A 1S3JA 2P4VA 3ABKB 1RSOA 1AI4A 1ROPA 4TQFA 3X2QB 1N32B 2PTMA 4FPPA 1OHHG 3JD4A 4A5UB 4LF4B 4ZIBA 5IY5B 4ZHQB 2KQXA 3BAAA 3RYHB 3CMEV 2EIKB 1XDCA 3BPZA 1UJWB 2P90A 3ZMVA 2NN4A 5KMGA 1IBLB 2QA4V 4DV7O 2BOCC 4DR3O 4LF9O 3APOA 2X7RB 4FLXA 1KP3A 4B3MO 2OWOA 4X1IB 2CDYA 2WPDG 5LGUA 2A3QA 3N2GB 2L6LA 4TV8B 4I5SA 4JYYA 4J7JA 3ZMSA 4J9YB 1HP8A 5LBQA 4Q6GA 2BOBC 1VARA 4I9WA 1PNMA 4O4HA 2MK3A 3T1YO 2UXCO 4NVPA 1FXHA 1Q6UA 3E89A 3OR7C 2GBOA 1YITV 3QNEA 4PI2A 3LDDA 1FXKC 5LMNB 4MS2A 2F66C 4UCSA 4LF5O 2LQTA 1QR9A 4I50A 3A8TA 1BQ0A 2UUCO 5IJ0B 3H1IH 4FFBA 4JTDB 2EINC 4DR5O 5EYPB 4WCEV 3B2EE 5LHIA 3JATB 1NVPB 2YXLA 3ASOB 2YICA 4WFEA 1NTMH 4X20B 3K58A 4OPAA 3BABA 1NI8A 4PDMA 3ZRSA 4NXMB 3HKEA 3TETA 3BA9A 5B66Z 1V9PA 1H2MA 3IGAC 1BT8A 1PPJH 2IH1C 1FXVA 2DYSC 2EX3A 4DK1A 1N36O 1F51A 3ZHTA 3S3XA 5GTIZ 1WA8B 2P06A 1S76D 2ZIMA 3U0ZA 3JSLA 1HW7A 4ZHQA 1IXMA 2Q5ZA 5LGTA 2FB5A 3CYOA 5JQGA 1AJQA 4X9QA 4DYLA 4MT8A 1W2BU 2DJVA 2ZR3A 3T1HO 3CC2V 4JAUA 1Q5OA 3JAKA 4DV0B 2UXNA 3JAKB 4DV5B 2IW5A 3J7AU 1PP9H 2W6JG 3OTOO 2W6IG 3H1JH 4EEQA 1L1FA 1S77D 4TT3G 1AR4A 3VQWA 2B9ZA 4U3JB 4PA4A 4JZ2A 5L3FA 4DV1O 4DV4B 2VS0A 4H44B 2DQ0A 4RWUA 4F6EA 3FYIB 3ZN1A 3W7TA 4FM1A 2M6YA 2Z3YA 3KCYA 2Q67A 2ZE7A 2Q9LA 1AP5A 3AG4B 2CH7B 2Y0PA 3ETGA 2IJJA 1AILA 2DQ3A 5IDJA 4X66O 1R73A 5EK0A 3MD0A 3R66A 1XBLA 4X1YB 2HJDA 4GT1A 3CC4V 2ITDC 1BMFG 2R9RB 1NZ6A 3OUSA 4IYHA 2XAHA 2H8PC 3ZCCA 1K4CC 3Q4HB 1SZTA 3S3WA 1R3KC 4B3SO 2QTSA 3K06A 1O9HA 1JFFB 3UCSC 1FYJA 3TXSA 5B5EZ 4CH4A 2DE0X 1SA0A 1VQOV 4B3RO 4GCZA 4TV9A 5CA0B 2A0LA 1OCRC 4GX0A 1RPOA 2CTRA 2F4VO 4WFFA 2QM4A 1VQ6V 3E22A 2KKWA 4DW0A 3BRCA 1HR0O 4E2LA 2JGDB 3RYHA 1LR1A 4XDLA 1XHZA 2M7WA 3SJAC 3SPIA 3AG3B 1QLEB 3HKCB 2LGWA 1TUBB 4DV3O 3ASNB 3GVMA 3CJHA 4CZZA 1AI6A 2HHHB 4W4KA 4LFCB 3CJHB 3A0RA 4FVMA 4KHPO 4RUFA 3G4SV 3D36C 1QVGU 1YXBA 4P2ZA 5A9GA 5L3BA 1R3LC 4PA3A 4FLTA 1W0KG 2LJ2A 3JALB 1H2KA 3ETDA 1LUVA 4FJCC 2GUZA 2AGAA 1EBOA 4L87A 5FPRA 2LFSA 3GWKC 4FLVA 4FLUA 3FB8C 3ZRVA 1PKXA 1IBMB 1FXKB 5KAIZ 1ZWIC 4B3TO 1Q82W 1NT2B 2OYQA 1KD1W 2IJKA 3CCUV 4G27B 1XMOO 5IYZB 2V7QG 3A0BZ 3LNNA 4TUYA 1VP7A 1IBKO 4JI4O 1HNZB 4LP8A 3KCXA 1OCZC 2ZR2A 1URFA 4X62O 1QBZA 1B06A 3EHBB 1VQPV 2GSMB 3VQYA 4XDJA 2OT5A 2IBZH 3HKBA 4JI6O 4H33A 4WBNB 3QO5A 4YY3B 3QVNA 2FKXA 1K33A 1JA8A 1L0LH 2DOSA 1MSDA 3OEEG 3OM3B 1Q6IA 4YJ3B 5GONA 1OV9A 1NH2B 3FKSG 4YJ2A 2ZDIC 2Q4PA 1TAEA 3TGUH 5KMGB 1NU1H 4D7SA 4YHHB 5GONB 2UXBO 1PV0A 3L70H 3ZIAG 3N2KA 2QJ1A 3SYOA 2JEXA 4E4EA 1NTZH 5DECA 1V55C 3BFRA 1GM9A 2Q7GA 2XOKG 2CGOA 3ABKC 3U11A 1YIJV 3H1HH 2F95B 2DW4A 4K0KO 4HAMA 5IYBO 2A79B 4JI3O 1WP8A 1XL6A 1YVWA 1DF4A 4K8ZA 4DR1B 4Z2WA 2EIJB 4YXWG 4W4LA 4QPKA 1JCHA 3NXSA 3FB6C 4JYAO 2UXXA 1Y76B 2UUAO 3E8GA 3L9DA 2QM7A 2X6AA 3ZHUA 4MTGA 3K5OA 3RVZA 2PI4A 2E74B 4ZKIA 3B77A 4UFZA 2N04A 1S0VA 3ABLC 3F5WC 4X64O 1AJNA 4O4LA 1IDSA 5B1NA 4QIWF 3DSQA 1XNRB 5KUMA 3JAWA 2YXHA 4DV6O 5IE9A 3ZMZA 2OCCB 4QE9A 2BTOA 1GTOA 1AP6A 2ZQMA 2AXTZ 2ZIOA 1XHXA 1G6UA 4U7NA 2R70A 5CA0A 2JEUA 5JQGB 4LF8B 3G71V 5CB4B 1ZL8B 3ZBHA 3OE7G 2Q73A 2JJ2G 4GKJB 4DR4O 2L35A 2HLDG 3WFVA 3B4SA 1XNQO 2VRZA 3QO7A 2WLMA 1FXKA 2PUSA 3W7UA 1VQKV 1S5LZ 1YJNV 1ZLZA 2D2CB 3APQA 3ML0A 5BY1A 2RN9A 5IJ9B 1N34B 1HNWO 3CCQV 5K1XA 2XHBA 1K5QA 2BE3A 1KC8W 4X88A 5B3SB 3WB0A 4Z1VA 1OCRB 3ZHRA 1WJZA 4X1IA 5JCOA 3LSUA 4LF7O 1YHQV 1PM9A 4PD4F 4PELA 1TGOA 4J10A 5E79Z 3SYAA 5HFMA 4DR2B 3CX5F 2VQEO 5KUKA 1GO3F 1VIBA 5KHJA 2Q8VA 5IT9N 3CMAV 4F4LA 1Y4MA 1L8DA 2GUZB 3SDLA 1XMQO 1KKCA 3K3WA 2QWPB 1NTKH 4IIJB 1P7BA 1E1RG 2ADQB 4I4TB 4JYBA 4OX9O 3JSNA 2QWRB 5B1OA 4BIZA 1H38A 3G67A 4JTAB 3M7MX 4DUYB 1BE3H 1I94O 1I5YA 1M93A 3CPWU 5BR8O 1RM1C 1MMMA 5EIBC 1QR8A 1SF9A 1E79G 1NKDA 3SJQC 3ZRWA 1H2NA 4J9ZB 3DXRB 2LW7A 1HNXB 3D36A 1GN2A 4H37A 3FFQA 4I55B 3JARA 5EBMC 1NH2D 1MSWD 5DEDA 2Q0AA 1DGSA 4I55A 5KAFZ 1Q6HA 1QU7A 1AR5A 1VMGA 1THZA 2PY5A 5LMUO 2YSUB 2GTSA 2FL4A 1VF6C 3ABMC 3AK2A 4J11A 5FNVA 2WLLA 2UU9O 1H8HG 2E5LO 4JI2O 2WLLB 4NXNO 1Q43A 4JTCB 1SQFA 2UXDO 1VEWA 3CCRV 1M4UA 2AW9A 2ZE5A 2XAJA 5ITZA 4DUZO 3CSXA 3ZRWB 5JVDA 1SQBH 2QKSA 2UUBO 1SQXH 1GMGA 5FPOA 4HBNA 1SQVH 2QEXV 3QTCA 4ZOLB 3ASOC 3EFFK 1Y76A 4NTWA 1NJIW 1VF7A 4FLYA 4JI1B 4JI7O 5IWAB 1FJGO 4K35A 4I7ZB 4LF4O 1P84F 4AQYB 4O2BA 1RPRA 1EZJA 2CGNA 1K4DC 4GX2A 5KX5B 1XEQA 4TOIA 4DR6B 3P30A 3JASB 3QG5A 5JH7A 4TQDA 3HPLC 1WB8A 4DR3B 4X20A 3FD9A 5EC2C 4LF9B 4QGPA 2KG7B 1NBMG 2H3OA 3HB3B 3RW0A 3AG2B 2WLJA 1Y66A 3CRCA 4UVCA 1WLEA 5EC1C 4GYCB 3RWRD 4YJ2B 5B1AB 2JS5A 1DK1A 2Q6AA 1Z5WA 4DV2B 4MVUA 2WWWA 3RYIB 4Q20A 1J5EB 1YCIA 4HZ3A 4X1YA 2QKAA 4LF5B 4X89A 1CXZB 3UO2A 2P22C 5BMVB 4J7KA 3JAWB 3K08A 3M8AA 4PI0A 4LC1A 1JJ2U 1XOUA 3UQ8A 4MVZA 1U97A 1B6QA 3SYCA 2GHYA 2OIGA 2DWEC 5FLXN 2EIMB 1B3QA 1PL0A 5K1PA 3E35A 1XL4A 5CN0A 3LUTB 5KHGA 3WG7C 3SPJA 1JVMA 3VBBA 3U10A 1YJ9V 1N36B 5F2VO 5EZYA 3E83A 4MW8A 3MDSA 4LFBB 1KKDA 3WB2A 5EZYB 2EINB 3CRRA 4UVAA 2PZSA 2JGDA 1GM8A 4O2BB 3F5TA 3KZIZ 3SGIA 4I50B 4FLWA 1GN6A 2ZDIA 1K3EA 4AI8A 5CBFA 5JWPA 4LBEC 2HP8A 2HR3A 3ETEA 2X0LA 3P32A 4TV9B 4X65B 1WB7A 4HYOA 4GKKB 4JV5O 1GN4A 1R6TA 1N32O 1IZ3A 3KKYA 2MW2B 4X8AA 1AI7A 1RSOB 3JCZA 4D7TA 1Y67A 1WPXA 4ICGA 3EVKA 1I5XA 3H01A 2Q0OC 4NTYA 4LF6B 3W7WA 3AG3C 2DYSB 3I5DA 2OCCC 2PYLA 4I9QA 1K8AW 1UPGA 3D3QA 3RYFB 3FB7C 4X66B 3D8CA 3WU2Z 4JI5B 3CP1A 3IFXA 1WNSA 3GWOA 3RT3C 1RM1B 1DF5A 1JMKC 3B09A 2ZXWC 4CS4A 3ABLB 2ADPA 4B3MB 1T5EA 1N33O 1OCOC 2GDSA 4RQFA 5LL6Y 2WAMA 4UV9A 4U3JA 4LCUC 3WG7B 5ITZB 3CE2A 1TVKB 2DWDC 1N8RW 3SPHA 2KG7A 2QWOB 3E8FA 5EBLC 3RBZA 2Y69B 1FKAO 4YJ3A 2UXCB 2ILMA 2EZOA 5CA3A 1FD9A 2DMXA 3BHPA 4BWAA 3CCVV 2VQFB 4O2AA 4B3RB 5JH7B 2P4KA 1I7FA 2HKOA 1ZSPA 1BZKA 4YIPA 4X1KA 3ABMB 4B7KA 3E22B 1Y74A 2D3OW 1MG1A 2Y69C 2GTAA 1MZFA 1NR7A 1H8EG 4NKGB 2ODMA 4GLXA 1VQ5V 1Q7YW 2Q7EA 2X6CA 4DR7O 5FL7G 2BTQA 4O4JB 5EYPA 1P7GA 3JARB 4CC5A 2QTOA 2XAQA 1WAZA 4LFAO 4TSFG 4RAIA 3UM7A 5GW7A 3T2MA 3G6EV 3JD2A 1O9GA 4CH5A 1Q8IA 2QKCA 2JRIA 4GX5A 3ZRXA 3ZS8C 2ZNIA 3OMIB 2FMLA 3FAVA 3AK3A 5FNVB 5IJ9A 4OXSA 3FB5C 5H9CA 5KHHA 1G1XB 3B8NA 4JYCA 1QLEC 4I0XA 5J9PC 3G80A 1H2GA 4JI8O 1N4CA 4TUYB 3HR0A 1TUBA 4G2KA 3UT5B 1ENVA 2P6JA 5J2TA 3STZC 2ZM6B 2JJ1G 4FM2A 1HNZO 1ZL8A 1EN5A 1FS0G 5L3DA 1KECA 1YSCA 2R9IA 4DV0O 2XASA 4DV3B 1R6NA 5E1AC 4U3FH 3CRMA 4DV5O 3OTOB 1P4RA 4YY3O 2YIDA 3H1LH 1S5JA 1BGYH 4QNHB 3A0HZ 4EB6B 5H6RA 1KQSU 1ZTEA 2CE4A 2N05A 3SJBC 2F43G 2V4DA 5D5QA 2ZT9B 4YHHO 1IBLO 2R9AA 4BW5A 3MHHC 2LFRA 2EILB 1FFXA 3D3IA 4NTXA 2ETNA 1K97A 3WB1A 3ABUA 2X6BA 2AZ0A 1IXBA 3L74H 3ZN0A 4LH6A 2DYRC 1HDJA 3E86A 2NNUA 1P49A 1GN3A 3SPGA 2WLHA 1Y6XA 2RNBA 3CC7V 1F4MA 3LDEA 3ZHQA 2C2AA 3JALA 4MTXA 3T1YB 2EILC 2UUAB 5LXTA 1WP7A 1SESA 5J2UA 1F4NA 1SS3A 1BCCH 3FYEB 4FFBB 4WF9V 3OMNB 2YIBA 4MTOA 1TUEB 1HR0B 3NR7A 1I0HA 1KMIZ 1YF2A 4PA6A 4DR5B 1XNRO 2A06H 4IYIA 2QR4A 4DV6B 3BY6A 4UCTA 2BCCH 5H5NA 4JI0B 1Q3EA 3RN4A 4O4JA 3BCCH 2LP7A 2QM8A 3ZMTA 1JJOA 3X2QC 5CB4A 3KG2A 1PD3A 2K1EA 1KU9A 3B40A 1L0NH 2XAGA 4R8CA 4LF8O 4KP4A 3JYCA 1QCEA 4UCUA 4ZBMA 1ZX3A 2EIJC 5IYZA 5IJ0A 4WFGA 3C3TA 1M57B 4Z1MG 5JJNB 4KL1A 2AHZA 2ZXWB 1M90W 2A9HA 2E75B 2Q69A 3IAYA 2FTKA 5KLVH 5B1AC 3LNMB 4DK0A 4IHJB 4PDLA 1NVPD 3OFNG 4LWSB 5L3EA 5LP6B 2A7WA 3OD4A 3ABTA 3RYFA 4JZGA 3K59A 3BA8A 1YTFB 3HKEB 3K0GA 1N0JA 1V54B 1DTOA 4N23A 2IJHA 4CH3A 4H0LB 3T1CA 2P7TC 3ZJZA 1RFYA 4MVOA 3PN1A 3C3SA 1BHBA 2R72A 5J2UB 1KP2A 3R65A 4EB6A 3UO3A 2F1MA 4DV7B 2UXBB 4LNUA 1TA8A 2ATKC 3K0DA 5HFLA 1XUQA 2NR5A 4O2AB 2EBOA 1GH6A 4P9OA 3FX7A 1XI1A 4K0KB 1OZ0A 1B04A 1AVMA 2XTAA 4QPJA 1PL4A 2EJ7A 3L71H 4B3SB 3JD3A 1BS3A 2XT9A 1YJWV 4EFEA 4ABMA 1Q81W 2RCVA 3K9SA 4BR6A 5LOVB 3E2EA 4BIUA 3TJTA 3CCSV 1G4YB 1YEWA 2IH3C 2CUGA 2JK5C 2ZNJA 1YTFD 2XUMA 1EN6A 3OAAG 1IVSA 5LMNO 4JAAA 1SKVA 2CAZC 2RJZA 2RMKB 4FK5C 4AILC 2HG5C 3F7YC 5EBWC 3O65A 2YC0A 4IL6Z 2UUCB 2JGUA 4XDKA 1PNLA 1JPXA 2YIBD 1EZVH 2QWNB 2QGNA 2YEVB 4O4LB 2B5UA 1G8MA 1K92A 2V1DA 5LMUB 4N21A 4KXRA 1QNMA 3RYCB 3CCEV 1GK9A 2XNDG 1QQCA 1COWG 2HVJC 5CA1A 4FFKA 2HHHO 2E5LB 3SPCA 2LW1A 3MAQA 2KB1A 3RGBA 4NXMO 2FYUH 2ZE6A 2UXDB 1R3JC 4TV8A 1K73W 2ZINA 1K34A 4P9PA 1D5AA 5JVDB 1MA1A 2WLKA 1R6KA 4FLZA 1OJHA 2K9PA 4DR4B 4KFMA 4MVRA 5IY5C 5IYDO 2PF4E 3N27A 3RYIA 5JJEB 2YI8A 4G28B 1ORQC 3HKCA 4MVQA 1M56C 4CS3A 3K03A 2ZE8A 4QJFB 3CRQA 5IWAO 1FJGB 2AHYA 3DC5A 5L3GA 5TISZ 1IBKB 4JI4B 3O9OA 4MVSA 4PV1B 4WFAV 3W7SA 3T1HB 3CRAA 3TXQA 2QSAA 4X62B 4LWSA 5KHIA 1S72V 3AG7A 4DR6O 3MHSC 2HVKC 3OEHG 4WFBV 3CCLV 3IC7A 1KB9F 2Y4TA 1ZAUA 4UXNA 5B1BB 2VQEB 4DV1B 4DV4O 3CHXA 3B8MA 2ARHA 4C7UA 2QDOA 1MNGA 4K8XA 3K57A 1NQTA 3K5NA 2EULA 4K3AA 2KSDA 5CBGA 2EZPA 1QHTA 2JIZG 4NB5A 2B1IA 2IU0A 1XQ8A 4IHJA 1XMQB 2HFEC 2AZ2A 5H2FZ 3IC9A 3I55V 1J5EO 5LP6A 4BW9A 5LYJB 4GZRB 1CPYA 1U96A 4CBCA 4OX9B 1SRYA 4WFHA 1N0NA 3DXRA 4JI3B 3VOUA 5LYJA 1MOFA 1WN7A 1SZXA 3CCMV 1S5HC 2IJIA 3F7VC 3K79A 5BR8B 2PYJA 3Q4HA 5BZBA 2RDCA 3ZMUA 4WBNA 1KBHA 2YI9A 5D5PA 2VWJA 4J41A 4ZI7B 2CTPA 5LA6A 4FZ0A 4JGSA 2W0FC 1M5IA 5CMUA 1VQNV 2OIEA 4UVBA 1GAXA 1AJPA 2IM9A 4FM0A 3ZHVA 2BSKB 1TVKA 2XAFA 2F4VB 3G6BA 4I0XB 4CC6A 1R3IC 3OT7A 4XBFA 1CP9A 4MTFA 3LSSA 4IIJA 3L72H 4R50A 3JAMN 2CH7A 3ZHSA 3A2FA 4HNAB 4MW3A 1LUWA 2EIKC 4LR3A 2OCHA 2PGGA 2W0XA 3AG1C 4YIOA 1FAFA 3M99B 3OTFA 1GRJA 4NYKA 3K5LA 2WLIA 4IGGA 4LFBO 3H1KH 3JASA 4LFCO 5B1BC 4KHPB 4OPHA 2B1GA 4TWKA 4NR1A 1US6A 2Z0AA 5LGNA 3CWBH 2Y48A 3JCUZ 4H13B 2EIMC 2EJRA 3EXAA 3OGCC 3T4ZA 3BEHA 3AG4C 1QLNA 1E1QG 4GKJO 3QO8A 1SC5B 2WLNA 2CTWA 1XNQB 5GTHZ 4B08A 1IBMO 3OMAB 5LHGA 2BSKA 4B3TB 5C8YB 4JI1O 3CXCU 4ZOLA 4JI7B 4UB8Z 4L8JA 4X65O 2Y4UA 1X59A 1XREA 4QE7A 1XMOB 4GKKO 2OTLV 3SYQA 4JV5B 1CEZA 1HNWB 4PA7A 2DN9A 1WA8A 1FFXB 4LF6O 5EIBD 2YEVA 5B3SC 1J95A 4JI6B 3HKBB 1K7DA 4LNUB 2HEPA 1SETA 4DXWA 1EN4A 4JI5O 4UCRA 4DR2O 1JFFA 4JPRA 3W7XA 4ASUG 4RQEA 3AK1A 3JD0A 1VF5B 1YZBA 5KA6A 1M1KW 2CK3G 5CBHA 3HKDB 4DRXA 5LA6B 1D5NA 3HKDA 4DRXB 2HJFC 2OTJV 1NS1A 4DV2O 1H2LA 3THOA 1RP3B 5KA5A 3OR6C 2VQFO 1BQZA 4HNAA 4CH6A 4D6TH 2WA4A 1HWYA 1OCZB 1OCCB 1XILA 3ICXA 5H6QA 1OCOB 4DUYO 1MZEA 3AG1B 1I94B 1M9NA 4DR1O 4P30A 4PJ0Z 4RO2A 4JYAB 3DC6A 3E8BA 1GKFA 2ZKOA 4DR7B 2F93B 1SQPH 3P3NA 1Q86W 4O4IB 4BAYA 1W0JG 2LGQA 4O4IA 3K9AA 3SJCC 3J81N 5DN6G 4X64B 2YDEA 4I4TA 4B7EA 2LO1A 1IX9A 3ETQA 4DO2A 4R6ZA 1WPBA 2JVDA 3JATA 3CD6V 3OW2U 4JASA 3N2KB 5LP6C 5IYCO 5C93A 1AROP 4PA9A 4JI8B 2E76B 2UU9B 2WLIB 1V54C 1AR1B 1VF6A 3L73H 1V55B 5AG2A 1NR1A 3STLC 3CEIA 3ZEDA 5J2TB 2WSSG 1R1BA 4EKWA 2ZM6O 5LHHA 4GUNA 3GB7C 4DUZB 4AHCA 4MSWC 2UUBB 3LSQA 2ZCEA 1PNKA 4O4HB 4RUEA 4UCOA 5JCOC 5LXTB 4CS2A 2YUAA 1F23A 2ITCC 3ZX6A 4UCVA 4UB6Z 3SYPA 3CB2A 1LNQA 1MABG 2QWQB 1GM7A 3P3PA 1N34O 1Z5VA 2P5OA 3VQXA 3AG2C 1YI2V 3C90A 3L75H 4AQYO 3I56V 1F7YA 2WA3A 4DW1A 1KUQA 4JAVA 3H9VA 2ZD9A 3CS5A 4FIPC 1VQ8V 3K5MA 3OUFA 4LF7B 2Y0IA 4EFBA 4PDRA 2YIAA 5L3CA 3UT5A 2BTQB 1Y74B 2RQ6A 3E8HA 1M56B 2F23A 1K9MW 5KX5A 5C8YA 3PJSK 1ZUQA 1FPOA 1N33B 1JX9A 3CCJV 3LDCA 2CTQA 1SERA 4FZ1A 2YS8A 1K5SA 4X1KB 3IJ4A 1DLBA 1UFIA 3TK1A 1H2SB 1JOYA 1SQQH 4ZI7A 1EFRG 5A2QN 4FMTA 1OCCC 2JS3A 2VWKA 1FFTB 3RYCA 2PI5A 1I08A 4IT5A 3VQVA 2QE7G 3RVYA 1EM1A 2DYRB 5BMVA 3UKMA 2YXYA 2E3CA 3CXHF 4BIOA 5CA1B 4UUJC 1BSMA 4J7ZA 4JF3A 4R7CA 1YDXA 2Q7HA 3N2GA 4F6RA 1HNXO 1Q90D 5JJJB 4JI0O 2O57A 4MVMA 1VQMV 2G38A 3FAVB 3RFRA 4LFAB 4F6RB 3SR2C 1VQ4V 1IURA 1Z2GA 3AEIA 4U7OA 1KYOF 1W59A 2IU3A 2Q68A 4KUMA 2N74A 4PDVA 1VQ7V 1M57C 1VQ9V 1SA0B 1QVFU 4PHZA 4UV8A 1BL8A 2Z5UA 2P67A 3DGEA 3J80N 2NLJC 4JI2B 1A32A 3TCUA 2JDIG 4LH7A 4NXNB 4OGQB 4J42A 2H94A 5BXZA 1D2DA 1BHAA 1VQLV 4GX1A 3BVOA 4J80A 1JQ0A 1X4TA 3OGIB 3T4DA 5KHKA 1JR9A 5LOVA 2GV9A 3DTUB 1AI5A 3JD1A
chains in the Genus database with same CATH topology
3ABMB 2JIZG 3ASNC 3TCUA 2B1IA 5DM6V 3K04A 2D3OW 1MG1A 1S3JA 2Y69C 3ABKB 1NR7A 2IU0A 1AI4A 4U7NA 1H8EG 2JEUA 2HFEC 3G71V 1ROPA 3X2QB 1VQ5V 3I55V 1Q7YW 4FPPA 1OHHG 2X6CA 3JD4A 3OE7G 5FL7G 1CPYA 2JJ2G 5IY5B 4CBCA 1SRYA 3CMEV 4WFHA 2EIKB 2HLDG 3WFVA 2QTOA 2XAQA 3VOUA 1MOFA 4TSFG 4RAIA 3QO7A 2P90A 5GW7A 3T2MA 1S5HC 2IJIA 2WLMA 3F7VC 3UM7A 1FXKA 3ZMVA 3G6EV 1VQKV 3K79A 3W7UA 2QA4V 3JD2A 5BZBA 2BOCC 3ZMUA 1YJNV 3ML0A 4GX5A 3ZRXA 1UJWB 2X7RB 3CCQV 3OMIB 4JGSA 1KP3A 2W0FC 1K5QA 1KC8W 4X88A 4OXSA 5CMUA 5B3SB 1VQNV 2WPDG 3FB5C 4UVBA 1OCRB 5H9CA 5LGUA 3B8NA 1AJPA 1QLEC 4JYCA 5J9PC 4I5SA 3ZMSA 1H2GA 4J9YB 2XAFA 5LBQA 2BOBC 1YHQV 1R3IC 4I9WA 4XBFA 1PNMA 1CP9A 4G2KA 1ENVA 2MK3A 2P6JA 3LSSA 4MTFA 4PELA 3SYAA 1FXHA 5HFMA 4R50A 3E89A 3OR7C 3STZC 2JJ1G 4MW3A 5KUKA 1YITV 3QNEA 2EIKC 1GO3F 3LDDA 3AG1C 1FS0G 1FXKC 3M99B 5L3DA 4MS2A 1KECA 1YSCA 2R9IA 2XASA 3CMAV 2WLIA 1Y4MA 4F4LA 1R6NA 3CCMV 5E1AC 5B1BC 1QR9A 1P4RA 2B1GA 4TWKA 4JTDB 5LGNA 2EINC 2Y48A 4QNHB 4WCEV 3K3WA 2EIMC 2EJRA 5LHIA 1NVPB 3OGCC 5H6RA 3ASOB 1KQSU 1P7BA 3T4ZA 3BEHA 1E1RG 3AG4C 4WFEA 1QLNA 1E1QG 3QO8A 4JYBA 2WLNA 2F43G 5B1OA 4BIZA 1H38A 4JTAB 3OMAB 5LHGA 3CXCU 1I5YA 4PDMA 3ZRSA 3CPWU 1RM1C 4BW5A 3TETA 3MHHC 2LFRA 4QE7A 2EILB 2OTLV 3SYQA 1QR8A 1E79G 3IGAC 3D3IA 1NKDA 1CEZA 3SJQC 1K97A 3ZRWA 4J9ZB 4PA7A 2IH1C 1FXVA 2X6BA 3ABUA 2DYSC 3ZN0A 3D36A 2DYRC 3E86A 2NNUA 1F51A 2YEVA 4H37A 5B3SC 1J95A 5EBMC 1NH2D 3SPGA 2WLHA 1MSWD 1S76D 3CC7V 1K7DA 1IXMA 1F4MA 3LDEA 5LGTA 1SETA 2C2AA 4DXWA 1THZA 4MTXA 3CYOA 1AJQA 2EILC 4JPRA 3W7XA 4ASUG 4RQEA 4MT8A 1W2BU 3JD0A 1SESA 2ZR3A 2YSUB 5KA6A 1M1KW 1F4NA 3CC2V 3ABMC 2CK3G 4JAUA 5CBHA 2WLLA 3FYEB 2UXNA 4WF9V 1H8HG 2WLLB 2IW5A 3OMNB 2W6JG 4MTOA 2HJFC 2W6IG 2OTJV 4JTCB 1TUEB 1L1FA 1S77D 4TT3G 4PA6A 3CCRV 2XAJA 4PA4A 5KA5A 5L3FA 3ZRWB 3OR6C 3BY6A 2DQ0A 2QKSA 3FYIB 1GMGA 3ZN1A 3W7TA 2LP7A 2Z3YA 2QM8A 1HWYA 1OCZB 2QEXV 1OCCB 2Q67A 3ASOC 3ZMTA 3EFFK 3X2QC 5H6QA 1OCOB 3AG4B 3AG1B 1NJIW 1M9NA 3ETGA 3KG2A 1PD3A 2IJJA 4P30A 2K1EA 2DQ3A 5IDJA 4RO2A 2XAGA 4R8CA 1R73A 5EK0A 3MD0A 4KP4A 3JYCA 3E8BA 1GKFA 1QCEA 4ZBMA 4GT1A 2EIJC 3CC4V 2ITDC 1BMFG 2R9RB 3OUSA 2XAHA 2H8PC 1Q86W 3ZCCA 1RPRA 4BAYA 4WFGA 1K4CC 1EZJA 1M57B 1W0JG 1SZTA 4Z1MG 1K4DC 4GX2A 1R3KC 3K9AA 3P30A 3K06A 2AHZA 2ZXWB 5DN6G 1M90W 2A9HA 3HPLC 2Q69A 5EC2C 4DO2A 4R6ZA 2FTKA 5B1AC 1NBMG 1VQOV 3CD6V 3LNMB 3OW2U 4JASA 4GCZA 3HB3B 3RW0A 4PDLA 2A0LA 5IYCO 1NVPD 3OFNG 3AG2B 2WLJA 5L3EA 5C93A 1OCRC 1Y66A 1AROP 4GX0A 4PA9A 1RPOA 4UVCA 1WLEA 2WLIB 5EC1C 4WFFA 1V54C 1AR1B 3ABTA 1VQ6V 5B1AB 1V55B 1NR1A 3STLC 2Q6AA 2WSSG 4E2LA 1YTFB 3K0GA 4XDLA 4EKWA 4MVUA 2M7WA 2WWWA 1V54B 1DTOA 4N23A 4Q20A 3SPIA 5LHHA 2IJHA 3AG3B 3GB7C 1QLEB 4HZ3A 4MSWC 3T1CA 2P7TC 3ASNB 3LSQA 1AI5A 1PNKA 4RUEA 3ZJZA 4CZZA 1AI6A 4MVOA 1F23A 2ITCC 1BHBA 3A0RA 4X89A 4RUFA 1KP2A 3R65A 3G4SV 1QVGU 4P2ZA 5L3BA 1R3LC 4PA3A 3SYPA 1LNQA 1W0KG 1MABG 2ATKC 3K0DA 1GM7A 5HFLA 3ETDA 3K08A 4FJCC 3AG2C 1YI2V 4LC1A 1JJ2U 3I56V 1EBOA 4L87A 2EBOA 2LFSA 4MVZA 4P9OA 4JAVA 1OZ0A 1B6QA 2ZD9A 4QPJA 3FB8C 3SYCA 3ZRVA 1PKXA 4FIPC 2GHYA 1FXKB 1VQ8V 2DWEC 3JD3A 1ZWIC 3OUFA 1Q82W 1YJWV 4PDRA 2EIMB 1Q81W 1KD1W 2IJKA 3CCUV 4G27B 1PL0A 3E35A 1XL4A 4BIUA 5L3CA 3E2EA 5CN0A 2V7QG 3LUTB 3CCSV 3WG7C 1G4YB 2IH3C 3SPJA 1JVMA 2JK5C 3E8HA 1M56B 4LP8A 1YTFD 3VBBA 1K9MW 1OCZC 3OAAG 2ZR2A 3PJSK 1YJ9V 1JX9A 3E83A 4MW8A 3CCJV 1QBZA 3LDCA 3EHBB 1KKDA 4FK5C 1VQPV 2HG5C 1SERA 3F7YC 2EINB 2GSMB 2OT5A 4UVAA 4XDJA 5EBWC 1K5SA 1GM8A 4H33A 3QO5A 4XDKA 1DLBA 1PNLA 1K33A 1JPXA 3TK1A 1JOYA 2YEVB 2B5UA 1EFRG 1G8MA 1K92A 2V1DA 4FMTA 4N21A 2ZDIA 1K3EA 1OCCC 3OEEG 3CCEV 3OM3B 5CBFA 1GK9A 2XNDG 1FFTB 2PI5A 1NH2B 2HVJC 1COWG 4LBEC 3FKSG 2QE7G 2ZDIC 2HR3A 3ETEA 3RVYA 2DYRB 3SPCA 2X0LA 3P32A 3UKMA 2KB1A 4HYOA 3ZIAG 4UUJC 3SYOA 2JEXA 1R3JC 4JF3A 4R7CA 1K73W 1K34A 4P9PA 1V55C 1GM9A 2XOKG 4WFBV 1AI7A 2WLKA 3JCZA 4X8AA 3ABKC 1WPXA 1R6KA 1YIJV 1I5XA 3H01A 4KFMA 4MVRA 2DW4A 3W7WA 4MVMA 3AG3C 4HAMA 2DYSB 1VQMV 5IYBO 2A79B 2OCCC 5IY5C 1XL6A 5IYDO 1DF4A 1K8AW 4G28B 1VQ4V 1ORQC 4MVQA 2EIJB 3AEIA 1M56C 3FB7C 4U7OA 4YXWG 3K03A 4QPKA 3CP1A 4QJFB 2IU3A 1JCHA 3NXSA 3FB6C 2AHYA 3IFXA 2UXXA 5L3GA 3GWOA 2Q68A 1RM1B 1DF5A 4KUMA 3E8GA 2ZXWC 3ABLB 4PDVA 1VQ7V 1M57C 4MVSA 1VQ9V 2QM7A 4WFAV 2X6AA 3W7SA 1OCOC 4RQFA 1QVFU 4MTGA 2WAMA 3RVZA 4UV8A 2PI4A 1BL8A 4UV9A 2Z5UA 2P67A 3DGEA 4LCUC 2NLJC 3B77A 3WG7B 4ZKIA 1S72V 3MHSC 2HVKC 3OEHG 1S0VA 2DWDC 2JDIG 3ABLC 3F5WC 1AJNA 3IC7A 3E8FA 5EBLC 3RBZA 3SPHA 2Y69B 1N8RW 5B1NA 4QIWF 2H94A 1BHAA 4UXNA 1VQLV 5B1BB 4GX1A 5KUMA 2EZOA 5CA3A 1JQ0A 3CCLV 3CCVV 3B8MA 3T4DA 2HKOA 3ZMZA 1NQTA 2OCCB 5CBGA 2EZPA 4QE9A 1GTOA 3DTUB 2ZQMA 3JD1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WF9 V;  1VQP V;  1S72 V;  1VQ8 V;  1K8A W;  3CCM V;  1NJI W;  3CC7 V;  1VQ4 V;  5DM6 V;  3CXC U;  3G6E V;  3G4S V;  1VQK V;  2QA4 V;  2D3O W;  4WFB V;  3CCL V;  3CPW U;  1YHQ V;  1YJW V;  1Q82 W;  1Q81 W;  1QVG U;  1N8R W;  1M90 W;  1KD1 W;  1VQ6 V;  3CCU V;  1YJN V;  1R73 A;  2OTL V;  3CCR V;  3G71 V;  4WCE V;  1K73 W;  3CCS V;  1VQL V;  1VQ5 V;  3I55 V;  1Q7Y W;  3CCE V;  3CCQ V;  1YIT V;  3CCV V;  1W2B U;  1KQS U;  1VQO V;  1K9M W;  1VQ7 V;  1YI2 V;  3CC4 V;  3OW2 U;  1VQM V;  1VQ9 V;  1YJ9 V;  3CD6 V;  1KC8 W;  4WFA V;  1M1K W;  1YIJ V;  1JJ2 U;  1VQN V;  3I56 V;  1Q86 W;  3CC2 V;  3CCJ V;  3CME V;  2OTJ V;  1QVF U;  2QEX V;  3CMA V; 
#chains in the Genus database with same CATH topology
 1AB3 A;  1SQG A;  3ASN C;  3QF7 A;  5DM6 V;  3K04 A;  1S3J A;  2P4V A;  3ABK B;  1RSO A;  1AI4 A;  1ROP A;  4TQF A;  3X2Q B;  1N32 B;  2PTM A;  4FPP A;  1OHH G;  3JD4 A;  4A5U B;  4LF4 B;  4ZIB A;  5IY5 B;  4ZHQ B;  2KQX A;  3BAA A;  3RYH B;  3CME V;  2EIK B;  1XDC A;  3BPZ A;  1UJW B;  2P90 A;  3ZMV A;  2NN4 A;  5KMG A;  1IBL B;  2QA4 V;  4DV7 O;  2BOC C;  4DR3 O;  4LF9 O;  3APO A;  2X7R B;  4FLX A;  1KP3 A;  4B3M O;  2OWO A;  4X1I B;  2CDY A;  2WPD G;  5LGU A;  2A3Q A;  3N2G B;  2L6L A;  4TV8 B;  4I5S A;  4JYY A;  4J7J A;  3ZMS A;  4J9Y B;  1HP8 A;  5LBQ A;  4Q6G A;  2BOB C;  1VAR A;  4I9W A;  1PNM A;  4O4H A;  2MK3 A;  3T1Y O;  2UXC O;  4NVP A;  1FXH A;  1Q6U A;  3E89 A;  3OR7 C;  2GBO A;  1YIT V;  3QNE A;  4PI2 A;  3LDD A;  1FXK C;  5LMN B;  4MS2 A;  2F66 C;  4UCS A;  4LF5 O;  2LQT A;  1QR9 A;  4I50 A;  3A8T A;  1BQ0 A;  2UUC O;  5IJ0 B;  3H1I H;  4FFB A;  4JTD B;  2EIN C;  4DR5 O;  5EYP B;  4WCE V;  3B2E E;  5LHI A;  3JAT B;  1NVP B;  2YXL A;  3ASO B;  2YIC A;  4WFE A;  1NTM H;  4X20 B;  3K58 A;  4OPA A;  3BAB A;  1NI8 A;  4PDM A;  3ZRS A;  4NXM B;  3HKE A;  3TET A;  3BA9 A;  5B66 Z;  1V9P A;  1H2M A;  3IGA C;  1BT8 A;  1PPJ H;  2IH1 C;  1FXV A;  2DYS C;  2EX3 A;  4DK1 A;  1N36 O;  1F51 A;  3ZHT A;  3S3X A;  5GTI Z;  1WA8 B;  2P06 A;  1S76 D;  2ZIM A;  3U0Z A;  3JSL A;  1HW7 A;  4ZHQ A;  1IXM A;  2Q5Z A;  5LGT A;  2FB5 A;  3CYO A;  5JQG A;  1AJQ A;  4X9Q A;  4DYL A;  4MT8 A;  1W2B U;  2DJV A;  2ZR3 A;  3T1H O;  3CC2 V;  4JAU A;  1Q5O A;  3JAK A;  4DV0 B;  2UXN A;  3JAK B;  4DV5 B;  2IW5 A;  3J7A U;  1PP9 H;  2W6J G;  3OTO O;  2W6I G;  3H1J H;  4EEQ A;  1L1F A;  1S77 D;  4TT3 G;  1AR4 A;  3VQW A;  2B9Z A;  4U3J B;  4PA4 A;  4JZ2 A;  5L3F A;  4DV1 O;  4DV4 B;  2VS0 A;  4H44 B;  2DQ0 A;  4RWU A;  4F6E A;  3FYI B;  3ZN1 A;  3W7T A;  4FM1 A;  2M6Y A;  2Z3Y A;  3KCY A;  2Q67 A;  2ZE7 A;  2Q9L A;  1AP5 A;  3AG4 B;  2CH7 B;  2Y0P A;  3ETG A;  2IJJ A;  1AIL A;  2DQ3 A;  5IDJ A;  4X66 O;  1R73 A;  5EK0 A;  3MD0 A;  3R66 A;  1XBL A;  4X1Y B;  2HJD A;  4GT1 A;  3CC4 V;  2ITD C;  1BMF G;  2R9R B;  1NZ6 A;  3OUS A;  4IYH A;  2XAH A;  2H8P C;  3ZCC A;  1K4C C;  3Q4H B;  1SZT A;  3S3W A;  1R3K C;  4B3S O;  2QTS A;  3K06 A;  1O9H A;  1JFF B;  3UCS C;  1FYJ A;  3TXS A;  5B5E Z;  4CH4 A;  2DE0 X;  1SA0 A;  1VQO V;  4B3R O;  4GCZ A;  4TV9 A;  5CA0 B;  2A0L A;  1OCR C;  4GX0 A;  1RPO A;  2CTR A;  2F4V O;  4WFF A;  2QM4 A;  1VQ6 V;  3E22 A;  2KKW A;  4DW0 A;  3BRC A;  1HR0 O;  4E2L A;  2JGD B;  3RYH A;  1LR1 A;  4XDL A;  1XHZ A;  2M7W A;  3SJA C;  3SPI A;  3AG3 B;  1QLE B;  3HKC B;  2LGW A;  1TUB B;  4DV3 O;  3ASN B;  3GVM A;  3CJH A;  4CZZ A;  1AI6 A;  2HHH B;  4W4K A;  4LFC B;  3CJH B;  3A0R A;  4FVM A;  4KHP O;  4RUF A;  3G4S V;  3D36 C;  1QVG U;  1YXB A;  4P2Z A;  5A9G A;  5L3B A;  1R3L C;  4PA3 A;  4FLT A;  1W0K G;  2LJ2 A;  3JAL B;  1H2K A;  3ETD A;  1LUV A;  4FJC C;  2GUZ A;  2AGA A;  1EBO A;  4L87 A;  5FPR A;  2LFS A;  3GWK C;  4FLV A;  4FLU A;  3FB8 C;  3ZRV A;  1PKX A;  1IBM B;  1FXK B;  5KAI Z;  1ZWI C;  4B3T O;  1Q82 W;  1NT2 B;  2OYQ A;  1KD1 W;  2IJK A;  3CCU V;  4G27 B;  1XMO O;  5IYZ B;  2V7Q G;  3A0B Z;  3LNN A;  4TUY A;  1VP7 A;  1IBK O;  4JI4 O;  1HNZ B;  4LP8 A;  3KCX A;  1OCZ C;  2ZR2 A;  1URF A;  4X62 O;  1QBZ A;  1B06 A;  3EHB B;  1VQP V;  2GSM B;  3VQY A;  4XDJ A;  2OT5 A;  2IBZ H;  3HKB A;  4JI6 O;  4H33 A;  4WBN B;  3QO5 A;  4YY3 B;  3QVN A;  2FKX A;  1K33 A;  1JA8 A;  1L0L H;  2DOS A;  1MSD A;  3OEE G;  3OM3 B;  1Q6I A;  4YJ3 B;  5GON A;  1OV9 A;  1NH2 B;  3FKS G;  4YJ2 A;  2ZDI C;  2Q4P A;  1TAE A;  3TGU H;  5KMG B;  1NU1 H;  4D7S A;  4YHH B;  5GON B;  2UXB O;  1PV0 A;  3L70 H;  3ZIA G;  3N2K A;  2QJ1 A;  3SYO A;  2JEX A;  4E4E A;  1NTZ H;  5DEC A;  1V55 C;  3BFR A;  1GM9 A;  2Q7G A;  2XOK G;  2CGO A;  3ABK C;  3U11 A;  1YIJ V;  3H1H H;  2F95 B;  2DW4 A;  4K0K O;  4HAM A;  5IYB O;  2A79 B;  4JI3 O;  1WP8 A;  1XL6 A;  1YVW A;  1DF4 A;  4K8Z A;  4DR1 B;  4Z2W A;  2EIJ B;  4YXW G;  4W4L A;  4QPK A;  1JCH A;  3NXS A;  3FB6 C;  4JYA O;  2UXX A;  1Y76 B;  2UUA O;  3E8G A;  3L9D A;  2QM7 A;  2X6A A;  3ZHU A;  4MTG A;  3K5O A;  3RVZ A;  2PI4 A;  2E74 B;  4ZKI A;  3B77 A;  4UFZ A;  2N04 A;  1S0V A;  3ABL C;  3F5W C;  4X64 O;  1AJN A;  4O4L A;  1IDS A;  5B1N A;  4QIW F;  3DSQ A;  1XNR B;  5KUM A;  3JAW A;  2YXH A;  4DV6 O;  5IE9 A;  3ZMZ A;  2OCC B;  4QE9 A;  2BTO A;  1GTO A;  1AP6 A;  2ZQM A;  2AXT Z;  2ZIO A;  1XHX A;  1G6U A;  4U7N A;  2R70 A;  5CA0 A;  2JEU A;  5JQG B;  4LF8 B;  3G71 V;  5CB4 B;  1ZL8 B;  3ZBH A;  3OE7 G;  2Q73 A;  2JJ2 G;  4GKJ B;  4DR4 O;  2L35 A;  2HLD G;  3WFV A;  3B4S A;  1XNQ O;  2VRZ A;  3QO7 A;  2WLM A;  1FXK A;  2PUS A;  3W7U A;  1VQK V;  1S5L Z;  1YJN V;  1ZLZ A;  2D2C B;  3APQ A;  3ML0 A;  5BY1 A;  2RN9 A;  5IJ9 B;  1N34 B;  1HNW O;  3CCQ V;  5K1X A;  2XHB A;  1K5Q A;  2BE3 A;  1KC8 W;  4X88 A;  5B3S B;  3WB0 A;  4Z1V A;  1OCR B;  3ZHR A;  1WJZ A;  4X1I A;  5JCO A;  3LSU A;  4LF7 O;  1YHQ V;  1PM9 A;  4PD4 F;  4PEL A;  1TGO A;  4J10 A;  5E79 Z;  3SYA A;  5HFM A;  4DR2 B;  3CX5 F;  2VQE O;  5KUK A;  1GO3 F;  1VIB A;  5KHJ A;  2Q8V A;  5IT9 N;  3CMA V;  4F4L A;  1Y4M A;  1L8D A;  2GUZ B;  3SDL A;  1XMQ O;  1KKC A;  3K3W A;  2QWP B;  1NTK H;  4IIJ B;  1P7B A;  1E1R G;  2ADQ B;  4I4T B;  4JYB A;  4OX9 O;  3JSN A;  2QWR B;  5B1O A;  4BIZ A;  1H38 A;  3G67 A;  4JTA B;  3M7M X;  4DUY B;  1BE3 H;  1I94 O;  1I5Y A;  1M93 A;  3CPW U;  5BR8 O;  1RM1 C;  1MMM A;  5EIB C;  1QR8 A;  1SF9 A;  1E79 G;  1NKD A;  3SJQ C;  3ZRW A;  1H2N A;  4J9Z B;  3DXR B;  2LW7 A;  1HNX B;  3D36 A;  1GN2 A;  4H37 A;  3FFQ A;  4I55 B;  3JAR A;  5EBM C;  1NH2 D;  1MSW D;  5DED A;  2Q0A A;  1DGS A;  4I55 A;  5KAF Z;  1Q6H A;  1QU7 A;  1AR5 A;  1VMG A;  1THZ A;  2PY5 A;  5LMU O;  2YSU B;  2GTS A;  2FL4 A;  1VF6 C;  3ABM C;  3AK2 A;  4J11 A;  5FNV A;  2WLL A;  2UU9 O;  1H8H G;  2E5L O;  4JI2 O;  2WLL B;  4NXN O;  1Q43 A;  4JTC B;  1SQF A;  2UXD O;  1VEW A;  3CCR V;  1M4U A;  2AW9 A;  2ZE5 A;  2XAJ A;  5ITZ A;  4DUZ O;  3CSX A;  3ZRW B;  5JVD A;  1SQB H;  2QKS A;  2UUB O;  1SQX H;  1GMG A;  5FPO A;  4HBN A;  1SQV H;  2QEX V;  3QTC A;  4ZOL B;  3ASO C;  3EFF K;  1Y76 A;  4NTW A;  1NJI W;  1VF7 A;  4FLY A;  4JI1 B;  4JI7 O;  5IWA B;  1FJG O;  4K35 A;  4I7Z B;  4LF4 O;  1P84 F;  4AQY B;  4O2B A;  1RPR A;  1EZJ A;  2CGN A;  1K4D C;  4GX2 A;  5KX5 B;  1XEQ A;  4TOI A;  4DR6 B;  3P30 A;  3JAS B;  3QG5 A;  5JH7 A;  4TQD A;  3HPL C;  1WB8 A;  4DR3 B;  4X20 A;  3FD9 A;  5EC2 C;  4LF9 B;  4QGP A;  2KG7 B;  1NBM G;  2H3O A;  3HB3 B;  3RW0 A;  3AG2 B;  2WLJ A;  1Y66 A;  3CRC A;  4UVC A;  1WLE A;  5EC1 C;  4GYC B;  3RWR D;  4YJ2 B;  5B1A B;  2JS5 A;  1DK1 A;  2Q6A A;  1Z5W A;  4DV2 B;  4MVU A;  2WWW A;  3RYI B;  4Q20 A;  1J5E B;  1YCI A;  4HZ3 A;  4X1Y A;  2QKA A;  4LF5 B;  4X89 A;  1CXZ B;  3UO2 A;  2P22 C;  5BMV B;  4J7K A;  3JAW B;  3K08 A;  3M8A A;  4PI0 A;  4LC1 A;  1JJ2 U;  1XOU A;  3UQ8 A;  4MVZ A;  1U97 A;  1B6Q A;  3SYC A;  2GHY A;  2OIG A;  2DWE C;  5FLX N;  2EIM B;  1B3Q A;  1PL0 A;  5K1P A;  3E35 A;  1XL4 A;  5CN0 A;  3LUT B;  5KHG A;  3WG7 C;  3SPJ A;  1JVM A;  3VBB A;  3U10 A;  1YJ9 V;  1N36 B;  5F2V O;  5EZY A;  3E83 A;  4MW8 A;  3MDS A;  4LFB B;  1KKD A;  3WB2 A;  5EZY B;  2EIN B;  3CRR A;  4UVA A;  2PZS A;  2JGD A;  1GM8 A;  4O2B B;  3F5T A;  3KZI Z;  3SGI A;  4I50 B;  4FLW A;  1GN6 A;  2ZDI A;  1K3E A;  4AI8 A;  5CBF A;  5JWP A;  4LBE C;  2HP8 A;  2HR3 A;  3ETE A;  2X0L A;  3P32 A;  4TV9 B;  4X65 B;  1WB7 A;  4HYO A;  4GKK B;  4JV5 O;  1GN4 A;  1R6T A;  1N32 O;  1IZ3 A;  3KKY A;  2MW2 B;  4X8A A;  1AI7 A;  1RSO B;  3JCZ A;  4D7T A;  1Y67 A;  1WPX A;  4ICG A;  3EVK A;  1I5X A;  3H01 A;  2Q0O C;  4NTY A;  4LF6 B;  3W7W A;  3AG3 C;  2DYS B;  3I5D A;  2OCC C;  2PYL A;  4I9Q A;  1K8A W;  1UPG A;  3D3Q A;  3RYF B;  3FB7 C;  4X66 B;  3D8C A;  3WU2 Z;  4JI5 B;  3CP1 A;  3IFX A;  1WNS A;  3GWO A;  3RT3 C;  1RM1 B;  1DF5 A;  1JMK C;  3B09 A;  2ZXW C;  4CS4 A;  3ABL B;  2ADP A;  4B3M B;  1T5E A;  1N33 O;  1OCO C;  2GDS A;  4RQF A;  5LL6 Y;  2WAM A;  4UV9 A;  4U3J A;  4LCU C;  3WG7 B;  5ITZ B;  3CE2 A;  1TVK B;  2DWD C;  1N8R W;  3SPH A;  2KG7 A;  2QWO B;  3E8F A;  5EBL C;  3RBZ A;  2Y69 B;  1FKA O;  4YJ3 A;  2UXC B;  2ILM A;  2EZO A;  5CA3 A;  1FD9 A;  2DMX A;  3BHP A;  4BWA A;  3CCV V;  2VQF B;  4O2A A;  4B3R B;  5JH7 B;  2P4K A;  1I7F A;  2HKO A;  1ZSP A;  1BZK A;  4YIP A;  4X1K A;  3ABM B;  4B7K A;  3E22 B;  1Y74 A;  2D3O W;  1MG1 A;  2Y69 C;  2GTA A;  1MZF A;  1NR7 A;  1H8E G;  4NKG B;  2ODM A;  4GLX A;  1VQ5 V;  1Q7Y W;  2Q7E A;  2X6C A;  4DR7 O;  5FL7 G;  2BTQ A;  4O4J B;  5EYP A;  1P7G A;  3JAR B;  4CC5 A;  2QTO A;  2XAQ A;  1WAZ A;  4LFA O;  4TSF G;  4RAI A;  3UM7 A;  5GW7 A;  3T2M A;  3G6E V;  3JD2 A;  1O9G A;  4CH5 A;  1Q8I A;  2QKC A;  2JRI A;  4GX5 A;  3ZRX A;  3ZS8 C;  2ZNI A;  3OMI B;  2FML A;  3FAV A;  3AK3 A;  5FNV B;  5IJ9 A;  4OXS A;  3FB5 C;  5H9C A;  5KHH A;  1G1X B;  3B8N A;  4JYC A;  1QLE C;  4I0X A;  5J9P C;  3G80 A;  1H2G A;  4JI8 O;  1N4C A;  4TUY B;  3HR0 A;  1TUB A;  4G2K A;  3UT5 B;  1ENV A;  2P6J A;  5J2T A;  3STZ C;  2ZM6 B;  2JJ1 G;  4FM2 A;  1HNZ O;  1ZL8 A;  1EN5 A;  1FS0 G;  5L3D A;  1KEC A;  1YSC A;  2R9I A;  4DV0 O;  2XAS A;  4DV3 B;  1R6N A;  5E1A C;  4U3F H;  3CRM A;  4DV5 O;  3OTO B;  1P4R A;  4YY3 O;  2YID A;  3H1L H;  1S5J A;  1BGY H;  4QNH B;  3A0H Z;  4EB6 B;  5H6R A;  1KQS U;  1ZTE A;  2CE4 A;  2N05 A;  3SJB C;  2F43 G;  2V4D A;  5D5Q A;  2ZT9 B;  4YHH O;  1IBL O;  2R9A A;  4BW5 A;  3MHH C;  2LFR A;  2EIL B;  1FFX A;  3D3I A;  4NTX A;  2ETN A;  1K97 A;  3WB1 A;  3ABU A;  2X6B A;  2AZ0 A;  1IXB A;  3L74 H;  3ZN0 A;  4LH6 A;  2DYR C;  1HDJ A;  3E86 A;  2NNU A;  1P49 A;  1GN3 A;  3SPG A;  2WLH A;  1Y6X A;  2RNB A;  3CC7 V;  1F4M A;  3LDE A;  3ZHQ A;  2C2A A;  3JAL A;  4MTX A;  3T1Y B;  2EIL C;  2UUA B;  5LXT A;  1WP7 A;  1SES A;  5J2U A;  1F4N A;  1SS3 A;  1BCC H;  3FYE B;  4FFB B;  4WF9 V;  3OMN B;  2YIB A;  4MTO A;  1TUE B;  1HR0 B;  3NR7 A;  1I0H A;  1KMI Z;  1YF2 A;  4PA6 A;  4DR5 B;  1XNR O;  2A06 H;  4IYI A;  2QR4 A;  4DV6 B;  3BY6 A;  4UCT A;  2BCC H;  5H5N A;  4JI0 B;  1Q3E A;  3RN4 A;  4O4J A;  3BCC H;  2LP7 A;  2QM8 A;  3ZMT A;  1JJO A;  3X2Q C;  5CB4 A;  3KG2 A;  1PD3 A;  2K1E A;  1KU9 A;  3B40 A;  1L0N H;  2XAG A;  4R8C A;  4LF8 O;  4KP4 A;  3JYC A;  1QCE A;  4UCU A;  4ZBM A;  1ZX3 A;  2EIJ C;  5IYZ A;  5IJ0 A;  4WFG A;  3C3T A;  1M57 B;  4Z1M G;  5JJN B;  4KL1 A;  2AHZ A;  2ZXW B;  1M90 W;  2A9H A;  2E75 B;  2Q69 A;  3IAY A;  2FTK A;  5KLV H;  5B1A C;  3LNM B;  4DK0 A;  4IHJ B;  4PDL A;  1NVP D;  3OFN G;  4LWS B;  5L3E A;  5LP6 B;  2A7W A;  3OD4 A;  3ABT A;  3RYF A;  4JZG A;  3K59 A;  3BA8 A;  1YTF B;  3HKE B;  3K0G A;  1N0J A;  1V54 B;  1DTO A;  4N23 A;  2IJH A;  4CH3 A;  4H0L B;  3T1C A;  2P7T C;  3ZJZ A;  1RFY A;  4MVO A;  3PN1 A;  3C3S A;  1BHB A;  2R72 A;  5J2U B;  1KP2 A;  3R65 A;  4EB6 A;  3UO3 A;  2F1M A;  4DV7 B;  2UXB B;  4LNU A;  1TA8 A;  2ATK C;  3K0D A;  5HFL A;  1XUQ A;  2NR5 A;  4O2A B;  2EBO A;  1GH6 A;  4P9O A;  3FX7 A;  1XI1 A;  4K0K B;  1OZ0 A;  1B04 A;  1AVM A;  2XTA A;  4QPJ A;  1PL4 A;  2EJ7 A;  3L71 H;  4B3S B;  3JD3 A;  1BS3 A;  2XT9 A;  1YJW V;  4EFE A;  4ABM A;  1Q81 W;  2RCV A;  3K9S A;  4BR6 A;  5LOV B;  3E2E A;  4BIU A;  3TJT A;  3CCS V;  1G4Y B;  1YEW A;  2IH3 C;  2CUG A;  2JK5 C;  2ZNJ A;  1YTF D;  2XUM A;  1EN6 A;  3OAA G;  1IVS A;  5LMN O;  4JAA A;  1SKV A;  2CAZ C;  2RJZ A;  2RMK B;  4FK5 C;  4AIL C;  2HG5 C;  3F7Y C;  5EBW C;  3O65 A;  2YC0 A;  4IL6 Z;  2UUC B;  2JGU A;  4XDK A;  1PNL A;  1JPX A;  2YIB D;  1EZV H;  2QWN B;  2QGN A;  2YEV B;  4O4L B;  2B5U A;  1G8M A;  1K92 A;  2V1D A;  5LMU B;  4N21 A;  4KXR A;  1QNM A;  3RYC B;  3CCE V;  1GK9 A;  2XND G;  1QQC A;  1COW G;  2HVJ C;  5CA1 A;  4FFK A;  2HHH O;  2E5L B;  3SPC A;  2LW1 A;  3MAQ A;  2KB1 A;  3RGB A;  4NXM O;  2FYU H;  2ZE6 A;  2UXD B;  1R3J C;  4TV8 A;  1K73 W;  2ZIN A;  1K34 A;  4P9P A;  1D5A A;  5JVD B;  1MA1 A;  2WLK A;  1R6K A;  4FLZ A;  1OJH A;  2K9P A;  4DR4 B;  4KFM A;  4MVR A;  5IY5 C;  5IYD O;  2PF4 E;  3N27 A;  3RYI A;  5JJE B;  2YI8 A;  4G28 B;  1ORQ C;  3HKC A;  4MVQ A;  1M56 C;  4CS3 A;  3K03 A;  2ZE8 A;  4QJF B;  3CRQ A;  5IWA O;  1FJG B;  2AHY A;  3DC5 A;  5L3G A;  5TIS Z;  1IBK B;  4JI4 B;  3O9O A;  4MVS A;  4PV1 B;  4WFA V;  3W7S A;  3T1H B;  3CRA A;  3TXQ A;  2QSA A;  4X62 B;  4LWS A;  5KHI A;  1S72 V;  3AG7 A;  4DR6 O;  3MHS C;  2HVK C;  3OEH G;  4WFB V;  3CCL V;  3IC7 A;  1KB9 F;  2Y4T A;  1ZAU A;  4UXN A;  5B1B B;  2VQE B;  4DV1 B;  4DV4 O;  3CHX A;  3B8M A;  2ARH A;  4C7U A;  2QDO A;  1MNG A;  4K8X A;  3K57 A;  1NQT A;  3K5N A;  2EUL A;  4K3A A;  2KSD A;  5CBG A;  2EZP A;  1QHT A;  2JIZ G;  4NB5 A;  2B1I A;  2IU0 A;  1XQ8 A;  4IHJ A;  1XMQ B;  2HFE C;  2AZ2 A;  5H2F Z;  3IC9 A;  3I55 V;  1J5E O;  5LP6 A;  4BW9 A;  5LYJ B;  4GZR B;  1CPY A;  1U96 A;  4CBC A;  4OX9 B;  1SRY A;  4WFH A;  1N0N A;  3DXR A;  4JI3 B;  3VOU A;  5LYJ A;  1MOF A;  1WN7 A;  1SZX A;  3CCM V;  1S5H C;  2IJI A;  3F7V C;  3K79 A;  5BR8 B;  2PYJ A;  3Q4H A;  5BZB A;  2RDC A;  3ZMU A;  4WBN A;  1KBH A;  2YI9 A;  5D5P A;  2VWJ A;  4J41 A;  4ZI7 B;  2CTP A;  5LA6 A;  4FZ0 A;  4JGS A;  2W0F C;  1M5I A;  5CMU A;  1VQN V;  2OIE A;  4UVB A;  1GAX A;  1AJP A;  2IM9 A;  4FM0 A;  3ZHV A;  2BSK B;  1TVK A;  2XAF A;  2F4V B;  3G6B A;  4I0X B;  4CC6 A;  1R3I C;  3OT7 A;  4XBF A;  1CP9 A;  4MTF A;  3LSS A;  4IIJ A;  3L72 H;  4R50 A;  3JAM N;  2CH7 A;  3ZHS A;  3A2F A;  4HNA B;  4MW3 A;  1LUW A;  2EIK C;  4LR3 A;  2OCH A;  2PGG A;  2W0X A;  3AG1 C;  4YIO A;  1FAF A;  3M99 B;  3OTF A;  1GRJ A;  4NYK A;  3K5L A;  2WLI A;  4IGG A;  4LFB O;  3H1K H;  3JAS A;  4LFC O;  5B1B C;  4KHP B;  4OPH A;  2B1G A;  4TWK A;  4NR1 A;  1US6 A;  2Z0A A;  5LGN A;  3CWB H;  2Y48 A;  3JCU Z;  4H13 B;  2EIM C;  2EJR A;  3EXA A;  3OGC C;  3T4Z A;  3BEH A;  3AG4 C;  1QLN A;  1E1Q G;  4GKJ O;  3QO8 A;  1SC5 B;  2WLN A;  2CTW A;  1XNQ B;  5GTH Z;  4B08 A;  1IBM O;  3OMA B;  5LHG A;  2BSK A;  4B3T B;  5C8Y B;  4JI1 O;  3CXC U;  4ZOL A;  4JI7 B;  4UB8 Z;  4L8J A;  4X65 O;  2Y4U A;  1X59 A;  1XRE A;  4QE7 A;  1XMO B;  4GKK O;  2OTL V;  3SYQ A;  4JV5 B;  1CEZ A;  1HNW B;  4PA7 A;  2DN9 A;  1WA8 A;  1FFX B;  4LF6 O;  5EIB D;  2YEV A;  5B3S C;  1J95 A;  4JI6 B;  3HKB B;  1K7D A;  4LNU B;  2HEP A;  1SET A;  4DXW A;  1EN4 A;  4JI5 O;  4UCR A;  4DR2 O;  1JFF A;  4JPR A;  3W7X A;  4ASU G;  4RQE A;  3AK1 A;  3JD0 A;  1VF5 B;  1YZB A;  5KA6 A;  1M1K W;  2CK3 G;  5CBH A;  3HKD B;  4DRX A;  5LA6 B;  1D5N A;  3HKD A;  4DRX B;  2HJF C;  2OTJ V;  1NS1 A;  4DV2 O;  1H2L A;  3THO A;  1RP3 B;  5KA5 A;  3OR6 C;  2VQF O;  1BQZ A;  4HNA A;  4CH6 A;  4D6T H;  2WA4 A;  1HWY A;  1OCZ B;  1OCC B;  1XIL A;  3ICX A;  5H6Q A;  1OCO B;  4DUY O;  1MZE A;  3AG1 B;  1I94 B;  1M9N A;  4DR1 O;  4P30 A;  4PJ0 Z;  4RO2 A;  4JYA B;  3DC6 A;  3E8B A;  1GKF A;  2ZKO A;  4DR7 B;  2F93 B;  1SQP H;  3P3N A;  1Q86 W;  4O4I B;  4BAY A;  1W0J G;  2LGQ A;  4O4I A;  3K9A A;  3SJC C;  3J81 N;  5DN6 G;  4X64 B;  2YDE A;  4I4T A;  4B7E A;  2LO1 A;  1IX9 A;  3ETQ A;  4DO2 A;  4R6Z A;  1WPB A;  2JVD A;  3JAT A;  3CD6 V;  3OW2 U;  4JAS A;  3N2K B;  5LP6 C;  5IYC O;  5C93 A;  1ARO P;  4PA9 A;  4JI8 B;  2E76 B;  2UU9 B;  2WLI B;  1V54 C;  1AR1 B;  1VF6 A;  3L73 H;  1V55 B;  5AG2 A;  1NR1 A;  3STL C;  3CEI A;  3ZED A;  5J2T B;  2WSS G;  1R1B A;  4EKW A;  2ZM6 O;  5LHH A;  4GUN A;  3GB7 C;  4DUZ B;  4AHC A;  4MSW C;  2UUB B;  3LSQ A;  2ZCE A;  1PNK A;  4O4H B;  4RUE A;  4UCO A;  5JCO C;  5LXT B;  4CS2 A;  2YUA A;  1F23 A;  2ITC C;  3ZX6 A;  4UCV A;  4UB6 Z;  3SYP A;  3CB2 A;  1LNQ A;  1MAB G;  2QWQ B;  1GM7 A;  3P3P A;  1N34 O;  1Z5V A;  2P5O A;  3VQX A;  3AG2 C;  1YI2 V;  3C90 A;  3L75 H;  4AQY O;  3I56 V;  1F7Y A;  2WA3 A;  4DW1 A;  1KUQ A;  4JAV A;  3H9V A;  2ZD9 A;  3CS5 A;  4FIP C;  1VQ8 V;  3K5M A;  3OUF A;  4LF7 B;  2Y0I A;  4EFB A;  4PDR A;  2YIA A;  5L3C A;  3UT5 A;  2BTQ B;  1Y74 B;  2RQ6 A;  3E8H A;  1M56 B;  2F23 A;  1K9M W;  5KX5 A;  5C8Y A;  3PJS K;  1ZUQ A;  1FPO A;  1N33 B;  1JX9 A;  3CCJ V;  3LDC A;  2CTQ A;  1SER A;  4FZ1 A;  2YS8 A;  1K5S A;  4X1K B;  3IJ4 A;  1DLB A;  1UFI A;  3TK1 A;  1H2S B;  1JOY A;  1SQQ H;  4ZI7 A;  1EFR G;  5A2Q N;  4FMT A;  1OCC C;  2JS3 A;  2VWK A;  1FFT B;  3RYC A;  2PI5 A;  1I08 A;  4IT5 A;  3VQV A;  2QE7 G;  3RVY A;  1EM1 A;  2DYR B;  5BMV A;  3UKM A;  2YXY A;  2E3C A;  3CXH F;  4BIO A;  5CA1 B;  4UUJ C;  1BSM A;  4J7Z A;  4JF3 A;  4R7C A;  1YDX A;  2Q7H A;  3N2G A;  4F6R A;  1HNX O;  1Q90 D;  5JJJ B;  4JI0 O;  2O57 A;  4MVM A;  1VQM V;  2G38 A;  3FAV B;  3RFR A;  4LFA B;  4F6R B;  3SR2 C;  1VQ4 V;  1IUR A;  1Z2G A;  3AEI A;  4U7O A;  1KYO F;  1W59 A;  2IU3 A;  2Q68 A;  4KUM A;  2N74 A;  4PDV A;  1VQ7 V;  1M57 C;  1VQ9 V;  1SA0 B;  1QVF U;  4PHZ A;  4UV8 A;  1BL8 A;  2Z5U A;  2P67 A;  3DGE A;  3J80 N;  2NLJ C;  4JI2 B;  1A32 A;  3TCU A;  2JDI G;  4LH7 A;  4NXN B;  4OGQ B;  4J42 A;  2H94 A;  5BXZ A;  1D2D A;  1BHA A;  1VQL V;  4GX1 A;  3BVO A;  4J80 A;  1JQ0 A;  1X4T A;  3OGI B;  3T4D A;  5KHK A;  1JR9 A;  5LOV A;  2GV9 A;  3DTU B;  1AI5 A;  3JD1 A; 
#chains in the Genus database with same CATH homology
 3ABM B;  2JIZ G;  3ASN C;  3TCU A;  2B1I A;  5DM6 V;  3K04 A;  2D3O W;  1MG1 A;  1S3J A;  2Y69 C;  3ABK B;  1NR7 A;  2IU0 A;  1AI4 A;  4U7N A;  1H8E G;  2JEU A;  2HFE C;  3G71 V;  1ROP A;  3X2Q B;  1VQ5 V;  3I55 V;  1Q7Y W;  4FPP A;  1OHH G;  2X6C A;  3JD4 A;  3OE7 G;  5FL7 G;  1CPY A;  2JJ2 G;  5IY5 B;  4CBC A;  1SRY A;  3CME V;  4WFH A;  2EIK B;  2HLD G;  3WFV A;  2QTO A;  2XAQ A;  3VOU A;  1MOF A;  4TSF G;  4RAI A;  3QO7 A;  2P90 A;  5GW7 A;  3T2M A;  1S5H C;  2IJI A;  2WLM A;  3F7V C;  3UM7 A;  1FXK A;  3ZMV A;  3G6E V;  1VQK V;  3K79 A;  3W7U A;  2QA4 V;  3JD2 A;  5BZB A;  2BOC C;  3ZMU A;  1YJN V;  3ML0 A;  4GX5 A;  3ZRX A;  1UJW B;  2X7R B;  3CCQ V;  3OMI B;  4JGS A;  1KP3 A;  2W0F C;  1K5Q A;  1KC8 W;  4X88 A;  4OXS A;  5CMU A;  5B3S B;  1VQN V;  2WPD G;  3FB5 C;  4UVB A;  1OCR B;  5H9C A;  5LGU A;  3B8N A;  1AJP A;  1QLE C;  4JYC A;  5J9P C;  4I5S A;  3ZMS A;  1H2G A;  4J9Y B;  2XAF A;  5LBQ A;  2BOB C;  1YHQ V;  1R3I C;  4I9W A;  4XBF A;  1PNM A;  1CP9 A;  4G2K A;  1ENV A;  2MK3 A;  2P6J A;  3LSS A;  4MTF A;  4PEL A;  3SYA A;  1FXH A;  5HFM A;  4R50 A;  3E89 A;  3OR7 C;  3STZ C;  2JJ1 G;  4MW3 A;  5KUK A;  1YIT V;  3QNE A;  2EIK C;  1GO3 F;  3LDD A;  3AG1 C;  1FS0 G;  1FXK C;  3M99 B;  5L3D A;  4MS2 A;  1KEC A;  1YSC A;  2R9I A;  2XAS A;  3CMA V;  2WLI A;  1Y4M A;  4F4L A;  1R6N A;  3CCM V;  5E1A C;  5B1B C;  1QR9 A;  1P4R A;  2B1G A;  4TWK A;  4JTD B;  5LGN A;  2EIN C;  2Y48 A;  4QNH B;  4WCE V;  3K3W A;  2EIM C;  2EJR A;  5LHI A;  1NVP B;  3OGC C;  5H6R A;  3ASO B;  1KQS U;  1P7B A;  3T4Z A;  3BEH A;  1E1R G;  3AG4 C;  4WFE A;  1QLN A;  1E1Q G;  3QO8 A;  4JYB A;  2WLN A;  2F43 G;  5B1O A;  4BIZ A;  1H38 A;  4JTA B;  3OMA B;  5LHG A;  3CXC U;  1I5Y A;  4PDM A;  3ZRS A;  3CPW U;  1RM1 C;  4BW5 A;  3TET A;  3MHH C;  2LFR A;  4QE7 A;  2EIL B;  2OTL V;  3SYQ A;  1QR8 A;  1E79 G;  3IGA C;  3D3I A;  1NKD A;  1CEZ A;  3SJQ C;  1K97 A;  3ZRW A;  4J9Z B;  4PA7 A;  2IH1 C;  1FXV A;  2X6B A;  3ABU A;  2DYS C;  3ZN0 A;  3D36 A;  2DYR C;  3E86 A;  2NNU A;  1F51 A;  2YEV A;  4H37 A;  5B3S C;  1J95 A;  5EBM C;  1NH2 D;  3SPG A;  2WLH A;  1MSW D;  1S76 D;  3CC7 V;  1K7D A;  1IXM A;  1F4M A;  3LDE A;  5LGT A;  1SET A;  2C2A A;  4DXW A;  1THZ A;  4MTX A;  3CYO A;  1AJQ A;  2EIL C;  4JPR A;  3W7X A;  4ASU G;  4RQE A;  4MT8 A;  1W2B U;  3JD0 A;  1SES A;  2ZR3 A;  2YSU B;  5KA6 A;  1M1K W;  1F4N A;  3CC2 V;  3ABM C;  2CK3 G;  4JAU A;  5CBH A;  2WLL A;  3FYE B;  2UXN A;  4WF9 V;  1H8H G;  2WLL B;  2IW5 A;  3OMN B;  2W6J G;  4MTO A;  2HJF C;  2W6I G;  2OTJ V;  4JTC B;  1TUE B;  1L1F A;  1S77 D;  4TT3 G;  4PA6 A;  3CCR V;  2XAJ A;  4PA4 A;  5KA5 A;  5L3F A;  3ZRW B;  3OR6 C;  3BY6 A;  2DQ0 A;  2QKS A;  3FYI B;  1GMG A;  3ZN1 A;  3W7T A;  2LP7 A;  2Z3Y A;  2QM8 A;  1HWY A;  1OCZ B;  2QEX V;  1OCC B;  2Q67 A;  3ASO C;  3ZMT A;  3EFF K;  3X2Q C;  5H6Q A;  1OCO B;  3AG4 B;  3AG1 B;  1NJI W;  1M9N A;  3ETG A;  3KG2 A;  1PD3 A;  2IJJ A;  4P30 A;  2K1E A;  2DQ3 A;  5IDJ A;  4RO2 A;  2XAG A;  4R8C A;  1R73 A;  5EK0 A;  3MD0 A;  4KP4 A;  3JYC A;  3E8B A;  1GKF A;  1QCE A;  4ZBM A;  4GT1 A;  2EIJ C;  3CC4 V;  2ITD C;  1BMF G;  2R9R B;  3OUS A;  2XAH A;  2H8P C;  1Q86 W;  3ZCC A;  1RPR A;  4BAY A;  4WFG A;  1K4C C;  1EZJ A;  1M57 B;  1W0J G;  1SZT A;  4Z1M G;  1K4D C;  4GX2 A;  1R3K C;  3K9A A;  3P30 A;  3K06 A;  2AHZ A;  2ZXW B;  5DN6 G;  1M90 W;  2A9H A;  3HPL C;  2Q69 A;  5EC2 C;  4DO2 A;  4R6Z A;  2FTK A;  5B1A C;  1NBM G;  1VQO V;  3CD6 V;  3LNM B;  3OW2 U;  4JAS A;  4GCZ A;  3HB3 B;  3RW0 A;  4PDL A;  2A0L A;  5IYC O;  1NVP D;  3OFN G;  3AG2 B;  2WLJ A;  5L3E A;  5C93 A;  1OCR C;  1Y66 A;  1ARO P;  4GX0 A;  4PA9 A;  1RPO A;  4UVC A;  1WLE A;  2WLI B;  5EC1 C;  4WFF A;  1V54 C;  1AR1 B;  3ABT A;  1VQ6 V;  5B1A B;  1V55 B;  1NR1 A;  3STL C;  2Q6A A;  2WSS G;  4E2L A;  1YTF B;  3K0G A;  4XDL A;  4EKW A;  4MVU A;  2M7W A;  2WWW A;  1V54 B;  1DTO A;  4N23 A;  4Q20 A;  3SPI A;  5LHH A;  2IJH A;  3AG3 B;  3GB7 C;  1QLE B;  4HZ3 A;  4MSW C;  3T1C A;  2P7T C;  3ASN B;  3LSQ A;  1AI5 A;  1PNK A;  4RUE A;  3ZJZ A;  4CZZ A;  1AI6 A;  4MVO A;  1F23 A;  2ITC C;  1BHB A;  3A0R A;  4X89 A;  4RUF A;  1KP2 A;  3R65 A;  3G4S V;  1QVG U;  4P2Z A;  5L3B A;  1R3L C;  4PA3 A;  3SYP A;  1LNQ A;  1W0K G;  1MAB G;  2ATK C;  3K0D A;  1GM7 A;  5HFL A;  3ETD A;  3K08 A;  4FJC C;  3AG2 C;  1YI2 V;  4LC1 A;  1JJ2 U;  3I56 V;  1EBO A;  4L87 A;  2EBO A;  2LFS A;  4MVZ A;  4P9O A;  4JAV A;  1OZ0 A;  1B6Q A;  2ZD9 A;  4QPJ A;  3FB8 C;  3SYC A;  3ZRV A;  1PKX A;  4FIP C;  2GHY A;  1FXK B;  1VQ8 V;  2DWE C;  3JD3 A;  1ZWI C;  3OUF A;  1Q82 W;  1YJW V;  4PDR A;  2EIM B;  1Q81 W;  1KD1 W;  2IJK A;  3CCU V;  4G27 B;  1PL0 A;  3E35 A;  1XL4 A;  4BIU A;  5L3C A;  3E2E A;  5CN0 A;  2V7Q G;  3LUT B;  3CCS V;  3WG7 C;  1G4Y B;  2IH3 C;  3SPJ A;  1JVM A;  2JK5 C;  3E8H A;  1M56 B;  4LP8 A;  1YTF D;  3VBB A;  1K9M W;  1OCZ C;  3OAA G;  2ZR2 A;  3PJS K;  1YJ9 V;  1JX9 A;  3E83 A;  4MW8 A;  3CCJ V;  1QBZ A;  3LDC A;  3EHB B;  1KKD A;  4FK5 C;  1VQP V;  2HG5 C;  1SER A;  3F7Y C;  2EIN B;  2GSM B;  2OT5 A;  4UVA A;  4XDJ A;  5EBW C;  1K5S A;  1GM8 A;  4H33 A;  3QO5 A;  4XDK A;  1DLB A;  1PNL A;  1K33 A;  1JPX A;  3TK1 A;  1JOY A;  2YEV B;  2B5U A;  1EFR G;  1G8M A;  1K92 A;  2V1D A;  4FMT A;  4N21 A;  2ZDI A;  1K3E A;  1OCC C;  3OEE G;  3CCE V;  3OM3 B;  5CBF A;  1GK9 A;  2XND G;  1FFT B;  2PI5 A;  1NH2 B;  2HVJ C;  1COW G;  4LBE C;  3FKS G;  2QE7 G;  2ZDI C;  2HR3 A;  3ETE A;  3RVY A;  2DYR B;  3SPC A;  2X0L A;  3P32 A;  3UKM A;  2KB1 A;  4HYO A;  3ZIA G;  4UUJ C;  3SYO A;  2JEX A;  1R3J C;  4JF3 A;  4R7C A;  1K73 W;  1K34 A;  4P9P A;  1V55 C;  1GM9 A;  2XOK G;  4WFB V;  1AI7 A;  2WLK A;  3JCZ A;  4X8A A;  3ABK C;  1WPX A;  1R6K A;  1YIJ V;  1I5X A;  3H01 A;  4KFM A;  4MVR A;  2DW4 A;  3W7W A;  4MVM A;  3AG3 C;  4HAM A;  2DYS B;  1VQM V;  5IYB O;  2A79 B;  2OCC C;  5IY5 C;  1XL6 A;  5IYD O;  1DF4 A;  1K8A W;  4G28 B;  1VQ4 V;  1ORQ C;  4MVQ A;  2EIJ B;  3AEI A;  1M56 C;  3FB7 C;  4U7O A;  4YXW G;  3K03 A;  4QPK A;  3CP1 A;  4QJF B;  2IU3 A;  1JCH A;  3NXS A;  3FB6 C;  2AHY A;  3IFX A;  2UXX A;  5L3G A;  3GWO A;  2Q68 A;  1RM1 B;  1DF5 A;  4KUM A;  3E8G A;  2ZXW C;  3ABL B;  4PDV A;  1VQ7 V;  1M57 C;  4MVS A;  1VQ9 V;  2QM7 A;  4WFA V;  2X6A A;  3W7S A;  1OCO C;  4RQF A;  1QVF U;  4MTG A;  2WAM A;  3RVZ A;  4UV8 A;  2PI4 A;  1BL8 A;  4UV9 A;  2Z5U A;  2P67 A;  3DGE A;  4LCU C;  2NLJ C;  3B77 A;  3WG7 B;  4ZKI A;  1S72 V;  3MHS C;  2HVK C;  3OEH G;  1S0V A;  2DWD C;  2JDI G;  3ABL C;  3F5W C;  1AJN A;  3IC7 A;  3E8F A;  5EBL C;  3RBZ A;  3SPH A;  2Y69 B;  1N8R W;  5B1N A;  4QIW F;  2H94 A;  1BHA A;  4UXN A;  1VQL V;  5B1B B;  4GX1 A;  5KUM A;  2EZO A;  5CA3 A;  1JQ0 A;  3CCL V;  3CCV V;  3B8M A;  3T4D A;  2HKO A;  3ZMZ A;  1NQT A;  2OCC B;  5CBG A;  2EZP A;  4QE9 A;  1GTO A;  3DTU B;  2ZQM A;  3JD1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...