3CCMV

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ccmV00
1K8AW 1KD1W 1M90W 1QVFU 4WCEV 3G71V 1Q7YW 4WF9V 3CCJV 3CMEV 1YHQV 1S72V 1M1KW 1VQ5V 1VQ6V 1Q82W 2OTLV 1JJ2U 3CC7V 1VQ4V 5DM6V 1R73A 3CCVV 1YJ9V 1K9MW 3CCSV 1Q86W 1KQSU 3CXCU 3CCQV 1VQLV 3CPWU 1W2BU 1Q81W 3CC4V 1N8RW 1K73W 1VQNV 1VQPV 3CMAV 1VQ9V 2QA4V 3CCEV 1NJIW 4WFBV 3CC2V 1VQ7V 3I56V 1VQOV 1YITV 2D3OW 3CCLV 1QVGU 1YJWV 1KC8W 2OTJV 3CD6V 3I55V 1YIJV 4WFAV 2QEXV 1YI2V 3G4SV 1VQ8V 3G6EV 3OW2U 3CCMV 1YJNV 3CCUV 3CCRV 1VQMV 1VQKV
chains in the Genus database with same CATH superfamily
1Z2GA 3K5OA 2WLLA 1KMIZ 3LDDA 1JQ0A 1K7DA 4TQFA 2DYRC 4JI2B 5LMNB 1SA0B 2XT9A 2EIJB 3BHPA 2PTMA 3NR7A 1IXMA 3LDCA 1OV9A 4JAVA 5EZYB 1N32O 4LC1A 2UXDO 2YEVB 1Q43A 5AG2A 1OCOB 1SS3A 5KAIZ 3E8HA 1DTOA 3THOA 1GN6A 2VWKA 3K5MA 4X88A 2BTOA 3J80N 5ITZB 2VWJA 1I08A 1F51A 4OX9B 2ZE5A 2YEVA 1WN7A 4DR1B 5B1BC 1RP3B 5FPOA 1VF6C 4WFGA 1VQLV 1UJWB 2Q67A 4X66B 4J7JA 5LBQA 4BIUA 3ZIAG 1QU7A 1K5SA 2P6JA 3B4SA 3CP1A 1MOFA 1XILA 2GUZB 4AQYB 4YY3O 4IHJB 1Y66A 4LF6B 4D6TH 5A2QN 2AZ0A 4J9YB 2A0LA 2VS0A 2YIAA 2JS3A 2YXYA 3ABLB 3TK1A 3ZRSA 2IU3A 2GUZA 4Z1MG 3BABA 5KHIA 2ARHA 3R66A 3CCLV 1H8HG 4LF4O 1BSMA 3JAKA 3AG2C 4UCOA 5EBMC 3CCMV 4FZ0A 4UCTA 1NZ6A 1AJPA 1RPRA 4JI5O 4TUYB 4PD4F 3OMIB 3JD4A 3X2QB 5IT9N 1VEWA 5LP6B 3GVMA 5BR8B 2P7TC 1BS3A 4FFBB 4TUYA 4I7ZB 4G28B 1K97A 4JI2O 4MVOA 5LP6A 5IJ9B 3ML0A 3TCUA 4LBEC 4DW1A 3ABMB 3CJHB 3K59A 1GH6A 1KUQA 2M7WA 1FXHA 1Q82W 3CRCA 1FYJA 3KG2A 1Q8IA 4UFZA 2OCCC 5IJ9A 2QTOA 3UT5B 3L70H 1E1QG 1N36O 4U3FH 1US6A 4DO2A 1NT2B 3R65A 3STZC 4B3SB 4K8XA 3JCUZ 3UT5A 3SPJA 4DR2B 2X6CA 4F4LA 4OX9O 2EZOA 1MG1A 3CXCU 4C7UA 3MAQA 4WFBV 5JH7A 4X66O 4H33A 3ZN1A 4DRXB 4ZBMA 1XHZA 2HR3A 5LA6A 1K3EA 1W59A 3DC5A 3TXSA 5FLXN 1RM1B 4O2BA 3FB8C 1KBHA 1SETA 1ORQC 2DWEC 5LOVB 5GTHZ 4KFMA 5B1AB 1S72V 4DRXA 4J9ZB 4WBNB 4HBNA 3SJBC 3L74H 2VRZA 3QNEA 1VQNV 4LF7B 2BSKB 4LF8B 1XL4A 1Y74B 4NXNO 4J41A 5LOVA 3ETDA 3CD6V 2QTSA 4FM2A 4CS2A 3C90A 3LSUA 4LFAB 1XHXA 3E8BA 1FXKB 3W7WA 4JYAB 2BSKA 3JASB 1Y74A 4P2ZA 3F5TA 5B1OA 2HLDG 2P4VA 3A2FA 4PA9A 1QQCA 3ZMVA 2N05A 3CCJV 1YZBA 4RO2A 3JATB 1WB7A 4ZI7B 1FXKA 3CPWU 2M6YA 1WB8A 1WAZA 3JASA 2QA4V 4DR5B 2IH1C 3KCXA 2JGDA 3AG7A 2WLHA 2RMKB 2H3OA 3JATA 2JVDA 3ZHSA 1HR0B 3SPGA 2DMXA 4JYCA 1YDXA 1IBKB 3OUSA 2GTAA 4E4EA 3AK3A 2HFEC 5B66Z 1QBZA 4B7EA 4UCUA 4JI1B 2CE4A 4G2KA 2A06H 1JR9A 2N74A 4PELA 2NLJC 1HNXB 3VQXA 1PKXA 4OPHA 1THZA 5LGNA 2FTKA 3ZMZA 2UXBB 1F4MA 1GN2A 1EZVH 4IIJB 2BOCC 3JYCA 4UCRA 1OCZB 3LDEA 4DR2O 4I5SA 4NTWA 3HPLC 1XREA 4DYLA 4IIJA 3P32A 4RUEA 4UVBA 2QSAA 3K57A 1V54C 1S5LZ 2CK3G 3E2EA 4F6EA 2IJHA 4O4IB 3QVNA 1ZTEA 3M7MX 4D7SA 1AJQA 1NTMH 1QVFU 3C3TA 2KB1A 3IC9A 1IBLO 3VOUA 1MZFA 2H8PC 3OGCC 5CB4B 3K08A 2XAFA 1AVMA 4O4IA 5KX5B 4IT5A 5JWPA 3I56V 2LGWA 3H1LH 4TV9A 4LF7O 4LF8O 5LXTB 5CB4A 2LW7A 4LFAO 1R3LC 4DR4B 5KUMA 3HKBB 4U3JA 1H2LA 4GUNA 1L0NH 2B1GA 4JYAO 2JDIG 4YIOA 1SQXH 5LXTA 2VQEB 4BIOA 4CZZA 3SJQC 3B8MA 4GKKB 4NR1A 5L3DA 1L0LH 3ETEA 1M93A 4JGSA 4W4LA 3M8AA 5BXZA 3FD9A 3T4ZA 1HR0O 2GSMB 4B08A 3SPCA 3U0ZA 3DC6A 1IBKO 4I55B 3E35A 3H01A 1NU1H 3ABUA 1TAEA 3LUTB 3ASNB 3JALA 3JARA 4O4JB 2GTSA 2W6JG 1XI1A 1HNXO 2GBOA 1SQBH 1IX9A 3ABKC 5FPRA 2BE3A 2UXBO 2HVJC 1BQZA 4O4JA 2AHZA 3SYAA 1G1XB 1ZAUA 1M4UA 1NR1A 3QO5A 3UQ8A 3NXSA 4I4TA 4JZGA 3T2MA 3WFVA 4DUYB 1NTKH 1NR7A 1ZWIC 3HR0A 1OCCB 3A0HZ 3GB7C 1O9GA 3HKCB 2W6IG 2X0LA 4PA6A 1WJZA 1WNSA 1FD9A 3JAWB 3CRQA 3OR6C 4H0LB 2DYSB 1JPXA 4HYOA 4JASA 1S77D 3JAWA 5E1AC 3M99B 4DV1B 3BA8A 3U10A 4UVCA 2ZKOA 2Y69B 1B6QA 2P4KA 4JF3A 2CGNA 1OCRB 1HDJA 4X8AA 5A9GA 2VQEO 1S76D 1DGSA 3KCYA 3T4DA 1RM1C 1NH2D 5H2FZ 1XMOB 4CC5A 3SDLA 4GKKO 1YSCA 3ZHUA 1XBLA 1VP7A 2F4VB 2JIZG 4JI6B 3FB7C 3JSLA 3ZCCA 5KLVH 1OJHA 4JAUA 4FFKA 3B8NA 3AG3C 3FB5C 2Z3YA 3K3WA 3T1CA 3ZS8C 4GX5A 1FS0G 2ZE6A 1PP9H 5HFLA 3E8GA 4J80A 4GX1A 1I5YA 1HNZO 5L3EA 4PA4A 4WFEA 1YHQV 3FYEB 5FNVB 1ENVA 2NNUA 1BMFG 1B04A 1MABG 2O57A 4X20B 4IYIA 5KAFZ 2YUAA 1VIBA 3JD2A 4TOIA 4KHPB 4DUYO 2R72A 2ZM6B 4X20A 3UO2A 1TVKB 3S3XA 4Q20A 4F6RA 3FKSG 1IZ3A 3ZJZA 5LHGA 5CBFA 4KXRA 5IY5B 2GDSA 1KU9A 4NTYA 5H5NA 2MK3A 4TSFG 2CTPA 1NH2B 4JZ2A 1PM9A 4O2AA 3BAAA 1OZ0A 2UUAB 3CRMA 2OYQA 2WLJA 1HW7A 4DV1O 1TUBB 1YJ9V 1Q86W 1Q6IA 1QLNA 4PJ0Z 1XDCA 3QO8A 3OM3B 3MHSC 3F7VC 1N0NA 4FVMA 4YIPA 5D5PA 2P5OA 1ZX3A 1K33A 1XMOO 3EFFK 5IWAB 1IURA 1Y76B 2F4VO 3QG5A 1V9PA 4WF9V 4JI6O 5K1XA 4LH6A 3RVZA 2F93B 2E76B 5JCOA 2QKAA 1Y76A 3CHXA 2F23A 3T1YO 3JD1A 3ZHVA 3N2GB 1EM1A 2QWPB 1DF4A 3ZX6A 1MNGA 4DV7B 4DR6B 2YSUB 3CCRV 1HNWB 5K1PA 4B7KA 1HWYA 1XMQB 1PNLA 4J7KA 1QR9A 1TA8A 1VQ5V 2UXCB 3N2GA 4JV5B 1H2SB 3OR7C 2DN9A 4KP4A 3G6BA 2XOKG 4ABMA 2GV9A 2LJ2A 3OEHG 1VF7A 1NVPD 1AR4A 4KHPO 3EHBB 3ASNC 4RAIA 1GM7A 2ZM6O 4X9QA 1RPOA 4RWUA 3WB2A 1CXZB 3DXRA 5GONB 4DV5B 2FKXA 3WU2Z 1S3JA 2OIGA 4K0KO 3OD4A 5GONA 1QNMA 1YEWA 2N04A 3OT7A 3JAKB 1XEQA 4CH4A 2Q4PA 3K03A 1IDSA 4MTXA 2YDEA 1I94B 3UM7A 3AG1C 3GWKC 3BPZA 2QGNA 4XDLA 1EFRG 1HP8A 1L8DA 3T1HO 4CC6A 4E2LA 5IDJA 4G27B 1KKCA 3APOA 5IWAO 1SKVA 1PPJH 4FIPC 2A3QA 2PI5A 3I5DA 2EIKC 1PV0A 5LMUB 4ICGA 1R6TA 5KA6A 4XDKA 3E22B 3H1IH 1AP5A 1JCHA 4P30A 2Y4UA 4DUZO 5LMNO 2RDCA 3E22A 1NVPB 4GLXA 1M9NA 2UU9B 4DR6O 2Q9LA 4AHCA 5EYPA 2ZNJA 1GAXA 3OFNG 3OTFA 3BEHA 1N8RW 4JV5O 4OXSA 2PI4A 1COWG 1G4YB 4FLVA 1XOUA 4FZ1A 4FLYA 4H37A 4TV8A 1QLEB 1V55B 4UV8A 2CGOA 1M57C 2ZIOA 4JI0B 2LGQA 4JI3B 5LHHA 5JH7B 4JI8B 4H44B 3K0DA 3IC7A 1BGYH 3CS5A 4DR1O 4XDJA 1AI7A 5LA6B 5J2UA 2JK5C 2H94A 2LFSA 5KHKA 1PD3A 4X1IB 4O2BB 2OIEA 1SF9A 1X4TA 2XTAA 3AG4B 3APQA 1P84F 1E1RG 2ZDIC 2AHYA 1VMGA 4B3RB 4X1IA 4AQYO 2VQFB 1P7GA 3MD0A 3QO7A 4LF6O 5J9PC 2ZD9A 2EX3A 1CP9A 5FL7G 4ZOLB 5IYBO 1SQGA 2ODMA 4JTAB 3SYCA 1I94O 5TISZ 1S5HC 3LSQA 1Z5VA 3SYPA 3MDSA 1R3IC 3DTUB 4MVZA 1IXBA 4GCZA 1GM8A 1QR8A 4UUJC 4ZOLA 1M56B 2JGDB 1SRYA 5LL6Y 4QNHB 3OTOB 2EZPA 2X6AA 1QVGU 1OHHG 2LO1A 4J11A 4MW8A 5BZBA 5BR8O 4OGQB 2E5LB 2QWOB 2EIMB 1BHBA 3BFRA 3D36C 4GKJB 4LWSA 4GYCB 4CH5A 2WLKA 2Z0AA 2JJ2G 2A7WA 2ITCC 2JJ1G 4QE7A 4PI0A 3B40A 3LSSA 3E8FA 4LNUB 2F1MA 1XQ8A 1GO3F 4B3SO 1QCEA 2Q6AA 1KP3A 2QKSA 2Y4TA 3J7AU 3K79A 4JI3O 4JI8O 3F7YC 2EIJC 2RQ6A 4LNUA 1K34A 2EINB 2E3CA 3L9DA 4LCUC 4I50B 5EIBC 3RFRA 3JCZA 3G67A 3H9VA 1BHAA 1OCOC 2WLNA 4I50A 4R8CA 4TV9B 4NXMB 4B3RO 2VQFO 2Q0AA 3TGUH 1D5NA 4AI8A 3ASOB 4U3JB 4BIZA 3W7UA 1B3QA 1LNQA 1T5EA 4P9OA 2Q73A 3K04A 4MVUA 4UCVA 3WB0A 3WG7B 1SZTA 4LFBB 4EKWA 1G8MA 1EZJA 1R3KC 4WFHA 4LF9B 3ABTA 1K4CC 1Q5OA 1JJOA 3N2KA 2UUCB 2V1DA 1ZL8B 4BW5A 4DR5O 2DYRB 3ABLC 3D8CA 2A9HA 3RWRD 2KQXA 1ZL8A 4A5UB 4K8ZA 2E5LO 1M90W 2R9IA 3D3QA 3JALB 2JEXA 1MSDA 4GKJO 3JARB 1FXVA 4YJ3B 1JMKC 1GN3A 2V4DA 4ZIBA 3UKMA 4PDRA 4JI1O 2BTQB 3N27A 5LYJB 1IVSA 3JSNA 3X2QC 4YJ3A 1WPBA 5LP6C 3HB3B 3RYCA 1KD1W 1VARA 4J10A 3BVOA 5IJ0A 2BTQA 4I4TB 5LYJA 2Q8VA 1SZXA 2XAGA 5B1BB 4L8JA 5KHGA 4X1KA 2CTQA 2JEUA 3ABMC 1I0HA 3CX5F 4IGGA 2ATKC 3K58A 4BWAA 2YXHA 1I7FA 1NKDA 1CEZA 1S5JA 4TQDA 4DR3B 3RGBA 2ZR3A 2QR4A 1F7YA 3TJTA 3K5LA 1P7BA 3A0BZ 1VF6A 2DW4A 4EFBA 2EILB 3VQYA 1V55C 5KHHA 2AXTZ 3ZN0A 1W2BU 1PL0A 4JAAA 3QTCA 4YXWG 1KECA 1XL6A 2HJFC 1SC5B 4U7NA 1X59A 3STLC 1KB9F 4KUMA 4I0XB 2XUMA 3RN4A 4JPRA 1FKAO 3BY6A 3UCSC 4FM1A 2FYUH 4UB6Z 1R3JC 4DR4O 4O4LB 1N4CA 4I0XA 2DQ3A 5JVDB 3RYIA 2CTRA 2UUCO 4YHHB 5IYCO 4O4LA 4BW9A 2IJKA 5B1AC 4JYYA 1BE3H 3QF7A 4DR7B 3SR2C 4MTOA 5JVDA 3A0RA 2YXLA 2ITDC 4GX2A 1NBMG 3E86A 1MZEA 2R9RB 2P67A 3CCQV 4NVPA 1FXKC 1AI4A 2Q68A 4MW3A 4FLUA 3BRCA 4J42A 4L87A 2LW1A 4DV2B 2BOBC 4DUZB 1YIJV 4WFAV 2ZQMA 4DV4B 3TETA 2WLMA 4CBCA 1Y67A 2OCCB 3ZHTA 1EN4A 4R7CA 1VQKV 3FB6C 1VQMV 2Y48A 4FMTA 2BCCH 2MW2B 2HG5C 2OTLV 1NS1A 3CRAA 4AILC 2EBOA 1EN6A 5H9CA 1RSOA 3ZMUA 2EIMC 2ZE8A 3LNMB 5GW7A 1MA1A 3B09A 3BCCH 4QE9A 1H2NA 2NR5A 1AP6A 1P4RA 4BAYA 4FLTA 3SPHA 4F6RB 2KG7B 2L6LA 4NYKA 1WA8A 4DR3O 1YF2A 2UXDB 1K4DC 2OWOA 1Y4MA 4HZ3A 4MVQA 3ZMSA 1J5EB 4FLWA 4FK5C 4LFCB 2WSSG 2DWDC 2YI9A 4O2AB 2KG7A 1N33B 1H2KA 3U11A 5CA0B 4RQFA 1P49A 4CH3A 1OCZC 2F66C 3O9OA 1W0JG 5DN6G 2ZXWB 1YTFD 2PZSA 2QM7A 4FJCC 4I9QA 4EEQA 2Q0OC 4X89A 5CA0A 3A8TA 2LFRA 1AROP 2QWNB 1VQ4V 1GMGA 3H1HH 1W0KG 3E89A 1EBOA 2CUGA 1N34B 4FLZA 3ZRWA 3CXHF 1VQ8V 1LUVA 4X64B 4YHHO 4CH6A 3ZBHA 1S0VA 4DR7O 3UO3A 5GTIZ 1GM9A 3RYFB 5J2TB 4PDVA 1XNRB 2ETNA 5B5EZ 3WG7C 1FFXB 2QE7G 2YICA 2DOSA 2XAHA 3RYFA 5J2TA 1FPOA 2FL4A 2XHBA 1FFXA 4DV2O 1M1KW 4DV4O 1BCCH 3CYOA 2CDYA 4LF5B 2JRIA 5H6QA 3PJSK 4MT8A 1KQSU 2CAZC 1Q6UA 1VF5B 3CE2A 4LH7A 2X7RB 3OE7G 3IAYA 5C8YB 1JOYA 2HVKC 4FLXA 5CBHA 4R6ZA 2ZNIA 3CSXA 3DXRB 1YTFB 4WCEV 1SA0A 1CPYA 1V54B 4NB5A 5C8YA 4PHZA 1WP8A 3JD0A 3ZEDA 1N36B 2OT5A 3FX7A 3IFXA 1J5EO 4H13B 4LFCO 3D3IA 2Y0PA 2OTJV 2KKWA 4JYBA 1N33O 5EZYA 1H38A 2ZE7A 3SYQA 2RCVA 5CMUA 4P9PA 4NKGB 4Q6GA 1WLEA 3RW0A 3IJ4A 3L71H 4MS2A 1IBMB 2UUAO 5EC1C 2ZT9B 1R73A 5DM6V 5ITZA 4D7TA 2PYJA 3HKDB 4CS3A 3CMAV 1OCCC 1YCIA 2ZINA 3VBBA 5B3SB 1BZKA 1L1FA 3BA9A 2IW5A 2WWWA 1N34O 2QEXV 2EILC 3G6EV 3HKDA 1Q3EA 4ZKIA 2IU0A 1BQ0A 4MVRA 4X64O 5KMGB 2HJDA 4ZHQB 5LGTA 2DYSC 4NXNB 2IJJA 3CCSV 4IHJA 2ZR2A 1XNRO 1U96A 2PGGA 1NJIW 2R9AA 5KMGA 1QHTA 4IYHA 1SESA 4ZHQA 2Y69C 2Q7EA 2Q7GA 1XUQA 1J95A 1ZSPA 1GN4A 1OCRC 5EYPB 3ETGA 4GT1A 2KSDA 2LP7A 2K1EA 5JQGB 4DV7O 2WA4A 5E79Z 1HNWO 1XMQO 4TV8B 4LF5O 2WLIB 3E83A 1PL4A 1EN5A 2UXCO 3ABKB 2UXXA 1AJNA 5BY1A 2F95B 2AGAA 5JQGA 5CA1B 4DXWA 3CWBH 4FM0A 4PDLA 2WLIA 3L75H 5IYDO 4QPKA 2XAQA 5J2UB 4FFBA 4MVSA 3ZHQA 2JS5A 5CA3A 4N21A 4K35A 5CA1A 5JJNB 3OMAB 1JX9A 1NQTA 2HEPA 1FAFA 1H8EG 1K73W 3CJHA 2YS8A 4DV0B 1XNQB 2LQTA 3CCUV 4PA3A 4DV5O 1B06A 1R6KA 1JJ2U 3LNNA 1SQQH 1IBMO 3CCVV 4PI2A 2HP8A 5IE9A 4UXNA 3SGIA 1AILA 2QM4A 4KL1A 1KYOF 2PY5A 3B77A 3H1KH 5CBGA 3OW2U 1SQFA 1IBLB 2B1IA 4DV3B 5L3CA 2QDOA 4JI7B 5IY5C 5C93A 1Q7YW 2AZ2A 1E79G 2EJ7A 2F43G 1KKDA 1K9MW 4DW0A 2ZXWC 5LGUA 3CCEV 3GWOA 1PNMA 4WBNA 4LWSB 5LMUO 3AG3B 1AI5A 4X65B 4UVAA 2CH7B 1TGOA 1YVWA 1GK9A 1H2GA 4DV6B 1WP7A 3ZRVA 2EULA 3VQVA 2CH7A 3C3SA 1SQPH 2UU9O 2XNDG 1UFIA 2HKOA 5F2VO 5JCOC 3ETQA 4K3AA 3RVYA 1SQVH 2QJ1A 1Z5WA 1SERA 3K0GA 3I55V 3CEIA 3SJAC 4ZI7A 4LP8A 3G4SV 3ZHRA 4B3MB 1AI6A 3B2EE 2EJRA 4JI0O 4JTCB 3ZRXA 3CC7V 1YXBA 4JI4B 4JTDB 3RYHB 1VQPV 2UUBB 2PF4E 4WFFA 1YJWV 1D5AA 1UPGA 1MSWD 1FJGB 1KP2A 3K5NA 2WPDG 4OPAA 4DV0O 3RYHA 1XNQO 2RN9A 4Z2WA 5L3GA 1JVMA 3SJCC 1AR1B 2D2CB 4IL6Z 2DE0X 2OCHA 2X6BA 3F5WC 2YIBD 1NTZH 3K06A 5KHJA 1F4NA 3OUFA 2K9PA 3H1JH 4TT3G 2Y0IA 1BT8A 5EBLC 1Q90D 5CN0A 3N2KB 3SPIA 1G6UA 1A32A 2PYLA 4PA7A 3DSQA 4DV3O 4JI7O 4W4KA 3RBZA 2GHYA 3O65A 4PV1B 1AR5A 2XASA 3RT3C 4QGPA 3ICXA 5JJJB 3OTOO 1JA8A 2FB5A 1KC8W 3Q4HB 2CTWA 2W0XA 3K9AA 5KX5A 2Q5ZA 4QIWF 1TUEB 4X65O 5B3SC 3Q4HA 1BL8A 3OAAG 3HKEB 1F23A 4DV6O 4RQEA 1DLBA 4MVMA 3HKBA 2L35A 1R1BA 4O4HB 3RYCB 5EBWC 1VQOV 2D3OW 4MTGA 5JJEB 5KA5A 5IJ0B 3HKEA 1DK1A 4XBFA 2A79B 2RJZA 2XAJA 1GTOA 2Q7HA 2ZCEA 4O4HA 1Q6HA 5D5QA 4YJ2B 3G71V 4X1KB 4B3MO 1AB3A 4NTXA 4PDMA 2E74B 4R50A 4JI4O 1WPXA 4YJ2A 1HNZB 2UUBO 1MMMA 4I55A 2C2AA 3KZIZ 2IH3C 2P90A 2B5UA 4HNAB 3AK2A 3MHHC 1FJGO 2QWRB 2YIBA 1QLEC 4Z1VA 4BR6A 4HNAA 1Q81W 1FFTB 5KUKA 2IBZH 3KKYA 3S3WA 4NXMO 1URFA 4RUFA 1R6NA 1O9HA 3CRRA 3PN1A 5IYZB 3AG1B 3RYIB 2FMLA 1NI8A 2RNBA 2JGUA 4LFBO 4GX0A 3CMEV 2IJIA 4CS4A 3AG2B 4LF9O 5IYZA 3AG4C 3L72H 3CC4V 5H6RA 2E75B 2G38A 3HKCA 3JD3A 5DECA 2R70A 2QWQB 4GZRB 2Q69A 2HHHB 1U97A 2EIKB 3AEIA 1D2DA 1YJNV 4B3TB 2YC0A 5HFMA 3JAMN 3FFQA 3FYIB 3W7SA 3IGAC 2B9ZA 4FPPA 2ILMA 3L73H 2ZIMA 3OEEG 5BMVB 1M5IA 3OMNB 3VQWA 4ASUG 1VQ9V 2ADQB 4MTFA 1ZUQA 1M56C 3FAVB 4X62B 4QPJA 4UB8Z 5BMVA 4QJFB 2P22C 1RSOB 4LR3A 1ZLZA 3FAVA 5DEDA 2Z5UA 1M57B 3T1YB 4UV9A 4J7ZA 4UCSA 5EK0A 1PNKA 3CC2V 1VQ7V 1WA8B 2PUSA 3P3NA 2P06A 4DK0A 1H2MA 1GKFA 4U7OA 1LUWA 1N32B 5L3FA 4X1YB 2DJVA 2WA3A 3P30A 4I9WA 3G80A 4DK1A 5B1NA 3CB2A 3SYOA 3EXAA 4X1YA 5FNVA 2WAMA 3DGEA 5EC2C 2V7QG 2ZDIA 5LHIA 2YI8A 1K8AW 5EIBD 2UXNA 2ADPA 3J81N 3P3PA 1K5QA 3ZRWB 1VQ6V 2EINC 1ROPA 2QM8A 4N23A 1JFFB 4EB6B 2AW9A 3W7TA 3WB1A 4EFEA 3W7XA 1LR1A 4K0KB 1TVKA 2QKCA 4TWKA 4YY3B 1YI2V 1JFFA 4EB6A 3ZMTA 3OGIB 2YIDA 3AK1A 5L3BA 2HHHO 3TXQA 3ASOC 4B3TO 2W0FC 4MSWC 4LF4B 1Y6XA 2IM9A 2WLLB 1DF5A 1YITV 3T1HB 2NN4A 2DQ0A 1I5XA 1GRJA 1TUBA 3K9SA 4HAMA 1RFYA 1N0JA 1K92A 3EVKA 4X62O 3D36A 4JI5B
chains in the Genus database with same CATH topology
3JCZA 2WLLA 4MVSA 4UVCA 1BHAA 5CA3A 4N21A 1OCOC 2WLNA 2Y69B 3LDDA 1B6QA 4JF3A 4R8CA 1OCRB 1JQ0A 1K7DA 4X8AA 3OMAB 1JX9A 1NQTA 2DYRC 1H8EG 1K73W 1S76D 3T4DA 3ASOB 1RM1C 4BIZA 1NH2D 3W7UA 1LNQA 4P9OA 1YSCA 3K04A 4MVUA 3WG7B 2EIJB 1SZTA 2JIZG 4EKWA 1G8MA 3CCUV 4PA3A 1EZJA 1R3KC 3FB7C 4WFHA 1IXMA 3ZCCA 3ABTA 1K4CC 4JAUA 1R6KA 1JJ2U 3B8NA 3LDCA 4JAVA 3CCVV 3AG3C 3FB5C 4LC1A 2Z3YA 3K3WA 4UXNA 3T1CA 2V1DA 4GX5A 2YEVB 1FS0G 1OCOB 4BW5A 3E8HA 1DTOA 3B77A 5HFLA 3E8GA 5CBGA 3OW2U 2DYRB 4X88A 3ABLC 4GX1A 2A9HA 1I5YA 2B1IA 5L3EA 1F51A 2YEVA 5L3CA 1M90W 5B1BC 5IY5C 5C93A 1Q7YW 4PA4A 4WFEA 1YHQV 3FYEB 2R9IA 1E79G 2F43G 4WFGA 2JEXA 1KKDA 1ENVA 2NNUA 1BMFG 1K9MW 2ZXWC 1UJWB 1VQLV 1FXVA 2Q67A 1MABG 5LGUA 5LBQA 3UKMA 4BIUA 3ZIAG 4PDRA 3CCEV 1K5SA 3GWOA 1PNMA 2P6JA 3CP1A 3JD2A 3AG3B 1MOFA 1AI5A 4UVAA 3X2QC 1Y66A 1KD1W 3HB3B 1GK9A 1H2GA 3ZRVA 4J9YB 2A0LA 3ABLB 3TK1A 4Q20A 3ZRSA 3FKSG 2IU3A 3ZJZA 5LHGA 4Z1MG 5CBFA 2XNDG 2XAGA 2HKOA 5B1BB 3RVYA 5IY5B 3CCLV 2JEUA 3ABMC 1H8HG 2MK3A 1SERA 3K0GA 4TSFG 3I55V 1NH2B 4LP8A 2ATKC 3G4SV 3AG2C 1OZ0A 5EBMC 3CCMV 1NKDA 1CEZA 1AI6A 2ZR3A 2WLJA 1P7BA 2DW4A 2EJRA 1AJPA 1RPRA 4JTCB 3ZRXA 3CC7V 2EILB 3OMIB 3JD4A 3X2QB 1YJ9V 1Q86W 1V55C 1QLNA 3ZN0A 1W2BU 4JTDB 1PL0A 1VQPV 3QO8A 3OM3B 4YXWG 1KECA 1XL6A 2P7TC 2HJFC 3MHSC 4WFFA 3F7VC 1YJWV 4U7NA 1K33A 3STLC 1MSWD 4G28B 1KP2A 4KUMA 3EFFK 2WPDG 4JPRA 1K97A 4MVOA 3BY6A 3ML0A 3TCUA 4LBEC 1R3JC 1JVMA 3ABMB 5L3GA 1AR1B 4WF9V 2M7WA 1FXHA 1Q82W 3KG2A 3RVZA 2DQ3A 2OCCC 2X6BA 3F5WC 3K06A 2QTOA 1F4NA 3OUFA 4TT3G 1E1QG 5EBLC 3JD1A 5IYCO 2IJKA 5B1AC 4DO2A 3R65A 3STZC 1DF4A 5CN0A 4MTOA 2YSUB 3CCRV 3A0RA 3SPIA 3SPJA 2ITDC 1HWYA 1NBMG 4GX2A 1PNLA 2X6CA 3E86A 4F4LA 4PA7A 1QR9A 1VQ5V 2EZOA 2R9RB 2P67A 3OR7C 3RBZA 1MG1A 2GHYA 3CXCU 3CCQV 2XASA 1FXKC 4KP4A 1AI4A 2Q68A 4MW3A 4WFBV 1KC8W 4L87A 2BOBC 2XOKG 4H33A 3K9AA 3ZN1A 4WFAV 1YIJV 2ZQMA 4ZBMA 3TETA 2WLMA 2HR3A 4CBCA 1K3EA 2OCCB 4QIWF 3OEHG 4R7CA 1NVPD 1VQKV 3FB6C 1VQMV 2Y48A 1TUEB 4FMTA 1RM1B 5B3SC 3FB8C 1BL8A 1SETA 1ORQC 2DWEC 3ASNC 3EHBB 4RAIA 4KFMA 5B1AB 1S72V 1GM7A 2HG5C 3OAAG 2OTLV 4J9ZB 1RPOA 1F23A 4RQEA 1DLBA 2EBOA 4MVMA 3QNEA 5H9CA 1VQNV 3ZMUA 1XL4A 2EIMC 3LNMB 5GW7A 5EBWC 1VQOV 2D3OW 4MTGA 4QE9A 3ETDA 3CD6V 5KA5A 4XBFA 2A79B 1S3JA 3E8BA 2XAJA 1GTOA 1P4RA 4BAYA 1FXKB 3SPHA 3W7WA 4P2ZA 5B1OA 3G71V 2HLDG 3ZMVA 4PA9A 3CCJV 4RO2A 1K4DC 4PDMA 1Y4MA 4HZ3A 4MVQA 3ZMSA 3K03A 1FXKA 4FK5C 4MTXA 3CPWU 2WSSG 4R50A 2DWDC 3UM7A 2QA4V 2IH1C 3AG1C 1WPXA 4RQFA 2WLHA 1OCZC 2C2AA 4XDLA 1EFRG 1W0JG 3SPGA 2IH3C 2ZXWB 4JYCA 2P90A 5DN6G 2B5UA 4E2LA 5IDJA 1YTFD 3MHHC 4G27B 2QM7A 3OUSA 4FJCC 4X89A 2HFEC 2LFRA 4FIPC 1AROP 1QBZA 1VQ4V 1GMGA 2PI5A 1QLEC 1W0KG 2EIKC 1Q81W 1FFTB 3E89A 5KUKA 1EBOA 5KA6A 4G2KA 4XDKA 3ZRWA 4RUFA 1JCHA 4PELA 2NLJC 1R6NA 4P30A 1VQ8V 1PKXA 1THZA 5LGNA 2FTKA 3ZMZA 3AG1B 1S0VA 1F4MA 1NVPB 1M9NA 2BOCC 3JYCA 4GX0A 3CMEV 1GM9A 1OCZB 2IJIA 4PDVA 3LDEA 3WG7C 3OFNG 3AG2B 3BEHA 2QE7G 3CC4V 3AG4C 4I5SA 1N8RW 3HPLC 5H6RA 4OXSA 2PI4A 1COWG 1G4YB 3JD3A 2XAHA 3P32A 4RUEA 4UVBA 4H37A 1QLEB 1V54C 2Q69A 2CK3G 1V55B 2EIKB 3AEIA 3E2EA 4UV8A 1YJNV 1M57C 2IJHA 5HFMA 1M1KW 3FYIB 1AJQA 3W7SA 3CYOA 1QVFU 2KB1A 3IGAC 5LHHA 3VOUA 4FPPA 2H8PC 3OGCC 3K0DA 3IC7A 5H6QA 3OEEG 3PJSK 4MT8A 3K08A 4XDJA 1KQSU 2XAFA 1AI7A 3OMNB 4ASUG 2JK5C 1VQ9V 2H94A 2LFSA 4MTFA 2X7RB 3I56V 1M56C 3OE7G 1PD3A 1JOYA 2HVKC 4QPJA 3AG4B 5CBHA 4R6ZA 1E1RG 2ZDIC 1R3LC 5KUMA 2AHYA 4QJFB 1YTFB 4WCEV 2B1GA 2JDIG 1CPYA 1V54B 3MD0A 2Z5UA 1M57B 3QO7A 3SJQC 3JD0A 4CZZA 3B8MA 4UV9A 2OT5A 5J9PC 2ZD9A 1CP9A 5FL7G 3IFXA 5IYBO 5EK0A 1PNKA 3CC2V 1VQ7V 3D3IA 4JTAB 3SYCA 5L3DA 2OTJV 1S5HC 3LSQA 4JYBA 3ETEA 1H38A 3SYPA 3SYQA 4JGSA 1R3IC 3DTUB 4P9PA 5CMUA 4MVZA 1GKFA 4GCZA 1GM8A 1QR8A 4U7OA 4UUJC 3T4ZA 1WLEA 1M56B 2GSMB 3RW0A 4MS2A 3SPCA 5L3FA 1SRYA 5EC1C 3P30A 1R73A 5DM6V 4QNHB 2EZPA 3E35A 3H01A 4I9WA 5B1NA 2X6AA 3CMAV 1OCCC 3ABUA 3VBBA 5B3SB 3SYOA 1L1FA 1QVGU 1OHHG 3LUTB 2IW5A 3ASNB 4MW8A 2WWWA 5BZBA 2WAMA 3DGEA 5EC2C 2EILC 2QEXV 2V7QG 2ZDIA 3G6EV 2W6JG 5LHIA 4ZKIA 2IU0A 1K8AW 4MVRA 2EIMB 1BHBA 3ABKC 2UXNA 1K5QA 3ZRWB 2HVJC 5LGTA 2EINC 1VQ6V 1ROPA 2DYSC 2QM8A 2WLKA 2AHZA 4N23A 2IJJA 3SYAA 2JJ2G 3CCSV 3W7TA 2ZR2A 2ITCC 2JJ1G 1NR1A 3W7XA 1NJIW 3QO5A 4QE7A 3NXSA 3T2MA 1SESA 4TWKA 2Y69C 3WFVA 1J95A 1YI2V 1NR7A 1OCRC 1ZWIC 3ZMTA 3LSSA 3ETGA 4GT1A 5L3BA 1OCCB 3E8FA 2LP7A 3GB7C 3ASOC 1GO3F 2K1EA 1QCEA 2Q6AA 1KP3A 2W6IG 2X0LA 2W0FC 4PA6A 2QKSA 3K79A 2WLIB 3E83A 3F7YC 2EIJC 4MSWC 3ABKB 2UXXA 1AJNA 1K34A 2WLLB 1DF5A 1YITV 3OR6C 2DQ0A 2EINB 1I5XA 2DYSB 4DXWA 4LCUC 1JPXA 4HYOA 4JASA 1S77D 4HAMA 2WLIA 4PDLA 5E1AC 5IYDO 4QPKA 1K92A 3M99B 2XAQA 3D36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8A W;  1KD1 W;  1M90 W;  1QVF U;  4WCE V;  3G71 V;  1Q7Y W;  4WF9 V;  3CCJ V;  3CME V;  1YHQ V;  1S72 V;  1M1K W;  1VQ5 V;  1VQ6 V;  1Q82 W;  2OTL V;  1JJ2 U;  3CC7 V;  1VQ4 V;  5DM6 V;  1R73 A;  3CCV V;  1YJ9 V;  1K9M W;  3CCS V;  1Q86 W;  1KQS U;  3CXC U;  3CCQ V;  1VQL V;  3CPW U;  1W2B U;  1Q81 W;  3CC4 V;  1N8R W;  1K73 W;  1VQN V;  1VQP V;  3CMA V;  1VQ9 V;  2QA4 V;  3CCE V;  1NJI W;  4WFB V;  3CC2 V;  1VQ7 V;  3I56 V;  1VQO V;  1YIT V;  2D3O W;  3CCL V;  1QVG U;  1YJW V;  1KC8 W;  2OTJ V;  3CD6 V;  3I55 V;  1YIJ V;  4WFA V;  2QEX V;  1YI2 V;  3G4S V;  1VQ8 V;  3G6E V;  3OW2 U;  3CCM V;  1YJN V;  3CCU V;  3CCR V;  1VQM V;  1VQK V; 
#chains in the Genus database with same CATH topology
 1Z2G A;  3K5O A;  2WLL A;  1KMI Z;  3LDD A;  1JQ0 A;  1K7D A;  4TQF A;  2DYR C;  4JI2 B;  5LMN B;  1SA0 B;  2XT9 A;  2EIJ B;  3BHP A;  2PTM A;  3NR7 A;  1IXM A;  3LDC A;  1OV9 A;  4JAV A;  5EZY B;  1N32 O;  4LC1 A;  2UXD O;  2YEV B;  1Q43 A;  5AG2 A;  1OCO B;  1SS3 A;  5KAI Z;  3E8H A;  1DTO A;  3THO A;  1GN6 A;  2VWK A;  3K5M A;  4X88 A;  2BTO A;  3J80 N;  5ITZ B;  2VWJ A;  1I08 A;  1F51 A;  4OX9 B;  2ZE5 A;  2YEV A;  1WN7 A;  4DR1 B;  5B1B C;  1RP3 B;  5FPO A;  1VF6 C;  4WFG A;  1VQL V;  1UJW B;  2Q67 A;  4X66 B;  4J7J A;  5LBQ A;  4BIU A;  3ZIA G;  1QU7 A;  1K5S A;  2P6J A;  3B4S A;  3CP1 A;  1MOF A;  1XIL A;  2GUZ B;  4AQY B;  4YY3 O;  4IHJ B;  1Y66 A;  4LF6 B;  4D6T H;  5A2Q N;  2AZ0 A;  4J9Y B;  2A0L A;  2VS0 A;  2YIA A;  2JS3 A;  2YXY A;  3ABL B;  3TK1 A;  3ZRS A;  2IU3 A;  2GUZ A;  4Z1M G;  3BAB A;  5KHI A;  2ARH A;  3R66 A;  3CCL V;  1H8H G;  4LF4 O;  1BSM A;  3JAK A;  3AG2 C;  4UCO A;  5EBM C;  3CCM V;  4FZ0 A;  4UCT A;  1NZ6 A;  1AJP A;  1RPR A;  4JI5 O;  4TUY B;  4PD4 F;  3OMI B;  3JD4 A;  3X2Q B;  5IT9 N;  1VEW A;  5LP6 B;  3GVM A;  5BR8 B;  2P7T C;  1BS3 A;  4FFB B;  4TUY A;  4I7Z B;  4G28 B;  1K97 A;  4JI2 O;  4MVO A;  5LP6 A;  5IJ9 B;  3ML0 A;  3TCU A;  4LBE C;  4DW1 A;  3ABM B;  3CJH B;  3K59 A;  1GH6 A;  1KUQ A;  2M7W A;  1FXH A;  1Q82 W;  3CRC A;  1FYJ A;  3KG2 A;  1Q8I A;  4UFZ A;  2OCC C;  5IJ9 A;  2QTO A;  3UT5 B;  3L70 H;  1E1Q G;  1N36 O;  4U3F H;  1US6 A;  4DO2 A;  1NT2 B;  3R65 A;  3STZ C;  4B3S B;  4K8X A;  3JCU Z;  3UT5 A;  3SPJ A;  4DR2 B;  2X6C A;  4F4L A;  4OX9 O;  2EZO A;  1MG1 A;  3CXC U;  4C7U A;  3MAQ A;  4WFB V;  5JH7 A;  4X66 O;  4H33 A;  3ZN1 A;  4DRX B;  4ZBM A;  1XHZ A;  2HR3 A;  5LA6 A;  1K3E A;  1W59 A;  3DC5 A;  3TXS A;  5FLX N;  1RM1 B;  4O2B A;  3FB8 C;  1KBH A;  1SET A;  1ORQ C;  2DWE C;  5LOV B;  5GTH Z;  4KFM A;  5B1A B;  1S72 V;  4DRX A;  4J9Z B;  4WBN B;  4HBN A;  3SJB C;  3L74 H;  2VRZ A;  3QNE A;  1VQN V;  4LF7 B;  2BSK B;  4LF8 B;  1XL4 A;  1Y74 B;  4NXN O;  4J41 A;  5LOV A;  3ETD A;  3CD6 V;  2QTS A;  4FM2 A;  4CS2 A;  3C90 A;  3LSU A;  4LFA B;  1XHX A;  3E8B A;  1FXK B;  3W7W A;  4JYA B;  2BSK A;  3JAS B;  1Y74 A;  4P2Z A;  3F5T A;  5B1O A;  2HLD G;  2P4V A;  3A2F A;  4PA9 A;  1QQC A;  3ZMV A;  2N05 A;  3CCJ V;  1YZB A;  4RO2 A;  3JAT B;  1WB7 A;  4ZI7 B;  1FXK A;  3CPW U;  2M6Y A;  1WB8 A;  1WAZ A;  3JAS A;  2QA4 V;  4DR5 B;  2IH1 C;  3KCX A;  2JGD A;  3AG7 A;  2WLH A;  2RMK B;  2H3O A;  3JAT A;  2JVD A;  3ZHS A;  1HR0 B;  3SPG A;  2DMX A;  4JYC A;  1YDX A;  1IBK B;  3OUS A;  2GTA A;  4E4E A;  3AK3 A;  2HFE C;  5B66 Z;  1QBZ A;  4B7E A;  4UCU A;  4JI1 B;  2CE4 A;  4G2K A;  2A06 H;  1JR9 A;  2N74 A;  4PEL A;  2NLJ C;  1HNX B;  3VQX A;  1PKX A;  4OPH A;  1THZ A;  5LGN A;  2FTK A;  3ZMZ A;  2UXB B;  1F4M A;  1GN2 A;  1EZV H;  4IIJ B;  2BOC C;  3JYC A;  4UCR A;  1OCZ B;  3LDE A;  4DR2 O;  4I5S A;  4NTW A;  3HPL C;  1XRE A;  4DYL A;  4IIJ A;  3P32 A;  4RUE A;  4UVB A;  2QSA A;  3K57 A;  1V54 C;  1S5L Z;  2CK3 G;  3E2E A;  4F6E A;  2IJH A;  4O4I B;  3QVN A;  1ZTE A;  3M7M X;  4D7S A;  1AJQ A;  1NTM H;  1QVF U;  3C3T A;  2KB1 A;  3IC9 A;  1IBL O;  3VOU A;  1MZF A;  2H8P C;  3OGC C;  5CB4 B;  3K08 A;  2XAF A;  1AVM A;  4O4I A;  5KX5 B;  4IT5 A;  5JWP A;  3I56 V;  2LGW A;  3H1L H;  4TV9 A;  4LF7 O;  4LF8 O;  5LXT B;  5CB4 A;  2LW7 A;  4LFA O;  1R3L C;  4DR4 B;  5KUM A;  3HKB B;  4U3J A;  1H2L A;  4GUN A;  1L0N H;  2B1G A;  4JYA O;  2JDI G;  4YIO A;  1SQX H;  5LXT A;  2VQE B;  4BIO A;  4CZZ A;  3SJQ C;  3B8M A;  4GKK B;  4NR1 A;  5L3D A;  1L0L H;  3ETE A;  1M93 A;  4JGS A;  4W4L A;  3M8A A;  5BXZ A;  3FD9 A;  3T4Z A;  1HR0 O;  2GSM B;  4B08 A;  3SPC A;  3U0Z A;  3DC6 A;  1IBK O;  4I55 B;  3E35 A;  3H01 A;  1NU1 H;  3ABU A;  1TAE A;  3LUT B;  3ASN B;  3JAL A;  3JAR A;  4O4J B;  2GTS A;  2W6J G;  1XI1 A;  1HNX O;  2GBO A;  1SQB H;  1IX9 A;  3ABK C;  5FPR A;  2BE3 A;  2UXB O;  2HVJ C;  1BQZ A;  4O4J A;  2AHZ A;  3SYA A;  1G1X B;  1ZAU A;  1M4U A;  1NR1 A;  3QO5 A;  3UQ8 A;  3NXS A;  4I4T A;  4JZG A;  3T2M A;  3WFV A;  4DUY B;  1NTK H;  1NR7 A;  1ZWI C;  3HR0 A;  1OCC B;  3A0H Z;  3GB7 C;  1O9G A;  3HKC B;  2W6I G;  2X0L A;  4PA6 A;  1WJZ A;  1WNS A;  1FD9 A;  3JAW B;  3CRQ A;  3OR6 C;  4H0L B;  2DYS B;  1JPX A;  4HYO A;  4JAS A;  1S77 D;  3JAW A;  5E1A C;  3M99 B;  4DV1 B;  3BA8 A;  3U10 A;  4UVC A;  2ZKO A;  2Y69 B;  1B6Q A;  2P4K A;  4JF3 A;  2CGN A;  1OCR B;  1HDJ A;  4X8A A;  5A9G A;  2VQE O;  1S76 D;  1DGS A;  3KCY A;  3T4D A;  1RM1 C;  1NH2 D;  5H2F Z;  1XMO B;  4CC5 A;  3SDL A;  4GKK O;  1YSC A;  3ZHU A;  1XBL A;  1VP7 A;  2F4V B;  2JIZ G;  4JI6 B;  3FB7 C;  3JSL A;  3ZCC A;  5KLV H;  1OJH A;  4JAU A;  4FFK A;  3B8N A;  3AG3 C;  3FB5 C;  2Z3Y A;  3K3W A;  3T1C A;  3ZS8 C;  4GX5 A;  1FS0 G;  2ZE6 A;  1PP9 H;  5HFL A;  3E8G A;  4J80 A;  4GX1 A;  1I5Y A;  1HNZ O;  5L3E A;  4PA4 A;  4WFE A;  1YHQ V;  3FYE B;  5FNV B;  1ENV A;  2NNU A;  1BMF G;  1B04 A;  1MAB G;  2O57 A;  4X20 B;  4IYI A;  5KAF Z;  2YUA A;  1VIB A;  3JD2 A;  4TOI A;  4KHP B;  4DUY O;  2R72 A;  2ZM6 B;  4X20 A;  3UO2 A;  1TVK B;  3S3X A;  4Q20 A;  4F6R A;  3FKS G;  1IZ3 A;  3ZJZ A;  5LHG A;  5CBF A;  4KXR A;  5IY5 B;  2GDS A;  1KU9 A;  4NTY A;  5H5N A;  2MK3 A;  4TSF G;  2CTP A;  1NH2 B;  4JZ2 A;  1PM9 A;  4O2A A;  3BAA A;  1OZ0 A;  2UUA B;  3CRM A;  2OYQ A;  2WLJ A;  1HW7 A;  4DV1 O;  1TUB B;  1YJ9 V;  1Q86 W;  1Q6I A;  1QLN A;  4PJ0 Z;  1XDC A;  3QO8 A;  3OM3 B;  3MHS C;  3F7V C;  1N0N A;  4FVM A;  4YIP A;  5D5P A;  2P5O A;  1ZX3 A;  1K33 A;  1XMO O;  3EFF K;  5IWA B;  1IUR A;  1Y76 B;  2F4V O;  3QG5 A;  1V9P A;  4WF9 V;  4JI6 O;  5K1X A;  4LH6 A;  3RVZ A;  2F93 B;  2E76 B;  5JCO A;  2QKA A;  1Y76 A;  3CHX A;  2F23 A;  3T1Y O;  3JD1 A;  3ZHV A;  3N2G B;  1EM1 A;  2QWP B;  1DF4 A;  3ZX6 A;  1MNG A;  4DV7 B;  4DR6 B;  2YSU B;  3CCR V;  1HNW B;  5K1P A;  4B7K A;  1HWY A;  1XMQ B;  1PNL A;  4J7K A;  1QR9 A;  1TA8 A;  1VQ5 V;  2UXC B;  3N2G A;  4JV5 B;  1H2S B;  3OR7 C;  2DN9 A;  4KP4 A;  3G6B A;  2XOK G;  4ABM A;  2GV9 A;  2LJ2 A;  3OEH G;  1VF7 A;  1NVP D;  1AR4 A;  4KHP O;  3EHB B;  3ASN C;  4RAI A;  1GM7 A;  2ZM6 O;  4X9Q A;  1RPO A;  4RWU A;  3WB2 A;  1CXZ B;  3DXR A;  5GON B;  4DV5 B;  2FKX A;  3WU2 Z;  1S3J A;  2OIG A;  4K0K O;  3OD4 A;  5GON A;  1QNM A;  1YEW A;  2N04 A;  3OT7 A;  3JAK B;  1XEQ A;  4CH4 A;  2Q4P A;  3K03 A;  1IDS A;  4MTX A;  2YDE A;  1I94 B;  3UM7 A;  3AG1 C;  3GWK C;  3BPZ A;  2QGN A;  4XDL A;  1EFR G;  1HP8 A;  1L8D A;  3T1H O;  4CC6 A;  4E2L A;  5IDJ A;  4G27 B;  1KKC A;  3APO A;  5IWA O;  1SKV A;  1PPJ H;  4FIP C;  2A3Q A;  2PI5 A;  3I5D A;  2EIK C;  1PV0 A;  5LMU B;  4ICG A;  1R6T A;  5KA6 A;  4XDK A;  3E22 B;  3H1I H;  1AP5 A;  1JCH A;  4P30 A;  2Y4U A;  4DUZ O;  5LMN O;  2RDC A;  3E22 A;  1NVP B;  4GLX A;  1M9N A;  2UU9 B;  4DR6 O;  2Q9L A;  4AHC A;  5EYP A;  2ZNJ A;  1GAX A;  3OFN G;  3OTF A;  3BEH A;  1N8R W;  4JV5 O;  4OXS A;  2PI4 A;  1COW G;  1G4Y B;  4FLV A;  1XOU A;  4FZ1 A;  4FLY A;  4H37 A;  4TV8 A;  1QLE B;  1V55 B;  4UV8 A;  2CGO A;  1M57 C;  2ZIO A;  4JI0 B;  2LGQ A;  4JI3 B;  5LHH A;  5JH7 B;  4JI8 B;  4H44 B;  3K0D A;  3IC7 A;  1BGY H;  3CS5 A;  4DR1 O;  4XDJ A;  1AI7 A;  5LA6 B;  5J2U A;  2JK5 C;  2H94 A;  2LFS A;  5KHK A;  1PD3 A;  4X1I B;  4O2B B;  2OIE A;  1SF9 A;  1X4T A;  2XTA A;  3AG4 B;  3APQ A;  1P84 F;  1E1R G;  2ZDI C;  2AHY A;  1VMG A;  4B3R B;  4X1I A;  4AQY O;  2VQF B;  1P7G A;  3MD0 A;  3QO7 A;  4LF6 O;  5J9P C;  2ZD9 A;  2EX3 A;  1CP9 A;  5FL7 G;  4ZOL B;  5IYB O;  1SQG A;  2ODM A;  4JTA B;  3SYC A;  1I94 O;  5TIS Z;  1S5H C;  3LSQ A;  1Z5V A;  3SYP A;  3MDS A;  1R3I C;  3DTU B;  4MVZ A;  1IXB A;  4GCZ A;  1GM8 A;  1QR8 A;  4UUJ C;  4ZOL A;  1M56 B;  2JGD B;  1SRY A;  5LL6 Y;  4QNH B;  3OTO B;  2EZP A;  2X6A A;  1QVG U;  1OHH G;  2LO1 A;  4J11 A;  4MW8 A;  5BZB A;  5BR8 O;  4OGQ B;  2E5L B;  2QWO B;  2EIM B;  1BHB A;  3BFR A;  3D36 C;  4GKJ B;  4LWS A;  4GYC B;  4CH5 A;  2WLK A;  2Z0A A;  2JJ2 G;  2A7W A;  2ITC C;  2JJ1 G;  4QE7 A;  4PI0 A;  3B40 A;  3LSS A;  3E8F A;  4LNU B;  2F1M A;  1XQ8 A;  1GO3 F;  4B3S O;  1QCE A;  2Q6A A;  1KP3 A;  2QKS A;  2Y4T A;  3J7A U;  3K79 A;  4JI3 O;  4JI8 O;  3F7Y C;  2EIJ C;  2RQ6 A;  4LNU A;  1K34 A;  2EIN B;  2E3C A;  3L9D A;  4LCU C;  4I50 B;  5EIB C;  3RFR A;  3JCZ A;  3G67 A;  3H9V A;  1BHA A;  1OCO C;  2WLN A;  4I50 A;  4R8C A;  4TV9 B;  4NXM B;  4B3R O;  2VQF O;  2Q0A A;  3TGU H;  1D5N A;  4AI8 A;  3ASO B;  4U3J B;  4BIZ A;  3W7U A;  1B3Q A;  1LNQ A;  1T5E A;  4P9O A;  2Q73 A;  3K04 A;  4MVU A;  4UCV A;  3WB0 A;  3WG7 B;  1SZT A;  4LFB B;  4EKW A;  1G8M A;  1EZJ A;  1R3K C;  4WFH A;  4LF9 B;  3ABT A;  1K4C C;  1Q5O A;  1JJO A;  3N2K A;  2UUC B;  2V1D A;  1ZL8 B;  4BW5 A;  4DR5 O;  2DYR B;  3ABL C;  3D8C A;  2A9H A;  3RWR D;  2KQX A;  1ZL8 A;  4A5U B;  4K8Z A;  2E5L O;  1M90 W;  2R9I A;  3D3Q A;  3JAL B;  2JEX A;  1MSD A;  4GKJ O;  3JAR B;  1FXV A;  4YJ3 B;  1JMK C;  1GN3 A;  2V4D A;  4ZIB A;  3UKM A;  4PDR A;  4JI1 O;  2BTQ B;  3N27 A;  5LYJ B;  1IVS A;  3JSN A;  3X2Q C;  4YJ3 A;  1WPB A;  5LP6 C;  3HB3 B;  3RYC A;  1KD1 W;  1VAR A;  4J10 A;  3BVO A;  5IJ0 A;  2BTQ A;  4I4T B;  5LYJ A;  2Q8V A;  1SZX A;  2XAG A;  5B1B B;  4L8J A;  5KHG A;  4X1K A;  2CTQ A;  2JEU A;  3ABM C;  1I0H A;  3CX5 F;  4IGG A;  2ATK C;  3K58 A;  4BWA A;  2YXH A;  1I7F A;  1NKD A;  1CEZ A;  1S5J A;  4TQD A;  4DR3 B;  3RGB A;  2ZR3 A;  2QR4 A;  1F7Y A;  3TJT A;  3K5L A;  1P7B A;  3A0B Z;  1VF6 A;  2DW4 A;  4EFB A;  2EIL B;  3VQY A;  1V55 C;  5KHH A;  2AXT Z;  3ZN0 A;  1W2B U;  1PL0 A;  4JAA A;  3QTC A;  4YXW G;  1KEC A;  1XL6 A;  2HJF C;  1SC5 B;  4U7N A;  1X59 A;  3STL C;  1KB9 F;  4KUM A;  4I0X B;  2XUM A;  3RN4 A;  4JPR A;  1FKA O;  3BY6 A;  3UCS C;  4FM1 A;  2FYU H;  4UB6 Z;  1R3J C;  4DR4 O;  4O4L B;  1N4C A;  4I0X A;  2DQ3 A;  5JVD B;  3RYI A;  2CTR A;  2UUC O;  4YHH B;  5IYC O;  4O4L A;  4BW9 A;  2IJK A;  5B1A C;  4JYY A;  1BE3 H;  3QF7 A;  4DR7 B;  3SR2 C;  4MTO A;  5JVD A;  3A0R A;  2YXL A;  2ITD C;  4GX2 A;  1NBM G;  3E86 A;  1MZE A;  2R9R B;  2P67 A;  3CCQ V;  4NVP A;  1FXK C;  1AI4 A;  2Q68 A;  4MW3 A;  4FLU A;  3BRC A;  4J42 A;  4L87 A;  2LW1 A;  4DV2 B;  2BOB C;  4DUZ B;  1YIJ V;  4WFA V;  2ZQM A;  4DV4 B;  3TET A;  2WLM A;  4CBC A;  1Y67 A;  2OCC B;  3ZHT A;  1EN4 A;  4R7C A;  1VQK V;  3FB6 C;  1VQM V;  2Y48 A;  4FMT A;  2BCC H;  2MW2 B;  2HG5 C;  2OTL V;  1NS1 A;  3CRA A;  4AIL C;  2EBO A;  1EN6 A;  5H9C A;  1RSO A;  3ZMU A;  2EIM C;  2ZE8 A;  3LNM B;  5GW7 A;  1MA1 A;  3B09 A;  3BCC H;  4QE9 A;  1H2N A;  2NR5 A;  1AP6 A;  1P4R A;  4BAY A;  4FLT A;  3SPH A;  4F6R B;  2KG7 B;  2L6L A;  4NYK A;  1WA8 A;  4DR3 O;  1YF2 A;  2UXD B;  1K4D C;  2OWO A;  1Y4M A;  4HZ3 A;  4MVQ A;  3ZMS A;  1J5E B;  4FLW A;  4FK5 C;  4LFC B;  2WSS G;  2DWD C;  2YI9 A;  4O2A B;  2KG7 A;  1N33 B;  1H2K A;  3U11 A;  5CA0 B;  4RQF A;  1P49 A;  4CH3 A;  1OCZ C;  2F66 C;  3O9O A;  1W0J G;  5DN6 G;  2ZXW B;  1YTF D;  2PZS A;  2QM7 A;  4FJC C;  4I9Q A;  4EEQ A;  2Q0O C;  4X89 A;  5CA0 A;  3A8T A;  2LFR A;  1ARO P;  2QWN B;  1VQ4 V;  1GMG A;  3H1H H;  1W0K G;  3E89 A;  1EBO A;  2CUG A;  1N34 B;  4FLZ A;  3ZRW A;  3CXH F;  1VQ8 V;  1LUV A;  4X64 B;  4YHH O;  4CH6 A;  3ZBH A;  1S0V A;  4DR7 O;  3UO3 A;  5GTI Z;  1GM9 A;  3RYF B;  5J2T B;  4PDV A;  1XNR B;  2ETN A;  5B5E Z;  3WG7 C;  1FFX B;  2QE7 G;  2YIC A;  2DOS A;  2XAH A;  3RYF A;  5J2T A;  1FPO A;  2FL4 A;  2XHB A;  1FFX A;  4DV2 O;  1M1K W;  4DV4 O;  1BCC H;  3CYO A;  2CDY A;  4LF5 B;  2JRI A;  5H6Q A;  3PJS K;  4MT8 A;  1KQS U;  2CAZ C;  1Q6U A;  1VF5 B;  3CE2 A;  4LH7 A;  2X7R B;  3OE7 G;  3IAY A;  5C8Y B;  1JOY A;  2HVK C;  4FLX A;  5CBH A;  4R6Z A;  2ZNI A;  3CSX A;  3DXR B;  1YTF B;  4WCE V;  1SA0 A;  1CPY A;  1V54 B;  4NB5 A;  5C8Y A;  4PHZ A;  1WP8 A;  3JD0 A;  3ZED A;  1N36 B;  2OT5 A;  3FX7 A;  3IFX A;  1J5E O;  4H13 B;  4LFC O;  3D3I A;  2Y0P A;  2OTJ V;  2KKW A;  4JYB A;  1N33 O;  5EZY A;  1H38 A;  2ZE7 A;  3SYQ A;  2RCV A;  5CMU A;  4P9P A;  4NKG B;  4Q6G A;  1WLE A;  3RW0 A;  3IJ4 A;  3L71 H;  4MS2 A;  1IBM B;  2UUA O;  5EC1 C;  2ZT9 B;  1R73 A;  5DM6 V;  5ITZ A;  4D7T A;  2PYJ A;  3HKD B;  4CS3 A;  3CMA V;  1OCC C;  1YCI A;  2ZIN A;  3VBB A;  5B3S B;  1BZK A;  1L1F A;  3BA9 A;  2IW5 A;  2WWW A;  1N34 O;  2QEX V;  2EIL C;  3G6E V;  3HKD A;  1Q3E A;  4ZKI A;  2IU0 A;  1BQ0 A;  4MVR A;  4X64 O;  5KMG B;  2HJD A;  4ZHQ B;  5LGT A;  2DYS C;  4NXN B;  2IJJ A;  3CCS V;  4IHJ A;  2ZR2 A;  1XNR O;  1U96 A;  2PGG A;  1NJI W;  2R9A A;  5KMG A;  1QHT A;  4IYH A;  1SES A;  4ZHQ A;  2Y69 C;  2Q7E A;  2Q7G A;  1XUQ A;  1J95 A;  1ZSP A;  1GN4 A;  1OCR C;  5EYP B;  3ETG A;  4GT1 A;  2KSD A;  2LP7 A;  2K1E A;  5JQG B;  4DV7 O;  2WA4 A;  5E79 Z;  1HNW O;  1XMQ O;  4TV8 B;  4LF5 O;  2WLI B;  3E83 A;  1PL4 A;  1EN5 A;  2UXC O;  3ABK B;  2UXX A;  1AJN A;  5BY1 A;  2F95 B;  2AGA A;  5JQG A;  5CA1 B;  4DXW A;  3CWB H;  4FM0 A;  4PDL A;  2WLI A;  3L75 H;  5IYD O;  4QPK A;  2XAQ A;  5J2U B;  4FFB A;  4MVS A;  3ZHQ A;  2JS5 A;  5CA3 A;  4N21 A;  4K35 A;  5CA1 A;  5JJN B;  3OMA B;  1JX9 A;  1NQT A;  2HEP A;  1FAF A;  1H8E G;  1K73 W;  3CJH A;  2YS8 A;  4DV0 B;  1XNQ B;  2LQT A;  3CCU V;  4PA3 A;  4DV5 O;  1B06 A;  1R6K A;  1JJ2 U;  3LNN A;  1SQQ H;  1IBM O;  3CCV V;  4PI2 A;  2HP8 A;  5IE9 A;  4UXN A;  3SGI A;  1AIL A;  2QM4 A;  4KL1 A;  1KYO F;  2PY5 A;  3B77 A;  3H1K H;  5CBG A;  3OW2 U;  1SQF A;  1IBL B;  2B1I A;  4DV3 B;  5L3C A;  2QDO A;  4JI7 B;  5IY5 C;  5C93 A;  1Q7Y W;  2AZ2 A;  1E79 G;  2EJ7 A;  2F43 G;  1KKD A;  1K9M W;  4DW0 A;  2ZXW C;  5LGU A;  3CCE V;  3GWO A;  1PNM A;  4WBN A;  4LWS B;  5LMU O;  3AG3 B;  1AI5 A;  4X65 B;  4UVA A;  2CH7 B;  1TGO A;  1YVW A;  1GK9 A;  1H2G A;  4DV6 B;  1WP7 A;  3ZRV A;  2EUL A;  3VQV A;  2CH7 A;  3C3S A;  1SQP H;  2UU9 O;  2XND G;  1UFI A;  2HKO A;  5F2V O;  5JCO C;  3ETQ A;  4K3A A;  3RVY A;  1SQV H;  2QJ1 A;  1Z5W A;  1SER A;  3K0G A;  3I55 V;  3CEI A;  3SJA C;  4ZI7 A;  4LP8 A;  3G4S V;  3ZHR A;  4B3M B;  1AI6 A;  3B2E E;  2EJR A;  4JI0 O;  4JTC B;  3ZRX A;  3CC7 V;  1YXB A;  4JI4 B;  4JTD B;  3RYH B;  1VQP V;  2UUB B;  2PF4 E;  4WFF A;  1YJW V;  1D5A A;  1UPG A;  1MSW D;  1FJG B;  1KP2 A;  3K5N A;  2WPD G;  4OPA A;  4DV0 O;  3RYH A;  1XNQ O;  2RN9 A;  4Z2W A;  5L3G A;  1JVM A;  3SJC C;  1AR1 B;  2D2C B;  4IL6 Z;  2DE0 X;  2OCH A;  2X6B A;  3F5W C;  2YIB D;  1NTZ H;  3K06 A;  5KHJ A;  1F4N A;  3OUF A;  2K9P A;  3H1J H;  4TT3 G;  2Y0I A;  1BT8 A;  5EBL C;  1Q90 D;  5CN0 A;  3N2K B;  3SPI A;  1G6U A;  1A32 A;  2PYL A;  4PA7 A;  3DSQ A;  4DV3 O;  4JI7 O;  4W4K A;  3RBZ A;  2GHY A;  3O65 A;  4PV1 B;  1AR5 A;  2XAS A;  3RT3 C;  4QGP A;  3ICX A;  5JJJ B;  3OTO O;  1JA8 A;  2FB5 A;  1KC8 W;  3Q4H B;  2CTW A;  2W0X A;  3K9A A;  5KX5 A;  2Q5Z A;  4QIW F;  1TUE B;  4X65 O;  5B3S C;  3Q4H A;  1BL8 A;  3OAA G;  3HKE B;  1F23 A;  4DV6 O;  4RQE A;  1DLB A;  4MVM A;  3HKB A;  2L35 A;  1R1B A;  4O4H B;  3RYC B;  5EBW C;  1VQO V;  2D3O W;  4MTG A;  5JJE B;  5KA5 A;  5IJ0 B;  3HKE A;  1DK1 A;  4XBF A;  2A79 B;  2RJZ A;  2XAJ A;  1GTO A;  2Q7H A;  2ZCE A;  4O4H A;  1Q6H A;  5D5Q A;  4YJ2 B;  3G71 V;  4X1K B;  4B3M O;  1AB3 A;  4NTX A;  4PDM A;  2E74 B;  4R50 A;  4JI4 O;  1WPX A;  4YJ2 A;  1HNZ B;  2UUB O;  1MMM A;  4I55 A;  2C2A A;  3KZI Z;  2IH3 C;  2P90 A;  2B5U A;  4HNA B;  3AK2 A;  3MHH C;  1FJG O;  2QWR B;  2YIB A;  1QLE C;  4Z1V A;  4BR6 A;  4HNA A;  1Q81 W;  1FFT B;  5KUK A;  2IBZ H;  3KKY A;  3S3W A;  4NXM O;  1URF A;  4RUF A;  1R6N A;  1O9H A;  3CRR A;  3PN1 A;  5IYZ B;  3AG1 B;  3RYI B;  2FML A;  1NI8 A;  2RNB A;  2JGU A;  4LFB O;  4GX0 A;  3CME V;  2IJI A;  4CS4 A;  3AG2 B;  4LF9 O;  5IYZ A;  3AG4 C;  3L72 H;  3CC4 V;  5H6R A;  2E75 B;  2G38 A;  3HKC A;  3JD3 A;  5DEC A;  2R70 A;  2QWQ B;  4GZR B;  2Q69 A;  2HHH B;  1U97 A;  2EIK B;  3AEI A;  1D2D A;  1YJN V;  4B3T B;  2YC0 A;  5HFM A;  3JAM N;  3FFQ A;  3FYI B;  3W7S A;  3IGA C;  2B9Z A;  4FPP A;  2ILM A;  3L73 H;  2ZIM A;  3OEE G;  5BMV B;  1M5I A;  3OMN B;  3VQW A;  4ASU G;  1VQ9 V;  2ADQ B;  4MTF A;  1ZUQ A;  1M56 C;  3FAV B;  4X62 B;  4QPJ A;  4UB8 Z;  5BMV A;  4QJF B;  2P22 C;  1RSO B;  4LR3 A;  1ZLZ A;  3FAV A;  5DED A;  2Z5U A;  1M57 B;  3T1Y B;  4UV9 A;  4J7Z A;  4UCS A;  5EK0 A;  1PNK A;  3CC2 V;  1VQ7 V;  1WA8 B;  2PUS A;  3P3N A;  2P06 A;  4DK0 A;  1H2M A;  1GKF A;  4U7O A;  1LUW A;  1N32 B;  5L3F A;  4X1Y B;  2DJV A;  2WA3 A;  3P30 A;  4I9W A;  3G80 A;  4DK1 A;  5B1N A;  3CB2 A;  3SYO A;  3EXA A;  4X1Y A;  5FNV A;  2WAM A;  3DGE A;  5EC2 C;  2V7Q G;  2ZDI A;  5LHI A;  2YI8 A;  1K8A W;  5EIB D;  2UXN A;  2ADP A;  3J81 N;  3P3P A;  1K5Q A;  3ZRW B;  1VQ6 V;  2EIN C;  1ROP A;  2QM8 A;  4N23 A;  1JFF B;  4EB6 B;  2AW9 A;  3W7T A;  3WB1 A;  4EFE A;  3W7X A;  1LR1 A;  4K0K B;  1TVK A;  2QKC A;  4TWK A;  4YY3 B;  1YI2 V;  1JFF A;  4EB6 A;  3ZMT A;  3OGI B;  2YID A;  3AK1 A;  5L3B A;  2HHH O;  3TXQ A;  3ASO C;  4B3T O;  2W0F C;  4MSW C;  4LF4 B;  1Y6X A;  2IM9 A;  2WLL B;  1DF5 A;  1YIT V;  3T1H B;  2NN4 A;  2DQ0 A;  1I5X A;  1GRJ A;  1TUB A;  3K9S A;  4HAM A;  1RFY A;  1N0J A;  1K92 A;  3EVK A;  4X62 O;  3D36 A;  4JI5 B; 
#chains in the Genus database with same CATH homology
 3JCZ A;  2WLL A;  4MVS A;  4UVC A;  1BHA A;  5CA3 A;  4N21 A;  1OCO C;  2WLN A;  2Y69 B;  3LDD A;  1B6Q A;  4JF3 A;  4R8C A;  1OCR B;  1JQ0 A;  1K7D A;  4X8A A;  3OMA B;  1JX9 A;  1NQT A;  2DYR C;  1H8E G;  1K73 W;  1S76 D;  3T4D A;  3ASO B;  1RM1 C;  4BIZ A;  1NH2 D;  3W7U A;  1LNQ A;  4P9O A;  1YSC A;  3K04 A;  4MVU A;  3WG7 B;  2EIJ B;  1SZT A;  2JIZ G;  4EKW A;  1G8M A;  3CCU V;  4PA3 A;  1EZJ A;  1R3K C;  3FB7 C;  4WFH A;  1IXM A;  3ZCC A;  3ABT A;  1K4C C;  4JAU A;  1R6K A;  1JJ2 U;  3B8N A;  3LDC A;  4JAV A;  3CCV V;  3AG3 C;  3FB5 C;  4LC1 A;  2Z3Y A;  3K3W A;  4UXN A;  3T1C A;  2V1D A;  4GX5 A;  2YEV B;  1FS0 G;  1OCO B;  4BW5 A;  3E8H A;  1DTO A;  3B77 A;  5HFL A;  3E8G A;  5CBG A;  3OW2 U;  2DYR B;  4X88 A;  3ABL C;  4GX1 A;  2A9H A;  1I5Y A;  2B1I A;  5L3E A;  1F51 A;  2YEV A;  5L3C A;  1M90 W;  5B1B C;  5IY5 C;  5C93 A;  1Q7Y W;  4PA4 A;  4WFE A;  1YHQ V;  3FYE B;  2R9I A;  1E79 G;  2F43 G;  4WFG A;  2JEX A;  1KKD A;  1ENV A;  2NNU A;  1BMF G;  1K9M W;  2ZXW C;  1UJW B;  1VQL V;  1FXV A;  2Q67 A;  1MAB G;  5LGU A;  5LBQ A;  3UKM A;  4BIU A;  3ZIA G;  4PDR A;  3CCE V;  1K5S A;  3GWO A;  1PNM A;  2P6J A;  3CP1 A;  3JD2 A;  3AG3 B;  1MOF A;  1AI5 A;  4UVA A;  3X2Q C;  1Y66 A;  1KD1 W;  3HB3 B;  1GK9 A;  1H2G A;  3ZRV A;  4J9Y B;  2A0L A;  3ABL B;  3TK1 A;  4Q20 A;  3ZRS A;  3FKS G;  2IU3 A;  3ZJZ A;  5LHG A;  4Z1M G;  5CBF A;  2XND G;  2XAG A;  2HKO A;  5B1B B;  3RVY A;  5IY5 B;  3CCL V;  2JEU A;  3ABM C;  1H8H G;  2MK3 A;  1SER A;  3K0G A;  4TSF G;  3I55 V;  1NH2 B;  4LP8 A;  2ATK C;  3G4S V;  3AG2 C;  1OZ0 A;  5EBM C;  3CCM V;  1NKD A;  1CEZ A;  1AI6 A;  2ZR3 A;  2WLJ A;  1P7B A;  2DW4 A;  2EJR A;  1AJP A;  1RPR A;  4JTC B;  3ZRX A;  3CC7 V;  2EIL B;  3OMI B;  3JD4 A;  3X2Q B;  1YJ9 V;  1Q86 W;  1V55 C;  1QLN A;  3ZN0 A;  1W2B U;  4JTD B;  1PL0 A;  1VQP V;  3QO8 A;  3OM3 B;  4YXW G;  1KEC A;  1XL6 A;  2P7T C;  2HJF C;  3MHS C;  4WFF A;  3F7V C;  1YJW V;  4U7N A;  1K33 A;  3STL C;  1MSW D;  4G28 B;  1KP2 A;  4KUM A;  3EFF K;  2WPD G;  4JPR A;  1K97 A;  4MVO A;  3BY6 A;  3ML0 A;  3TCU A;  4LBE C;  1R3J C;  1JVM A;  3ABM B;  5L3G A;  1AR1 B;  4WF9 V;  2M7W A;  1FXH A;  1Q82 W;  3KG2 A;  3RVZ A;  2DQ3 A;  2OCC C;  2X6B A;  3F5W C;  3K06 A;  2QTO A;  1F4N A;  3OUF A;  4TT3 G;  1E1Q G;  5EBL C;  3JD1 A;  5IYC O;  2IJK A;  5B1A C;  4DO2 A;  3R65 A;  3STZ C;  1DF4 A;  5CN0 A;  4MTO A;  2YSU B;  3CCR V;  3A0R A;  3SPI A;  3SPJ A;  2ITD C;  1HWY A;  1NBM G;  4GX2 A;  1PNL A;  2X6C A;  3E86 A;  4F4L A;  4PA7 A;  1QR9 A;  1VQ5 V;  2EZO A;  2R9R B;  2P67 A;  3OR7 C;  3RBZ A;  1MG1 A;  2GHY A;  3CXC U;  3CCQ V;  2XAS A;  1FXK C;  4KP4 A;  1AI4 A;  2Q68 A;  4MW3 A;  4WFB V;  1KC8 W;  4L87 A;  2BOB C;  2XOK G;  4H33 A;  3K9A A;  3ZN1 A;  4WFA V;  1YIJ V;  2ZQM A;  4ZBM A;  3TET A;  2WLM A;  2HR3 A;  4CBC A;  1K3E A;  2OCC B;  4QIW F;  3OEH G;  4R7C A;  1NVP D;  1VQK V;  3FB6 C;  1VQM V;  2Y48 A;  1TUE B;  4FMT A;  1RM1 B;  5B3S C;  3FB8 C;  1BL8 A;  1SET A;  1ORQ C;  2DWE C;  3ASN C;  3EHB B;  4RAI A;  4KFM A;  5B1A B;  1S72 V;  1GM7 A;  2HG5 C;  3OAA G;  2OTL V;  4J9Z B;  1RPO A;  1F23 A;  4RQE A;  1DLB A;  2EBO A;  4MVM A;  3QNE A;  5H9C A;  1VQN V;  3ZMU A;  1XL4 A;  2EIM C;  3LNM B;  5GW7 A;  5EBW C;  1VQO V;  2D3O W;  4MTG A;  4QE9 A;  3ETD A;  3CD6 V;  5KA5 A;  4XBF A;  2A79 B;  1S3J A;  3E8B A;  2XAJ A;  1GTO A;  1P4R A;  4BAY A;  1FXK B;  3SPH A;  3W7W A;  4P2Z A;  5B1O A;  3G71 V;  2HLD G;  3ZMV A;  4PA9 A;  3CCJ V;  4RO2 A;  1K4D C;  4PDM A;  1Y4M A;  4HZ3 A;  4MVQ A;  3ZMS A;  3K03 A;  1FXK A;  4FK5 C;  4MTX A;  3CPW U;  2WSS G;  4R50 A;  2DWD C;  3UM7 A;  2QA4 V;  2IH1 C;  3AG1 C;  1WPX A;  4RQF A;  2WLH A;  1OCZ C;  2C2A A;  4XDL A;  1EFR G;  1W0J G;  3SPG A;  2IH3 C;  2ZXW B;  4JYC A;  2P90 A;  5DN6 G;  2B5U A;  4E2L A;  5IDJ A;  1YTF D;  3MHH C;  4G27 B;  2QM7 A;  3OUS A;  4FJC C;  4X89 A;  2HFE C;  2LFR A;  4FIP C;  1ARO P;  1QBZ A;  1VQ4 V;  1GMG A;  2PI5 A;  1QLE C;  1W0K G;  2EIK C;  1Q81 W;  1FFT B;  3E89 A;  5KUK A;  1EBO A;  5KA6 A;  4G2K A;  4XDK A;  3ZRW A;  4RUF A;  1JCH A;  4PEL A;  2NLJ C;  1R6N A;  4P30 A;  1VQ8 V;  1PKX A;  1THZ A;  5LGN A;  2FTK A;  3ZMZ A;  3AG1 B;  1S0V A;  1F4M A;  1NVP B;  1M9N A;  2BOC C;  3JYC A;  4GX0 A;  3CME V;  1GM9 A;  1OCZ B;  2IJI A;  4PDV A;  3LDE A;  3WG7 C;  3OFN G;  3AG2 B;  3BEH A;  2QE7 G;  3CC4 V;  3AG4 C;  4I5S A;  1N8R W;  3HPL C;  5H6R A;  4OXS A;  2PI4 A;  1COW G;  1G4Y B;  3JD3 A;  2XAH A;  3P32 A;  4RUE A;  4UVB A;  4H37 A;  1QLE B;  1V54 C;  2Q69 A;  2CK3 G;  1V55 B;  2EIK B;  3AEI A;  3E2E A;  4UV8 A;  1YJN V;  1M57 C;  2IJH A;  5HFM A;  1M1K W;  3FYI B;  1AJQ A;  3W7S A;  3CYO A;  1QVF U;  2KB1 A;  3IGA C;  5LHH A;  3VOU A;  4FPP A;  2H8P C;  3OGC C;  3K0D A;  3IC7 A;  5H6Q A;  3OEE G;  3PJS K;  4MT8 A;  3K08 A;  4XDJ A;  1KQS U;  2XAF A;  1AI7 A;  3OMN B;  4ASU G;  2JK5 C;  1VQ9 V;  2H94 A;  2LFS A;  4MTF A;  2X7R B;  3I56 V;  1M56 C;  3OE7 G;  1PD3 A;  1JOY A;  2HVK C;  4QPJ A;  3AG4 B;  5CBH A;  4R6Z A;  1E1R G;  2ZDI C;  1R3L C;  5KUM A;  2AHY A;  4QJF B;  1YTF B;  4WCE V;  2B1G A;  2JDI G;  1CPY A;  1V54 B;  3MD0 A;  2Z5U A;  1M57 B;  3QO7 A;  3SJQ C;  3JD0 A;  4CZZ A;  3B8M A;  4UV9 A;  2OT5 A;  5J9P C;  2ZD9 A;  1CP9 A;  5FL7 G;  3IFX A;  5IYB O;  5EK0 A;  1PNK A;  3CC2 V;  1VQ7 V;  3D3I A;  4JTA B;  3SYC A;  5L3D A;  2OTJ V;  1S5H C;  3LSQ A;  4JYB A;  3ETE A;  1H38 A;  3SYP A;  3SYQ A;  4JGS A;  1R3I C;  3DTU B;  4P9P A;  5CMU A;  4MVZ A;  1GKF A;  4GCZ A;  1GM8 A;  1QR8 A;  4U7O A;  4UUJ C;  3T4Z A;  1WLE A;  1M56 B;  2GSM B;  3RW0 A;  4MS2 A;  3SPC A;  5L3F A;  1SRY A;  5EC1 C;  3P30 A;  1R73 A;  5DM6 V;  4QNH B;  2EZP A;  3E35 A;  3H01 A;  4I9W A;  5B1N A;  2X6A A;  3CMA V;  1OCC C;  3ABU A;  3VBB A;  5B3S B;  3SYO A;  1L1F A;  1QVG U;  1OHH G;  3LUT B;  2IW5 A;  3ASN B;  4MW8 A;  2WWW A;  5BZB A;  2WAM A;  3DGE A;  5EC2 C;  2EIL C;  2QEX V;  2V7Q G;  2ZDI A;  3G6E V;  2W6J G;  5LHI A;  4ZKI A;  2IU0 A;  1K8A W;  4MVR A;  2EIM B;  1BHB A;  3ABK C;  2UXN A;  1K5Q A;  3ZRW B;  2HVJ C;  5LGT A;  2EIN C;  1VQ6 V;  1ROP A;  2DYS C;  2QM8 A;  2WLK A;  2AHZ A;  4N23 A;  2IJJ A;  3SYA A;  2JJ2 G;  3CCS V;  3W7T A;  2ZR2 A;  2ITC C;  2JJ1 G;  1NR1 A;  3W7X A;  1NJI W;  3QO5 A;  4QE7 A;  3NXS A;  3T2M A;  1SES A;  4TWK A;  2Y69 C;  3WFV A;  1J95 A;  1YI2 V;  1NR7 A;  1OCR C;  1ZWI C;  3ZMT A;  3LSS A;  3ETG A;  4GT1 A;  5L3B A;  1OCC B;  3E8F A;  2LP7 A;  3GB7 C;  3ASO C;  1GO3 F;  2K1E A;  1QCE A;  2Q6A A;  1KP3 A;  2W6I G;  2X0L A;  2W0F C;  4PA6 A;  2QKS A;  3K79 A;  2WLI B;  3E83 A;  3F7Y C;  2EIJ C;  4MSW C;  3ABK B;  2UXX A;  1AJN A;  1K34 A;  2WLL B;  1DF5 A;  1YIT V;  3OR6 C;  2DQ0 A;  2EIN B;  1I5X A;  2DYS B;  4DXW A;  4LCU C;  1JPX A;  4HYO A;  4JAS A;  1S77 D;  4HAM A;  2WLI A;  4PDL A;  5E1A C;  5IYD O;  4QPK A;  1K92 A;  3M99 B;  2XAQ A;  3D36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...