3CCMV

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ccmV00
3CC7V 1Q86W 3I56V 3CCVV 1VQ8V 4WFAV 1NJIW 1YITV 1QVGU 3CC4V 3CCLV 1VQNV 1K73W 3CCEV 1YJ9V 1Q81W 1YJWV 3CPWU 1VQOV 1VQ4V 3CCMV 1QVFU 1VQ6V 2QEXV 3CCRV 1K9MW 5DM6V 3CCSV 1KQSU 1JJ2U 1YI2V 1Q7YW 2OTLV 2QA4V 4WF9V 1K8AW 3CMEV 1M1KW 2OTJV 4WCEV 4WFBV 3G4SV 1KC8W 1YJNV 3G71V 1S72V 3CD6V 1VQ9V 3CMAV 3CCQV 1Q82W 1N8RW 1M90W 3OW2U 3CCJV 3CXCU 1YHQV 1R73A 1VQPV 1W2BU 3CCUV 1KD1W 3I55V 1VQKV 3G6EV 1YIJV 1VQ5V 3CC2V 1VQMV 1VQ7V 2D3OW 1VQLV
chains in the Genus database with same CATH superfamily
2WA4A 4JASA 3IAYA 2ITDC 1QLEC 1L1FA 3GWKC 3AG3C 4EB6A 4FVMA 2Q7HA 3IGAC 4JTAB 4DR6B 4TOIA 3KCYA 1NI8A 3RYIA 5FNVA 1R73A 1H2GA 3JSLA 2A06H 4PHZA 1QLNA 3RYFB 1QVGU 1N4CA 3E35A 1K33A 1XNRO 3AG4C 4CS2A 1GAXA 1Q8IA 1F51A 2B9ZA 4G2KA 2K9PA 1S76D 4YXWG 1XREA 5IWAO 4DUZB 1GN3A 5IJ0A 1HNXO 4DR1O 5J2UB 3RBZA 4X62O 2EIJB 1EN4A 3H1KH 4P9PA 4FLUA 2OIGA 2WLHA 2L6LA 3A8TA 5H6RA 4O4HA 1D5NA 2PYJA 4LFBB 4U3FH 1KUQA 1XEQA 4LCUC 3UO2A 1BQZA 4IHJA 4DR5B 1KQSU 2OCHA 3QO5A 1NVPB 4PDRA 3K0DA 3B8MA 3ETEA 1FFXA 1YCIA 4GCZA 3C3TA 2OCCC 1SQVH 2H3OA 2UU9O 2F4VB 1PM9A 4RQEA 2Q7GA 3GWOA 1N34B 4JYAB 4YJ3B 1RM1B 5CA3A 4NB5A 4DV6B 2UXCB 4RUEA 1W0KG 1AILA 2AZ0A 2OTLV 3A0HZ 4ZOLA 1Q90D 4X1KA 3NXSA 3KZIZ 2KSDA 3ZBHA 4EFEA 4A5UB 3JATB 3SPJA 3E22B 2JGDB 3MDSA 4LBEC 3OUFA 3LNNA 4QNHB 3PN1A 4QGPA 2CK3G 4P9OA 1QVFU 4MVOA 3LDEA 1I5YA 5KHKA 5B1AB 1SZXA 1HNWB 3VQWA 3OR7C 4QIWF 2AW9A 1GO3F 4N23A 5CBFA 1QQCA 1GM9A 5TISZ 4RAIA 4HAMA 3D3IA 3FX7A 1KB9F 4G27B 4X65B 4LC1A 5LMNO 5IYDO 3JARA 4RUFA 1JX9A 1O9HA 1I94B 1AI5A 1QNMA 5B1BB 5CBGA 2RDCA 2WLNA 4B08A 2DE0X 3RWRD 2XT9A 4B7KA 5L3EA 1HP8A 5LOVA 5DEDA 2NR5A 5IJ9B 1UJWB 4DR4B 4ICGA 1FS0G 4CS4A 4BIUA 2ZKOA 3QG5A 4QE9A 2IJJA 3CE2A 2KG7A 3Q4HB 2A0LA 3SGIA 2YC0A 1XQ8A 3HR0A 5FPOA 1JVMA 2WLLB 4JI1O 5JCOC 3ABKC 2EJ7A 1ZLZA 1RSOB 2DQ3A 4DV7B 4UB6Z 2HJDA 3AK2A 5BMVA 2YUAA 2LFRA 2UXNA 3ASNC 5B3SB 5E1AC 4I0XA 3K08A 1XNQB 1PD3A 3O65A 2UUCO 2OWOA 3JSNA 4JI7B 2LGWA 1Y67A 4J7JA 4GX1A 3X2QC 1FXVA 2QM8A 4EEQA 2FKXA 2YI9A 3K0GA 1HR0B 5DECA 3CJHB 2EILC 4YIPA 2Q6AA 3CCRV 1JJ2U 4J42A 3M7MX 1MOFA 4X88A 1FJGB 1PNKA 2KQXA 4MVMA 5JH7B 2EZOA 3CEIA 4L87A 3LSQA 4UCTA 3ZRVA 3SPGA 1S0VA 2V4DA 3DTUB 4GZRB 3CC4V 2QKSA 2LW1A 4NTWA 2Q7EA 3P3NA 4DUYO 3QNEA 4HNAB 4LFAB 1H2SB 2A3QA 4KFMA 2W6JG 3TXSA 2G38A 4FM0A 1NQTA 2DOSA 3N27A 4TT3G 1TUEB 1R3LC 5JJEB 1NTKH 4X66O 4MW8A 5LBQA 2P4VA 1R6TA 1KYOF 3TGUH 1IBKB 4YY3O 4NR1A 5EK0A 4WFHA 4DW0A 3OE7G 2OIEA 3HKBA 3JAWB 4H13B 1Q6IA 1SS3A 4K0KO 5IWAB 2XHBA 2Y0IA 3WB1A 4KUMA 1OCOC 2P06A 4WFGA 5IE9A 4NTXA 3ZMZA 4XDJA 5LA6A 5L3FA 5HFMA 4FMTA 2NN4A 3STZC 1Q6UA 1GRJA 2X7RB 2ZQMA 1M9NA 5D5PA 3T1YO 2JEUA 3JYCA 1QCEA 3WU2Z 4H44B 1GM7A 2EINB 5JQGA 4UUJC 5JCOA 4B3MO 5CBHA 3ZRWA 3OM3B 3LUTB 2VQEO 3CCEV 2LGQA 3CRCA 4X1YA 4JI0B 2VQFO 5C8YA 1LUVA 3BFRA 1GM8A 3HKEA 1I5XA 5DN6G 1DK1A 2JEXA 5IYZB 2ADPA 2CH7A 4LF8B 3HB3B 4GT1A 5EBMC 2BOBC 4LH7A 1J5EO 2E3CA 4OPHA 1XUQA 4B3SB 1M1KW 3JD1A 2D2CB 4U7NA 1CP9A 4O2BA 3PJSK 5EYPB 4DV5B 1H2NA 1OCCB 5K1XA 4C7UA 4F6RB 5C93A 3R65A 2UXBB 1PNMA 4E2LA 1Q81W 4JAAA 4R6ZA 2DN9A 3R66A 2RN9A 1E1QG 4X20B 2A79B 2EULA 2ZE5A 1JFFA 2F1MA 4QPJA 5BY1A 1MZFA 4UB8Z 3E89A 3RYHA 3ZN0A 1SA0B 1JOYA 2IM9A 3X2QB 4WFAV 2P67A 3OUSA 3A0RA 5K1PA 3BA9A 2QWPB 1IDSA 3EFFK 2F93B 4B3RB 3D36C 2R9AA 2DW4A 4DR7O 2Y48A 2R9IA 1GH6A 4P2ZA 2EIJC 5KAFZ 4TV8B 5KMGB 1VQ9V 1FKAO 4O4JB 1MZEA 4OPAA 2L35A 1VQKV 2KKWA 3ZHVA 5GONA 2FL4A 2P90A 4GUNA 1KKDA 2CTQA 3VOUA 1EZVH 4O4LB 1OCRB 2LJ2A 3H1LH 5DM6V 2N05A 4DO2A 1L0LH 5LGTA 4FLYA 2ZCEA 3MAQA 5A9GA 1QBZA 1KD1W 2HG5C 3G6EV 4TV9B 2VWJA 1NH2D 3UO3A 4I55B 3U11A 4U3JA 4JI8B 4PELA 4LF7B 1RM1C 1AR5A 2LP7A 4DV3B 1KKCA 4FFBA 3KKYA 4GX5A 2HFEC 3J81N 1JCHA 2Q0AA 2OYQA 1ZX3A 4UCSA 1BZKA 1R6KA 2HEPA 3JD0A 1LNQA 2Q73A 4IIJA 3FFQA 1V9PA 4FFKA 5LXTB 4X64B 1H2MA 2ARHA 3G6BA 4BW9A 3N2GA 1Q5OA 2QE7G 4FLZA 3OGCC 2UXDO 5JJNB 1XOUA 3BY6A 5EBWC 3DSQA 5B1AC 3RYCA 3SYAA 1YXBA 4MTFA 1EBOA 1FXKB 3BA8A 3ZMVA 1IXBA 2RMKB 3U10A 2Z3YA 1YTFB 2GTSA 3SJAC 4TQDA 3SYPA 1VEWA 3ZN1A 4DR2O 4JYYA 5FL7G 4BIOA 5CB4A 5LHGA 2W0FC 5LYJB 4MTGA 2ZE6A 3UT5A 5EZYA 1F7YA 2P4KA 3ZMSA 4ZBMA 2QJ1A 1ENVA 5B1BC 2HKOA 2BE3A 3K5NA 3CHXA 1WP8A 1KC8W 3OTOO 2JS5A 3SR2C 4LF5O 1HNZO 1RP3B 3CRQA 4F6EA 1XMOO 4KHPO 1YI2V 4B3TB 4X1IB 3M99B 3CWBH 1XL4A 2BOCC 3ASOB 3O9OA 1NVPD 2DYSB 5KA5A 2JVDA 1R1BA 2WA3A 1B04A 2YEVB 1N33B 5KX5B 3A2FA 3T1HO 3T2MA 3RYFA 3UQ8A 3HPLC 4E4EA 2RNBA 2O57A 2ZIMA 1TA8A 1BGYH 5EIBC 4D7SA 4DV4O 2B1GA 3MHHC 3D36A 5B3SC 2UUAO 4UVAA 4JAUA 4CH5A 3W7WA 1IBMB 4I4TB 5J2UA 1ZSPA 2JDIG 1AI7A 4AQYO 1IBLO 2GBOA 4LF6O 2LQTA 5ITZB 2EJRA 2A9HA 1M93A 2VQEB 2ZXWB 4ASUG 2E74B 3CMAV 2W6IG 3DXRB 1K4DC 4DV1B 4JAVA 1G1XB 2HHHB 5IDJA 1SQFA 1R6NA 1WN7A 4DR3O 1OJHA 3BCCH 3ABTA 5J2TB 2YXLA 2E5LB 3ZMUA 3H1IH 1WLEA 2HVJC 2ILMA 5BXZA 2DWEC 2M7WA 4ZI7B 2HJFC 3L71H 2CGNA 3CRMA 4JI2B 1THZA 1Z2GA 2XAJA 4YJ3A 2YXHA 4TUYB 3L73H 1XHZA 4IYIA 3UKMA 4YHHB 4QPKA 5A2QN 5JVDB 3QVNA 4YIOA 2XOKG 5EBLC 3ZHSA 5GTIZ 1H8HG 4LF4B 3JATA 3E22A 2N74A 4PDMA 2JGDA 1JMKC 1Y66A 3ZEDA 4Z1VA 1SESA 1FAFA 4LR3A 3K59A 4LP8A 3CP1A 3OTFA 2EIMB 1EN6A 2EBOA 4KXRA 3CS5A 2GUZB 4JI6O 4I9WA 4EB6B 2RQ6A 3WB2A 1BCCH 3FYIB 1W59A 5FNVB 2ZINA 1WP7A 3FB8C 4JI4B 1SRYA 2R70A 1X4TA 3K3WA 1R3JC 4FLTA 3D3QA 4JV5B 3CRAA 3CXHF 4W4LA 2VRZA 2YXYA 2YDEA 4LF9B 5IJ9A 4TSFG 2E76B 3OEHG 3S3XA 4FK5C 1GMGA 2WWWA 3TETA 3Q4HA 3SYCA 2GV9A 3ETDA 2FYUH 1GKFA 2EINC 2JJ1G 1S77D 3JASB 5KUKA 4NYKA 1NTMH 3F7YC 4FIPC 2F95B 2EIKB 2P6JA 4FLVA 1IURA 1G4YB 1RSOA 1NJIW 1NS1A 1B6QA 4ZHQB 2HVKC 1Q43A 1K9MW 3RVZA 3BPZA 2ZM6B 1Y76B 2PZSA 1N32B 4LFCO 3RN4A 2YS8A 1N36O 1EM1A 4CZZA 1VQMV 4X8AA 1YITV 4D7TA 4WFFA 3JAMN 1VQ4V 4CS3A 3B4SA 4BW5A 2DYRB 1KMIZ 3STLC 3FAVB 1VARA 3CJHA 2IU0A 5CA0A 1KP3A 4NXNO 4WBNB 4PA7A 4PA3A 4I7ZB 1OCCC 1US6A 3TK1A 3SYQA 4J80A 5JH7A 2BTQB 3FB7C 4DK0A 3RW0A 4YJ2B 3QO8A 3T1CA 3H01A 5B1OA 1SQXH 4WFBV 1M4UA 2UUBO 5BR8B 4GKKO 1TAEA 4HNAA 5CA1B 2RCVA 1V54B 2V7QG 3BVOA 3CSXA 2YSUB 4H37A 2HLDG 1S3JA 5LMUO 2LO1A 4WF9V 4I5SA 4LNUB 3JALB 3AG1B 4NTYA 1W2BU 5KLVH 1TUBB 4DRXB 1VQPV 4K8ZA 1OCRC 2ODMA 3JAWA 1OCZB 1XDCA 3VBBA 1AVMA 2IJHA 4NXMO 4FLWA 3EXAA 3LDCA 1WNSA 4O2AB 2PGGA 2BTOA 4DK1A 1FPOA 2D3OW 4OX9O 4ZIBA 1AP5A 1BE3H 2H8PC 1SQGA 3EVKA 1FXHA 2PF4E 5CMUA 3OD4A 1F4MA 3AEIA 4LH6A 2VS0A 4HZ3A 1IXMA 1M57B 3CB2A 2ZDIC 1XI1A 4JI3O 3ZHTA 4OGQB 1XNRB 1H38A 1YHQV 2QDOA 3JD2A 3CCUV 2FB5A 3ZHQA 3ABLB 2EZPA 1NU1H 2XAQA 3SJCC 2GTAA 1BT8A 1KP2A 4JI5O 1HNXB 4DR1B 1H2KA 4GX0A 4MVSA 4X62B 1I7FA 5IYZA 1V55B 1BL8A 1FXKC 1ZL8B 4CH6A 2EX3A 2OT5A 3C3SA 3TCUA 3DC5A 2WPDG 3I5DA 4MS2A 2QWOB 1WJZA 1MSDA 1SQQH 1X59A 5EYPA 2BSKB 2UU9B 4DV2O 4F6RA 1BHBA 2QR4A 1WAZA 1TVKB 3JD3A 4AILC 1ZUQA 4K35A 2R72A 3J80N 4NVPA 2PUSA 1Q3EA 3LSSA 3ASOC 4X20A 2DYSC 4DR6O 4MTXA 2C2AA 4O4IB 3JAKB 3E2EA 4HYOA 2UXXA 1SA0A 4DW1A 4KL1A 4K3AA 3ZRSA 5B1NA 3SPHA 1DGSA 1OZ0A 1EZJA 4JYCA 5KHJA 4PDVA 3HKDA 4ZKIA 4FM2A 3IJ4A 4DUZO 5L3BA 4TV8A 5LP6B 4O4JA 3D8CA 5LHIA 4JF3A 2N04A 2QTOA 1NZ6A 1JR9A 4HBNA 4UCOA 1AR4A 5IYBO 4J9YB 1N0NA 1FFTB 3JD4A 2ZXWC 1QU7A 3ZX6A 4LFBO 1FYJA 1Z5VA 4X9QA 1GN6A 2ZIOA 1GN4A 5LMNB 3RFRA 1LUWA 4DR5O 4GYCB 2YI8A 1Q86W 4LFCB 2BCCH 1TGOA 2XAGA 4LWSB 1N36B 3OAAG 4TV9A 4I55A 2F4VO 4WFEA 1N34O 1YTFD 4JYAO 4CH3A 3CMEV 2Q69A 3B8NA 3VQYA 1B06A 3OGIB 1KBHA 4FLXA 1GN2A 4DV6O 2UXCO 2ZDIA 3ICXA 2HP8A 1P7BA 2DJVA 4GLXA 2CAZC 4JI1B 1P84F 1DF5A 2ZE8A 5F2VO 5LXTA 1FD9A 3QO7A 3T4DA 1K3EA 2PTMA 2IH3C 3CPWU 2F66C 1XMQO 1Q7YW 1DTOA 1K8AW 3B77A 2QWQB 3AG2B 2EIMC 3W7XA 1IZ3A 1YVWA 2IJKA 1FXKA 1UPGA 3B09A 2UUCB 2LW7A 1HNWO 5LHHA 4I50B 3ZJZA 2B1IA 1PPJH 4BWAA 3JCUZ 1P4RA 5LYJA 1BQ0A 4X65O 3FB6C 2XTAA 1N0JA 2Y69B 2QWNB 3SYOA 1I94O 4IL6Z 2M6YA 1JA8A 1MABG 4X1IA 1SZTA 4DR4O 2WLKA 4MW3A 1B3QA 2OTJV 2XASA 3G4SV 5L3CA 2YEVA 4UFZA 5KHGA 1WB8A 5KX5A 3CCQV 2EIKC 1D5AA 4UCRA 4ABMA 4DUYB 3H1HH 4DV7O 4MTOA 4J7KA 2PY5A 1MA1A 1AI6A 4I4TA 4X66B 1OV9A 3B2EE 1PL0A 2QKCA 4UCVA 2CE4A 5ITZA 3ZMTA 1K5QA 2ADQB 1URFA 4DV0O 1YIJV 1XNQO 1P49A 2AHYA 2A7WA 3P30A 4YY3B 3DXRA 4JI7O 1VF5B 1NBMG 1WA8B 2DYRC 1K97A 5J2TA 4MVZA 3AG7A 4K0KB 4ZI7A 2JIZG 4BIZA 1HR0O 1JQ0A 1Q82W 2PYLA 1N8RW 1M90W 5IYCO 1Y74B 4PI2A 4TUYA 4RQFA 1OHHG 3P3PA 1SQPH 4J41A 1VQLV 2F43G 4PJ0Z 3GB7C 3T1YB 1CEZA 2ZD9A 1JPXA 5IT9N 2AGAA 1S5HC 1NH2B 5H5NA 1FJGO 1NTZH 1T5EA 4RO2A 4D6TH 2WSSG 4B3MB 2ZNJA 4PA6A 3FKSG 2WLIB 1R3IC 1KU9A 3K04A 3N2KB 4MVRA 1KECA 1V54C 2FMLA 1Y6XA 5EZYB 2CUGA 2XUMA 2VQFB 4LFAO 2YIDA 1UFIA 3OR6C 3KCXA 2P5OA 4JZ2A 1MNGA 3E8FA 3HKCB 3VQVA 5HFLA 4J7ZA 1SC5B 2GUZA 3JCZA 2QEXV 1SQBH 1BS3A 1VP7A 3BAAA 4Q6GA 3AG1C 3OMNB 1XL6A 2DQ0A 3FYEB 1ORQC 2ITCC 1IBKO 1J5EB 3K57A 2ATKC 2NNUA 5JJJB 3SJQC 5FLXN 1OCZC 5CN0A 4MVQA 1YJ9V 4Q20A 4XDKA 4UV8A 4CBCA 3T4ZA 1WPXA 2IU3A 2F23A 4BAYA 3CCJV 2GHYA 1COWG 3K9AA 1K5SA 3JASA 4JYBA 4FPPA 5LGNA 1M57C 1K92A 5D5QA 3RGBA 3SPCA 3RYIB 1H2LA 2R9RB 2WAMA 1VIBA 2DMXA 2Q8VA 1P7GA 1G6UA 3FD9A 1VMGA 1IX9A 5EIBD 4ZHQA 4H0LB 4MSWC 1Y76A 2YIAA 3ABLC 2Q67A 3H1JH 4FZ0A 4JI0O 1RPRA 2P22C 4DR7B 4EKWA 3CCLV 1K73W 1R3KC 5IJ0B 1V55C 3ZS8C 2JRIA 1I0HA 4PV1B 2Z5UA 4LF8O 2X6BA 3WG7B 4O4HB 2IH1C 3K5OA 3L74H 4XDLA 2WLLA 1XMQB 4EFBA 3FAVA 2QTSA 5KHHA 1SKVA 1VQNV 3K58A 4B3SO 4IHJB 4WBNA 1HWYA 5B5EZ 1FFXB 1M5IA 1HDJA 1BHAA 3LNMB 1XILA 4DV5O 5L3DA 4H33A 1YZBA 2BTQA 2UXBO 4UVCA 1F23A 4YJ2A 3ABMB 3WFVA 3CXCU 1PV0A 2X6AA 4GX2A 5BZBA 4KP4A 2E75B 2HR3A 1AROP 2WLMA 1M56B 1ZWIC 4JTDB 1U97A 4ZOLB 4X1KB 3OMAB 4JZGA 5CA1A 3CCMV 4PA4A 2V1DA 3ETQA 4P30A 3F5WC 4PD4F 3ZHRA 2UXDB 2AZ2A 2YIBD 4B3RO 3IC7A 5KAIZ 3I55V 2ZT9B 5KA6A 4LNUA 4BR6A 3JALA 5LP6C 3W7TA 2JK5C 1TUBA 4DRXA 3ZHUA 3BHPA 2JS3A 3L72H 2MW2B 1Q6HA 5IY5B 3AK1A 3E86A 4WCEV 4DR2B 3B40A 2MK3A 3ETGA 3LSUA 1E1RG 5L3GA 4AI8A 3JARB 1AR1B 2DWDC 1DLBA 3MD0A 3I56V 1VQ8V 2CTWA 3K5MA 3CRRA 4O2AA 3K03A 3OTOB 3OEEG 4IYHA 1PP9H 3KG2A 5B66Z 4LF5B 1QLEB 3CX5F 1HNZB 1SF9A 4DV0B 1G8MA 3S3WA 5J9PC 1XMOB 4JI8O 4R8CA 4KHPB 1IVSA 4LF7O 4GKJO 3AG3B 5LOVB 2YIBA 1Z5WA 4DV3O 5JWPA 2KG7B 3T1HB 3H9VA 2JJ2G 2JGUA 3A0BZ 2Y4TA 3E83A 2CGOA 4X64O 5CA0B 5H6QA 3AG4B 2CTRA 4DV4B 5BMVB 2UUAB 1NR7A 1I08A 3AG2C 1ZAUA 1JJOA 5GW7A 4AQYB 1QR8A 1HW7A 5KUMA 1ROPA 1IBLB 1L0NH 4LF6B 2H94A 1VQ5V 1VQ7V 3LDDA 4I0XB 1ZL8A 2KB1A 3OT7A 4UV9A 2Y0PA 3W7UA 1YDXA 4K8XA 3L9DA 4DR3B 3F5TA 4R50A 2P7TC 1LR1A 2BSKA 4U7OA 3DC6A 3BABA 2OCCB 2Y69C 3FB5C 4MVUA 3K06A 3NR7A 4B7EA 1TVKA 4RWUA 1YSCA 3GVMA 2XAFA 3F7VC 5KHIA 1VQOV 1D2DA 4DXWA 1ZTEA 3OMIB 4FM1A 2AHZA 5EC1C 4B3TO 4O4IA 1XHXA 2PI4A 3JAKA 4MT8A 2Q5ZA 2VWKA 3ZCCA 5H2FZ 1N33O 2QM4A 1U96A 1K7DA 4XBFA 3APQA 4J9ZB 1GK9A 3IC9A 5LP6A 1VF6C 1IBMO 4JI6B 2XNDG 3TJTA 2B5UA 3K79A 2Q9LA 4Z1MG 4J11A 3W7SA 2ZNIA 2AXTZ 3ZRXA 3P32A 1Y4MA 3VQXA 4W4KA 4DV1O 2HHHO 4IT5A 3HKBB 4J10A 2E5LO 4LWSA 3G67A 2Q4PA 2ZE7A 2Z0AA 3J7AU 5FPRA 2WLJA 1DF4A 4JI2O 5LA6B 3CC2V 1MSWD 2IW5A 4JPRA 1NR1A 5KMGA 2ZR3A 4YHHO 1WB7A 2NLJC 4JTCB 5LGUA 1AP6A 2PI5A 2QSAA 3AK3A 4LF4O 5JQGB 3TXQA 1W0JG 1XBLA 4O4LA 3ZRWB 3ABKB 4UXNA 3CD6V 2K1EA 5AG2A 4PA9A 4FZ1A 1AB3A 1WPBA 4X1YB 3BRCA 3ASNB 5C8YB 4FJCC 3HKEB 1BSMA 3RVYA 4F4LA 5LL6Y 3U0ZA 2QA4V 1VF7A 4I50A 2GDSA 5EC2C 2CH7B 3SPIA 1SETA 4X89A 2X0LA 5H9CA 1YF2A 4JI4O 1K4CC 2YICA 4NXNB 1CXZB 4R7CA 2GSMB 3UM7A 4JV5O 1SERA 5GTHZ 2EILB 3HKDB 3QF7A 4O2BB 4CC6A 3G71V 4LF9O 2W0XA 3C90A 3G80A 1K34A 2FTKA 1AJPA 2UUBB 1EFRG 1J95A 1GTOA 4GKKB 3K5LA 1YJWV 1BMFG 3CYOA 1F4NA 1JFFB 4PI0A 3APOA 3E8HA 3RYHB 4L8JA 1O9GA 1A32A 3RT3C 2Q68A 1VF6A 4OXSA 2ZM6O 5LMUB 4GKJB 4UCUA 2RJZA 1N32O 2Y4UA 1AI4A 1PKXA 1PNLA 2LFSA 3IFXA 4G28B 1VQ6V 4AHCA 2ZR2A 4Z2WA 3WG7C 4N21A 1WA8A 2XAHA 5GONB 1S72V 3E8BA 1PL4A 4JGSA 3ABUA 4NXMB 2QGNA 4CC5A 1OCOB 1Y74A 1RPOA 1CPYA 3EHBB 1AJQA 5E79Z 1MMMA 2CDYA 3OFNG 4OX9B 2IBZH 4U3JB 3ABMC 4QE7A 4UVBA 4FFBB 2QM7A 3MHSC 1M56C 1L8DA 3CCVV 1E79G 2WLIA 3SJBC 4PDLA 4TQFA 4JI3B 5BR8O 3N2KA 4IIJB 1QR9A 3CCSV 2QKAA 3THOA 3N2GB 1AJNA 3BEHA 3ZIAG 3HKCA 4JI5B 1S5JA 1H8EG 2Q0OC 1S5LZ 3SDLA 3OW2U 2X6CA 4CH4A 1QHTA 3L70H 1YEWA 3WB0A 3L75H 4IGGA 3CC7V 3RYCB 2IJIA 2ETNA 4DYLA 1RFYA 1NT2B 4NKGB 1MG1A 5JVDA 3UCSC 3M8AA 4QJFB 2QWRB 3QTCA 5IY5C 1EN5A 4I9QA 4TWKA 3E8GA 1YJNV 3ML0A 5CB4B 2CTPA 1NKDA 3DGEA 3UT5B 4DV2B 3K9SA
chains in the Genus database with same CATH topology
1AROP 2WLMA 4JASA 2P90A 1M56B 1KKDA 1KP2A 2ITDC 1ZWIC 4JTDB 3VOUA 1QLEC 4GX0A 1L1FA 1OCRB 3OMAB 4MVSA 3CCMV 4PA4A 2V1DA 5DM6V 1V55B 3AG3C 4P30A 4DO2A 1BL8A 3F5WC 1FXKC 3IGAC 5LGTA 4JTAB 1QBZA 2OT5A 1R73A 3TCUA 2WPDG 1KD1W 3IC7A 2HG5C 3I55V 3G6EV 5KA6A 1H2GA 4MS2A 1NH2D 4PELA 1RM1C 1QLNA 1QVGU 3E35A 3W7TA 2LP7A 1K33A 2JK5C 3AG4C 4GX5A 2HFEC 1JCHA 1F51A 4G2KA 1S76D 4YXWG 5IY5B 1BHBA 3E86A 4WCEV 1R6KA 3JD0A 2MK3A 1LNQA 3JD3A 3RBZA 3ETGA 2EIJB 4P9PA 1E1RG 5L3GA 2QE7G 2WLHA 1AR1B 3LSSA 3ASOC 2DWDC 1DLBA 3MD0A 5H6RA 2DYSC 3I56V 1VQ8V 3OGCC 4MTXA 3K03A 2C2AA 3OEEG 4LCUC 3KG2A 3BY6A 1QLEB 3E2EA 4HYOA 2UXXA 5EBWC 5B1AC 1G8MA 3SYAA 5J9PC 1KQSU 3QO5A 4MTFA 4R8CA 3ZRSA 5B1NA 1NVPB 3AG3B 4PDRA 3SPHA 3K0DA 3B8MA 1OZ0A 3ETEA 1EBOA 4GCZA 1EZJA 1FXKB 2OCCC 4JYCA 3ZMVA 4PDVA 2Z3YA 1YTFB 4ZKIA 4RQEA 3GWOA 3SYPA 3ZN1A 5FL7G 5L3BA 1RM1B 2JJ2G 5LHIA 5LHGA 3E83A 4JF3A 2W0FC 4MTGA 5CA3A 2QTOA 5H6QA 3AG4B 4RUEA 1W0KG 3ZMSA 4ZBMA 5IYBO 4J9YB 2OTLV 1ENVA 1FFTB 5B1BC 3JD4A 1NR7A 2HKOA 3AG2C 2ZXWC 1KC8W 3NXSA 5GW7A 1QR8A 3SPJA 5KUMA 1ROPA 2H94A 1VQ5V 4LBEC 1VQ7V 3LDDA 1YI2V 3OUFA 3M99B 2KB1A 1Q86W 1XL4A 2BOCC 4QNHB 3ASOB 4UV9A 1NVPD 2XAGA 2DYSB 3W7UA 2CK3G 5KA5A 3OAAG 4P9OA 1QVFU 2YEVB 4MVOA 3LDEA 1I5YA 4WFEA 1YTFD 5B1AB 3T2MA 3CMEV 2Q69A 3B8NA 3HPLC 4R50A 2P7TC 4U7OA 2OCCB 2Y69C 3OR7C 4QIWF 1GO3F 2ZDIA 3FB5C 4N23A 4MVUA 5CBFA 2B1GA 3K06A 1GM9A 3D36A 1P7BA 3MHHC 4HAMA 4RAIA 5B3SC 4UVAA 3D3IA 1DF5A 4JAUA 3W7WA 4G27B 1YSCA 2JDIG 3QO7A 1AI7A 3T4DA 1K3EA 2XAFA 3F7VC 4LC1A 5IYDO 2IH3C 1JX9A 4RUFA 3CPWU 4DXWA 1VQOV 3OMIB 2AHZA 5EC1C 1Q7YW 2EJRA 1DTOA 2A9HA 1K8AW 1AI5A 2PI4A 4MT8A 3B77A 5B1BB 5CBGA 3AG2B 2ZXWB 2EIMC 4ASUG 2WLNA 3ZCCA 3W7XA 3CMAV 2W6IG 1K4DC 4JAVA 5L3EA 5IDJA 1R6NA 1UJWB 1FS0G 2IJKA 1FXKA 3ABTA 4BIUA 3ZMUA 1K7DA 1WLEA 2HVJC 4QE9A 2IJJA 4XBFA 2DWEC 2M7WA 5LHHA 2HJFC 3ZJZA 2A0LA 4J9ZB 2B1IA 1GK9A 1JVMA 2WLLB 1THZA 2XAJA 1P4RA 2XNDG 3ABKC 3UKMA 2DQ3A 2B5UA 4QPKA 3FB6C 3K79A 2Y69B 2LFRA 2XOKG 5EBLC 4Z1MG 3SYOA 3W7SA 2UXNA 1H8HG 3ASNC 3ZRXA 5B3SB 5E1AC 3P32A 1Y4MA 4PDMA 1MABG 3K08A 1SZTA 1Y66A 2WLKA 4MW3A 1SESA 2OTJV 1PD3A 4LP8A 2XASA 3G4SV 5L3CA 2YEVA 3CP1A 3CCQV 2EIMB 2WLJA 2EIKC 1DF4A 2EBOA 3CC2V 4GX1A 3X2QC 1FXVA 1MSWD 2QM8A 2IW5A 4JPRA 1NR1A 4I9WA 2ZR3A 3K0GA 2NLJC 3FYIB 4JTCB 4MTOA 5LGUA 2EILC 2PI5A 2Q6AA 1AI6A 3CCRV 1JJ2U 3FB8C 1MOFA 1W0JG 1SRYA 1PL0A 3ZRWB 3ABKB 4UXNA 3K3WA 3CD6V 1R3JC 4X88A 2K1EA 1PNKA 3ZMTA 1K5QA 4PA9A 4MVMA 1YIJV 2EZOA 2AHYA 4L87A 3P30A 3LSQA 3ZRVA 3SPGA 3ASNB 1S0VA 3DTUB 3CC4V 4FJCC 2QKSA 1NBMG 4TSFG 3OEHG 2DYRC 4FK5C 1K97A 4MVZA 3RVYA 4F4LA 1GMGA 2WWWA 3QNEA 2QA4V 3TETA 2JIZG 4BIZA 3SYCA 3ETDA 2W6JG 4KFMA 1GKFA 1JQ0A 1NQTA 2EINC 2JJ1G 5EC2C 1Q82W 1M90W 1S77D 5KUKA 3F7YC 4TT3G 3SPIA 1TUEB 1SETA 1R3LC 4FIPC 5IYCO 4X89A 1OHHG 4RQFA 2EIKB 2P6JA 2X0LA 5H9CA 1G4YB 1VQLV 2F43G 3GB7C 1CEZA 4MW8A 1K4CC 1NJIW 2ZD9A 4R7CA 1JPXA 2GSMB 1B6QA 1S5HC 1NH2B 3UM7A 2HVKC 4RO2A 5LBQA 1SERA 1K9MW 3RVZA 2EILB 2WSSG 4PA6A 3FKSG 5EK0A 3G71V 4WFHA 3OE7G 2WLIB 1R3IC 3K04A 1KECA 1V54C 4MVRA 4CZZA 1VQMV 1K34A 4KUMA 1OCOC 2FTKA 3OR6C 1AJPA 4WFGA 4X8AA 1YITV 4WFFA 1EFRG 1J95A 4XDJA 3ZMZA 5L3FA 1GTOA 5HFMA 3E8FA 1VQ4V 1YJWV 1BMFG 4FMTA 5HFLA 3CYOA 3STZC 3JCZA 4BW5A 2QEXV 2X7RB 2ZQMA 2DYRB 1F4NA 1M9NA 3STLC 2JEUA 3AG1C 3OMNB 1XL6A 3E8HA 2IU0A 2DQ0A 1KP3A 3FYEB 1QCEA 3JYCA 4PA7A 1GM7A 4PA3A 2EINB 1ORQC 2ITCC 2Q68A 4UUJC 2ATKC 2NNUA 4OXSA 1OCCC 5CBHA 3SJQC 3ZRWA 3OM3B 3TK1A 3LUTB 1OCZC 1AI4A 1PKXA 3SYQA 1PNLA 2LFSA 5CN0A 3CCEV 4MVQA 3IFXA 1YJ9V 3FB7C 4Q20A 4G28B 3RW0A 4XDKA 1VQ6V 3QO8A 3T1CA 3H01A 4UV8A 2ZR2A 5B1OA 4CBCA 4WFBV 3T4ZA 1WPXA 3WG7C 1GM8A 2IU3A 4N21A 1I5XA 2XAHA 1S72V 4BAYA 5DN6G 3E8BA 3CCJV 2GHYA 1COWG 3K9AA 4JGSA 2JEXA 1K5SA 1V54B 2V7QG 3ABUA 2YSUB 4JYBA 4H37A 3HB3B 1OCOB 2HLDG 4FPPA 4GT1A 5LGNA 1M57C 1K92A 1RPOA 1S3JA 5EBMC 2BOBC 1CPYA 3EHBB 1AJQA 3SPCA 2R9RB 3OFNG 2WAMA 4WF9V 1M1KW 3JD1A 4I5SA 3ABMC 4QE7A 3AG1B 4MSWC 4U7NA 3ABLC 1CP9A 1W2BU 2Q67A 3PJSK 4UVBA 1RPRA 2QM7A 1VQPV 3MHSC 1M56C 1OCCB 4EKWA 3CCVV 1E79G 5C93A 2WLIA 1OCRC 3R65A 4PDLA 3CCLV 1OCZB 1R3KC 1K73W 1PNMA 4E2LA 1Q81W 1V55C 4R6ZA 1QR9A 3CCSV 3VBBA 2IJHA 2Z5UA 1AJNA 3BEHA 3ZIAG 1E1QG 2X6BA 3WG7B 1H8EG 2IH1C 2A79B 3LDCA 3OW2U 4XDLA 2X6CA 2WLLA 4QPJA 1VQNV 3E89A 2D3OW 3ZN0A 3CC7V 1JOYA 2H8PC 2IJIA 3X2QB 4WFAV 1FXHA 2P67A 1HWYA 3OUSA 5CMUA 1MG1A 3A0RA 1F4MA 3AEIA 4HZ3A 1IXMA 4QJFB 1M57B 3LNMB 1BHAA 3EFFK 5IY5C 2ZDIC 5L3DA 4H33A 2DW4A 2Y48A 2R9IA 4TWKA 3E8GA 1YJNV 4P2ZA 3ML0A 4UVCA 1F23A 2EIJC 1VQ9V 3ABMB 3WFVA 1H38A 3CXCU 1YHQV 3JD2A 1NKDA 2X6AA 4GX2A 3DGEA 5BZBA 3CCUV 3ABLB 2EZPA 2XAQA 4KP4A 1VQKV 1N8RW 2HR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC7 V;  1Q86 W;  3I56 V;  3CCV V;  1VQ8 V;  4WFA V;  1NJI W;  1YIT V;  1QVG U;  3CC4 V;  3CCL V;  1VQN V;  1K73 W;  3CCE V;  1YJ9 V;  1Q81 W;  1YJW V;  3CPW U;  1VQO V;  1VQ4 V;  3CCM V;  1QVF U;  1VQ6 V;  2QEX V;  3CCR V;  1K9M W;  5DM6 V;  3CCS V;  1KQS U;  1JJ2 U;  1YI2 V;  1Q7Y W;  2OTL V;  2QA4 V;  4WF9 V;  1K8A W;  3CME V;  1M1K W;  2OTJ V;  4WCE V;  4WFB V;  3G4S V;  1KC8 W;  1YJN V;  3G71 V;  1S72 V;  3CD6 V;  1VQ9 V;  3CMA V;  3CCQ V;  1Q82 W;  1N8R W;  1M90 W;  3OW2 U;  3CCJ V;  3CXC U;  1YHQ V;  1R73 A;  1VQP V;  1W2B U;  3CCU V;  1KD1 W;  3I55 V;  1VQK V;  3G6E V;  1YIJ V;  1VQ5 V;  3CC2 V;  1VQM V;  1VQ7 V;  2D3O W;  1VQL V; 
#chains in the Genus database with same CATH topology
 2WA4 A;  4JAS A;  3IAY A;  2ITD C;  1QLE C;  1L1F A;  3GWK C;  3AG3 C;  4EB6 A;  4FVM A;  2Q7H A;  3IGA C;  4JTA B;  4DR6 B;  4TOI A;  3KCY A;  1NI8 A;  3RYI A;  5FNV A;  1R73 A;  1H2G A;  3JSL A;  2A06 H;  4PHZ A;  1QLN A;  3RYF B;  1QVG U;  1N4C A;  3E35 A;  1K33 A;  1XNR O;  3AG4 C;  4CS2 A;  1GAX A;  1Q8I A;  1F51 A;  2B9Z A;  4G2K A;  2K9P A;  1S76 D;  4YXW G;  1XRE A;  5IWA O;  4DUZ B;  1GN3 A;  5IJ0 A;  1HNX O;  4DR1 O;  5J2U B;  3RBZ A;  4X62 O;  2EIJ B;  1EN4 A;  3H1K H;  4P9P A;  4FLU A;  2OIG A;  2WLH A;  2L6L A;  3A8T A;  5H6R A;  4O4H A;  1D5N A;  2PYJ A;  4LFB B;  4U3F H;  1KUQ A;  1XEQ A;  4LCU C;  3UO2 A;  1BQZ A;  4IHJ A;  4DR5 B;  1KQS U;  2OCH A;  3QO5 A;  1NVP B;  4PDR A;  3K0D A;  3B8M A;  3ETE A;  1FFX A;  1YCI A;  4GCZ A;  3C3T A;  2OCC C;  1SQV H;  2H3O A;  2UU9 O;  2F4V B;  1PM9 A;  4RQE A;  2Q7G A;  3GWO A;  1N34 B;  4JYA B;  4YJ3 B;  1RM1 B;  5CA3 A;  4NB5 A;  4DV6 B;  2UXC B;  4RUE A;  1W0K G;  1AIL A;  2AZ0 A;  2OTL V;  3A0H Z;  4ZOL A;  1Q90 D;  4X1K A;  3NXS A;  3KZI Z;  2KSD A;  3ZBH A;  4EFE A;  4A5U B;  3JAT B;  3SPJ A;  3E22 B;  2JGD B;  3MDS A;  4LBE C;  3OUF A;  3LNN A;  4QNH B;  3PN1 A;  4QGP A;  2CK3 G;  4P9O A;  1QVF U;  4MVO A;  3LDE A;  1I5Y A;  5KHK A;  5B1A B;  1SZX A;  1HNW B;  3VQW A;  3OR7 C;  4QIW F;  2AW9 A;  1GO3 F;  4N23 A;  5CBF A;  1QQC A;  1GM9 A;  5TIS Z;  4RAI A;  4HAM A;  3D3I A;  3FX7 A;  1KB9 F;  4G27 B;  4X65 B;  4LC1 A;  5LMN O;  5IYD O;  3JAR A;  4RUF A;  1JX9 A;  1O9H A;  1I94 B;  1AI5 A;  1QNM A;  5B1B B;  5CBG A;  2RDC A;  2WLN A;  4B08 A;  2DE0 X;  3RWR D;  2XT9 A;  4B7K A;  5L3E A;  1HP8 A;  5LOV A;  5DED A;  2NR5 A;  5IJ9 B;  1UJW B;  4DR4 B;  4ICG A;  1FS0 G;  4CS4 A;  4BIU A;  2ZKO A;  3QG5 A;  4QE9 A;  2IJJ A;  3CE2 A;  2KG7 A;  3Q4H B;  2A0L A;  3SGI A;  2YC0 A;  1XQ8 A;  3HR0 A;  5FPO A;  1JVM A;  2WLL B;  4JI1 O;  5JCO C;  3ABK C;  2EJ7 A;  1ZLZ A;  1RSO B;  2DQ3 A;  4DV7 B;  4UB6 Z;  2HJD A;  3AK2 A;  5BMV A;  2YUA A;  2LFR A;  2UXN A;  3ASN C;  5B3S B;  5E1A C;  4I0X A;  3K08 A;  1XNQ B;  1PD3 A;  3O65 A;  2UUC O;  2OWO A;  3JSN A;  4JI7 B;  2LGW A;  1Y67 A;  4J7J A;  4GX1 A;  3X2Q C;  1FXV A;  2QM8 A;  4EEQ A;  2FKX A;  2YI9 A;  3K0G A;  1HR0 B;  5DEC A;  3CJH B;  2EIL C;  4YIP A;  2Q6A A;  3CCR V;  1JJ2 U;  4J42 A;  3M7M X;  1MOF A;  4X88 A;  1FJG B;  1PNK A;  2KQX A;  4MVM A;  5JH7 B;  2EZO A;  3CEI A;  4L87 A;  3LSQ A;  4UCT A;  3ZRV A;  3SPG A;  1S0V A;  2V4D A;  3DTU B;  4GZR B;  3CC4 V;  2QKS A;  2LW1 A;  4NTW A;  2Q7E A;  3P3N A;  4DUY O;  3QNE A;  4HNA B;  4LFA B;  1H2S B;  2A3Q A;  4KFM A;  2W6J G;  3TXS A;  2G38 A;  4FM0 A;  1NQT A;  2DOS A;  3N27 A;  4TT3 G;  1TUE B;  1R3L C;  5JJE B;  1NTK H;  4X66 O;  4MW8 A;  5LBQ A;  2P4V A;  1R6T A;  1KYO F;  3TGU H;  1IBK B;  4YY3 O;  4NR1 A;  5EK0 A;  4WFH A;  4DW0 A;  3OE7 G;  2OIE A;  3HKB A;  3JAW B;  4H13 B;  1Q6I A;  1SS3 A;  4K0K O;  5IWA B;  2XHB A;  2Y0I A;  3WB1 A;  4KUM A;  1OCO C;  2P06 A;  4WFG A;  5IE9 A;  4NTX A;  3ZMZ A;  4XDJ A;  5LA6 A;  5L3F A;  5HFM A;  4FMT A;  2NN4 A;  3STZ C;  1Q6U A;  1GRJ A;  2X7R B;  2ZQM A;  1M9N A;  5D5P A;  3T1Y O;  2JEU A;  3JYC A;  1QCE A;  3WU2 Z;  4H44 B;  1GM7 A;  2EIN B;  5JQG A;  4UUJ C;  5JCO A;  4B3M O;  5CBH A;  3ZRW A;  3OM3 B;  3LUT B;  2VQE O;  3CCE V;  2LGQ A;  3CRC A;  4X1Y A;  4JI0 B;  2VQF O;  5C8Y A;  1LUV A;  3BFR A;  1GM8 A;  3HKE A;  1I5X A;  5DN6 G;  1DK1 A;  2JEX A;  5IYZ B;  2ADP A;  2CH7 A;  4LF8 B;  3HB3 B;  4GT1 A;  5EBM C;  2BOB C;  4LH7 A;  1J5E O;  2E3C A;  4OPH A;  1XUQ A;  4B3S B;  1M1K W;  3JD1 A;  2D2C B;  4U7N A;  1CP9 A;  4O2B A;  3PJS K;  5EYP B;  4DV5 B;  1H2N A;  1OCC B;  5K1X A;  4C7U A;  4F6R B;  5C93 A;  3R65 A;  2UXB B;  1PNM A;  4E2L A;  1Q81 W;  4JAA A;  4R6Z A;  2DN9 A;  3R66 A;  2RN9 A;  1E1Q G;  4X20 B;  2A79 B;  2EUL A;  2ZE5 A;  1JFF A;  2F1M A;  4QPJ A;  5BY1 A;  1MZF A;  4UB8 Z;  3E89 A;  3RYH A;  3ZN0 A;  1SA0 B;  1JOY A;  2IM9 A;  3X2Q B;  4WFA V;  2P67 A;  3OUS A;  3A0R A;  5K1P A;  3BA9 A;  2QWP B;  1IDS A;  3EFF K;  2F93 B;  4B3R B;  3D36 C;  2R9A A;  2DW4 A;  4DR7 O;  2Y48 A;  2R9I A;  1GH6 A;  4P2Z A;  2EIJ C;  5KAF Z;  4TV8 B;  5KMG B;  1VQ9 V;  1FKA O;  4O4J B;  1MZE A;  4OPA A;  2L35 A;  1VQK V;  2KKW A;  3ZHV A;  5GON A;  2FL4 A;  2P90 A;  4GUN A;  1KKD A;  2CTQ A;  3VOU A;  1EZV H;  4O4L B;  1OCR B;  2LJ2 A;  3H1L H;  5DM6 V;  2N05 A;  4DO2 A;  1L0L H;  5LGT A;  4FLY A;  2ZCE A;  3MAQ A;  5A9G A;  1QBZ A;  1KD1 W;  2HG5 C;  3G6E V;  4TV9 B;  2VWJ A;  1NH2 D;  3UO3 A;  4I55 B;  3U11 A;  4U3J A;  4JI8 B;  4PEL A;  4LF7 B;  1RM1 C;  1AR5 A;  2LP7 A;  4DV3 B;  1KKC A;  4FFB A;  3KKY A;  4GX5 A;  2HFE C;  3J81 N;  1JCH A;  2Q0A A;  2OYQ A;  1ZX3 A;  4UCS A;  1BZK A;  1R6K A;  2HEP A;  3JD0 A;  1LNQ A;  2Q73 A;  4IIJ A;  3FFQ A;  1V9P A;  4FFK A;  5LXT B;  4X64 B;  1H2M A;  2ARH A;  3G6B A;  4BW9 A;  3N2G A;  1Q5O A;  2QE7 G;  4FLZ A;  3OGC C;  2UXD O;  5JJN B;  1XOU A;  3BY6 A;  5EBW C;  3DSQ A;  5B1A C;  3RYC A;  3SYA A;  1YXB A;  4MTF A;  1EBO A;  1FXK B;  3BA8 A;  3ZMV A;  1IXB A;  2RMK B;  3U10 A;  2Z3Y A;  1YTF B;  2GTS A;  3SJA C;  4TQD A;  3SYP A;  1VEW A;  3ZN1 A;  4DR2 O;  4JYY A;  5FL7 G;  4BIO A;  5CB4 A;  5LHG A;  2W0F C;  5LYJ B;  4MTG A;  2ZE6 A;  3UT5 A;  5EZY A;  1F7Y A;  2P4K A;  3ZMS A;  4ZBM A;  2QJ1 A;  1ENV A;  5B1B C;  2HKO A;  2BE3 A;  3K5N A;  3CHX A;  1WP8 A;  1KC8 W;  3OTO O;  2JS5 A;  3SR2 C;  4LF5 O;  1HNZ O;  1RP3 B;  3CRQ A;  4F6E A;  1XMO O;  4KHP O;  1YI2 V;  4B3T B;  4X1I B;  3M99 B;  3CWB H;  1XL4 A;  2BOC C;  3ASO B;  3O9O A;  1NVP D;  2DYS B;  5KA5 A;  2JVD A;  1R1B A;  2WA3 A;  1B04 A;  2YEV B;  1N33 B;  5KX5 B;  3A2F A;  3T1H O;  3T2M A;  3RYF A;  3UQ8 A;  3HPL C;  4E4E A;  2RNB A;  2O57 A;  2ZIM A;  1TA8 A;  1BGY H;  5EIB C;  4D7S A;  4DV4 O;  2B1G A;  3MHH C;  3D36 A;  5B3S C;  2UUA O;  4UVA A;  4JAU A;  4CH5 A;  3W7W A;  1IBM B;  4I4T B;  5J2U A;  1ZSP A;  2JDI G;  1AI7 A;  4AQY O;  1IBL O;  2GBO A;  4LF6 O;  2LQT A;  5ITZ B;  2EJR A;  2A9H A;  1M93 A;  2VQE B;  2ZXW B;  4ASU G;  2E74 B;  3CMA V;  2W6I G;  3DXR B;  1K4D C;  4DV1 B;  4JAV A;  1G1X B;  2HHH B;  5IDJ A;  1SQF A;  1R6N A;  1WN7 A;  4DR3 O;  1OJH A;  3BCC H;  3ABT A;  5J2T B;  2YXL A;  2E5L B;  3ZMU A;  3H1I H;  1WLE A;  2HVJ C;  2ILM A;  5BXZ A;  2DWE C;  2M7W A;  4ZI7 B;  2HJF C;  3L71 H;  2CGN A;  3CRM A;  4JI2 B;  1THZ A;  1Z2G A;  2XAJ A;  4YJ3 A;  2YXH A;  4TUY B;  3L73 H;  1XHZ A;  4IYI A;  3UKM A;  4YHH B;  4QPK A;  5A2Q N;  5JVD B;  3QVN A;  4YIO A;  2XOK G;  5EBL C;  3ZHS A;  5GTI Z;  1H8H G;  4LF4 B;  3JAT A;  3E22 A;  2N74 A;  4PDM A;  2JGD A;  1JMK C;  1Y66 A;  3ZED A;  4Z1V A;  1SES A;  1FAF A;  4LR3 A;  3K59 A;  4LP8 A;  3CP1 A;  3OTF A;  2EIM B;  1EN6 A;  2EBO A;  4KXR A;  3CS5 A;  2GUZ B;  4JI6 O;  4I9W A;  4EB6 B;  2RQ6 A;  3WB2 A;  1BCC H;  3FYI B;  1W59 A;  5FNV B;  2ZIN A;  1WP7 A;  3FB8 C;  4JI4 B;  1SRY A;  2R70 A;  1X4T A;  3K3W A;  1R3J C;  4FLT A;  3D3Q A;  4JV5 B;  3CRA A;  3CXH F;  4W4L A;  2VRZ A;  2YXY A;  2YDE A;  4LF9 B;  5IJ9 A;  4TSF G;  2E76 B;  3OEH G;  3S3X A;  4FK5 C;  1GMG A;  2WWW A;  3TET A;  3Q4H A;  3SYC A;  2GV9 A;  3ETD A;  2FYU H;  1GKF A;  2EIN C;  2JJ1 G;  1S77 D;  3JAS B;  5KUK A;  4NYK A;  1NTM H;  3F7Y C;  4FIP C;  2F95 B;  2EIK B;  2P6J A;  4FLV A;  1IUR A;  1G4Y B;  1RSO A;  1NJI W;  1NS1 A;  1B6Q A;  4ZHQ B;  2HVK C;  1Q43 A;  1K9M W;  3RVZ A;  3BPZ A;  2ZM6 B;  1Y76 B;  2PZS A;  1N32 B;  4LFC O;  3RN4 A;  2YS8 A;  1N36 O;  1EM1 A;  4CZZ A;  1VQM V;  4X8A A;  1YIT V;  4D7T A;  4WFF A;  3JAM N;  1VQ4 V;  4CS3 A;  3B4S A;  4BW5 A;  2DYR B;  1KMI Z;  3STL C;  3FAV B;  1VAR A;  3CJH A;  2IU0 A;  5CA0 A;  1KP3 A;  4NXN O;  4WBN B;  4PA7 A;  4PA3 A;  4I7Z B;  1OCC C;  1US6 A;  3TK1 A;  3SYQ A;  4J80 A;  5JH7 A;  2BTQ B;  3FB7 C;  4DK0 A;  3RW0 A;  4YJ2 B;  3QO8 A;  3T1C A;  3H01 A;  5B1O A;  1SQX H;  4WFB V;  1M4U A;  2UUB O;  5BR8 B;  4GKK O;  1TAE A;  4HNA A;  5CA1 B;  2RCV A;  1V54 B;  2V7Q G;  3BVO A;  3CSX A;  2YSU B;  4H37 A;  2HLD G;  1S3J A;  5LMU O;  2LO1 A;  4WF9 V;  4I5S A;  4LNU B;  3JAL B;  3AG1 B;  4NTY A;  1W2B U;  5KLV H;  1TUB B;  4DRX B;  1VQP V;  4K8Z A;  1OCR C;  2ODM A;  3JAW A;  1OCZ B;  1XDC A;  3VBB A;  1AVM A;  2IJH A;  4NXM O;  4FLW A;  3EXA A;  3LDC A;  1WNS A;  4O2A B;  2PGG A;  2BTO A;  4DK1 A;  1FPO A;  2D3O W;  4OX9 O;  4ZIB A;  1AP5 A;  1BE3 H;  2H8P C;  1SQG A;  3EVK A;  1FXH A;  2PF4 E;  5CMU A;  3OD4 A;  1F4M A;  3AEI A;  4LH6 A;  2VS0 A;  4HZ3 A;  1IXM A;  1M57 B;  3CB2 A;  2ZDI C;  1XI1 A;  4JI3 O;  3ZHT A;  4OGQ B;  1XNR B;  1H38 A;  1YHQ V;  2QDO A;  3JD2 A;  3CCU V;  2FB5 A;  3ZHQ A;  3ABL B;  2EZP A;  1NU1 H;  2XAQ A;  3SJC C;  2GTA A;  1BT8 A;  1KP2 A;  4JI5 O;  1HNX B;  4DR1 B;  1H2K A;  4GX0 A;  4MVS A;  4X62 B;  1I7F A;  5IYZ A;  1V55 B;  1BL8 A;  1FXK C;  1ZL8 B;  4CH6 A;  2EX3 A;  2OT5 A;  3C3S A;  3TCU A;  3DC5 A;  2WPD G;  3I5D A;  4MS2 A;  2QWO B;  1WJZ A;  1MSD A;  1SQQ H;  1X59 A;  5EYP A;  2BSK B;  2UU9 B;  4DV2 O;  4F6R A;  1BHB A;  2QR4 A;  1WAZ A;  1TVK B;  3JD3 A;  4AIL C;  1ZUQ A;  4K35 A;  2R72 A;  3J80 N;  4NVP A;  2PUS A;  1Q3E A;  3LSS A;  3ASO C;  4X20 A;  2DYS C;  4DR6 O;  4MTX A;  2C2A A;  4O4I B;  3JAK B;  3E2E A;  4HYO A;  2UXX A;  1SA0 A;  4DW1 A;  4KL1 A;  4K3A A;  3ZRS A;  5B1N A;  3SPH A;  1DGS A;  1OZ0 A;  1EZJ A;  4JYC A;  5KHJ A;  4PDV A;  3HKD A;  4ZKI A;  4FM2 A;  3IJ4 A;  4DUZ O;  5L3B A;  4TV8 A;  5LP6 B;  4O4J A;  3D8C A;  5LHI A;  4JF3 A;  2N04 A;  2QTO A;  1NZ6 A;  1JR9 A;  4HBN A;  4UCO A;  1AR4 A;  5IYB O;  4J9Y B;  1N0N A;  1FFT B;  3JD4 A;  2ZXW C;  1QU7 A;  3ZX6 A;  4LFB O;  1FYJ A;  1Z5V A;  4X9Q A;  1GN6 A;  2ZIO A;  1GN4 A;  5LMN B;  3RFR A;  1LUW A;  4DR5 O;  4GYC B;  2YI8 A;  1Q86 W;  4LFC B;  2BCC H;  1TGO A;  2XAG A;  4LWS B;  1N36 B;  3OAA G;  4TV9 A;  4I55 A;  2F4V O;  4WFE A;  1N34 O;  1YTF D;  4JYA O;  4CH3 A;  3CME V;  2Q69 A;  3B8N A;  3VQY A;  1B06 A;  3OGI B;  1KBH A;  4FLX A;  1GN2 A;  4DV6 O;  2UXC O;  2ZDI A;  3ICX A;  2HP8 A;  1P7B A;  2DJV A;  4GLX A;  2CAZ C;  4JI1 B;  1P84 F;  1DF5 A;  2ZE8 A;  5F2V O;  5LXT A;  1FD9 A;  3QO7 A;  3T4D A;  1K3E A;  2PTM A;  2IH3 C;  3CPW U;  2F66 C;  1XMQ O;  1Q7Y W;  1DTO A;  1K8A W;  3B77 A;  2QWQ B;  3AG2 B;  2EIM C;  3W7X A;  1IZ3 A;  1YVW A;  2IJK A;  1FXK A;  1UPG A;  3B09 A;  2UUC B;  2LW7 A;  1HNW O;  5LHH A;  4I50 B;  3ZJZ A;  2B1I A;  1PPJ H;  4BWA A;  3JCU Z;  1P4R A;  5LYJ A;  1BQ0 A;  4X65 O;  3FB6 C;  2XTA A;  1N0J A;  2Y69 B;  2QWN B;  3SYO A;  1I94 O;  4IL6 Z;  2M6Y A;  1JA8 A;  1MAB G;  4X1I A;  1SZT A;  4DR4 O;  2WLK A;  4MW3 A;  1B3Q A;  2OTJ V;  2XAS A;  3G4S V;  5L3C A;  2YEV A;  4UFZ A;  5KHG A;  1WB8 A;  5KX5 A;  3CCQ V;  2EIK C;  1D5A A;  4UCR A;  4ABM A;  4DUY B;  3H1H H;  4DV7 O;  4MTO A;  4J7K A;  2PY5 A;  1MA1 A;  1AI6 A;  4I4T A;  4X66 B;  1OV9 A;  3B2E E;  1PL0 A;  2QKC A;  4UCV A;  2CE4 A;  5ITZ A;  3ZMT A;  1K5Q A;  2ADQ B;  1URF A;  4DV0 O;  1YIJ V;  1XNQ O;  1P49 A;  2AHY A;  2A7W A;  3P30 A;  4YY3 B;  3DXR A;  4JI7 O;  1VF5 B;  1NBM G;  1WA8 B;  2DYR C;  1K97 A;  5J2T A;  4MVZ A;  3AG7 A;  4K0K B;  4ZI7 A;  2JIZ G;  4BIZ A;  1HR0 O;  1JQ0 A;  1Q82 W;  2PYL A;  1N8R W;  1M90 W;  5IYC O;  1Y74 B;  4PI2 A;  4TUY A;  4RQF A;  1OHH G;  3P3P A;  1SQP H;  4J41 A;  1VQL V;  2F43 G;  4PJ0 Z;  3GB7 C;  3T1Y B;  1CEZ A;  2ZD9 A;  1JPX A;  5IT9 N;  2AGA A;  1S5H C;  1NH2 B;  5H5N A;  1FJG O;  1NTZ H;  1T5E A;  4RO2 A;  4D6T H;  2WSS G;  4B3M B;  2ZNJ A;  4PA6 A;  3FKS G;  2WLI B;  1R3I C;  1KU9 A;  3K04 A;  3N2K B;  4MVR A;  1KEC A;  1V54 C;  2FML A;  1Y6X A;  5EZY B;  2CUG A;  2XUM A;  2VQF B;  4LFA O;  2YID A;  1UFI A;  3OR6 C;  3KCX A;  2P5O A;  4JZ2 A;  1MNG A;  3E8F A;  3HKC B;  3VQV A;  5HFL A;  4J7Z A;  1SC5 B;  2GUZ A;  3JCZ A;  2QEX V;  1SQB H;  1BS3 A;  1VP7 A;  3BAA A;  4Q6G A;  3AG1 C;  3OMN B;  1XL6 A;  2DQ0 A;  3FYE B;  1ORQ C;  2ITC C;  1IBK O;  1J5E B;  3K57 A;  2ATK C;  2NNU A;  5JJJ B;  3SJQ C;  5FLX N;  1OCZ C;  5CN0 A;  4MVQ A;  1YJ9 V;  4Q20 A;  4XDK A;  4UV8 A;  4CBC A;  3T4Z A;  1WPX A;  2IU3 A;  2F23 A;  4BAY A;  3CCJ V;  2GHY A;  1COW G;  3K9A A;  1K5S A;  3JAS A;  4JYB A;  4FPP A;  5LGN A;  1M57 C;  1K92 A;  5D5Q A;  3RGB A;  3SPC A;  3RYI B;  1H2L A;  2R9R B;  2WAM A;  1VIB A;  2DMX A;  2Q8V A;  1P7G A;  1G6U A;  3FD9 A;  1VMG A;  1IX9 A;  5EIB D;  4ZHQ A;  4H0L B;  4MSW C;  1Y76 A;  2YIA A;  3ABL C;  2Q67 A;  3H1J H;  4FZ0 A;  4JI0 O;  1RPR A;  2P22 C;  4DR7 B;  4EKW A;  3CCL V;  1K73 W;  1R3K C;  5IJ0 B;  1V55 C;  3ZS8 C;  2JRI A;  1I0H A;  4PV1 B;  2Z5U A;  4LF8 O;  2X6B A;  3WG7 B;  4O4H B;  2IH1 C;  3K5O A;  3L74 H;  4XDL A;  2WLL A;  1XMQ B;  4EFB A;  3FAV A;  2QTS A;  5KHH A;  1SKV A;  1VQN V;  3K58 A;  4B3S O;  4IHJ B;  4WBN A;  1HWY A;  5B5E Z;  1FFX B;  1M5I A;  1HDJ A;  1BHA A;  3LNM B;  1XIL A;  4DV5 O;  5L3D A;  4H33 A;  1YZB A;  2BTQ A;  2UXB O;  4UVC A;  1F23 A;  4YJ2 A;  3ABM B;  3WFV A;  3CXC U;  1PV0 A;  2X6A A;  4GX2 A;  5BZB A;  4KP4 A;  2E75 B;  2HR3 A;  1ARO P;  2WLM A;  1M56 B;  1ZWI C;  4JTD B;  1U97 A;  4ZOL B;  4X1K B;  3OMA B;  4JZG A;  5CA1 A;  3CCM V;  4PA4 A;  2V1D A;  3ETQ A;  4P30 A;  3F5W C;  4PD4 F;  3ZHR A;  2UXD B;  2AZ2 A;  2YIB D;  4B3R O;  3IC7 A;  5KAI Z;  3I55 V;  2ZT9 B;  5KA6 A;  4LNU A;  4BR6 A;  3JAL A;  5LP6 C;  3W7T A;  2JK5 C;  1TUB A;  4DRX A;  3ZHU A;  3BHP A;  2JS3 A;  3L72 H;  2MW2 B;  1Q6H A;  5IY5 B;  3AK1 A;  3E86 A;  4WCE V;  4DR2 B;  3B40 A;  2MK3 A;  3ETG A;  3LSU A;  1E1R G;  5L3G A;  4AI8 A;  3JAR B;  1AR1 B;  2DWD C;  1DLB A;  3MD0 A;  3I56 V;  1VQ8 V;  2CTW A;  3K5M A;  3CRR A;  4O2A A;  3K03 A;  3OTO B;  3OEE G;  4IYH A;  1PP9 H;  3KG2 A;  5B66 Z;  4LF5 B;  1QLE B;  3CX5 F;  1HNZ B;  1SF9 A;  4DV0 B;  1G8M A;  3S3W A;  5J9P C;  1XMO B;  4JI8 O;  4R8C A;  4KHP B;  1IVS A;  4LF7 O;  4GKJ O;  3AG3 B;  5LOV B;  2YIB A;  1Z5W A;  4DV3 O;  5JWP A;  2KG7 B;  3T1H B;  3H9V A;  2JJ2 G;  2JGU A;  3A0B Z;  2Y4T A;  3E83 A;  2CGO A;  4X64 O;  5CA0 B;  5H6Q A;  3AG4 B;  2CTR A;  4DV4 B;  5BMV B;  2UUA B;  1NR7 A;  1I08 A;  3AG2 C;  1ZAU A;  1JJO A;  5GW7 A;  4AQY B;  1QR8 A;  1HW7 A;  5KUM A;  1ROP A;  1IBL B;  1L0N H;  4LF6 B;  2H94 A;  1VQ5 V;  1VQ7 V;  3LDD A;  4I0X B;  1ZL8 A;  2KB1 A;  3OT7 A;  4UV9 A;  2Y0P A;  3W7U A;  1YDX A;  4K8X A;  3L9D A;  4DR3 B;  3F5T A;  4R50 A;  2P7T C;  1LR1 A;  2BSK A;  4U7O A;  3DC6 A;  3BAB A;  2OCC B;  2Y69 C;  3FB5 C;  4MVU A;  3K06 A;  3NR7 A;  4B7E A;  1TVK A;  4RWU A;  1YSC A;  3GVM A;  2XAF A;  3F7V C;  5KHI A;  1VQO V;  1D2D A;  4DXW A;  1ZTE A;  3OMI B;  4FM1 A;  2AHZ A;  5EC1 C;  4B3T O;  4O4I A;  1XHX A;  2PI4 A;  3JAK A;  4MT8 A;  2Q5Z A;  2VWK A;  3ZCC A;  5H2F Z;  1N33 O;  2QM4 A;  1U96 A;  1K7D A;  4XBF A;  3APQ A;  4J9Z B;  1GK9 A;  3IC9 A;  5LP6 A;  1VF6 C;  1IBM O;  4JI6 B;  2XND G;  3TJT A;  2B5U A;  3K79 A;  2Q9L A;  4Z1M G;  4J11 A;  3W7S A;  2ZNI A;  2AXT Z;  3ZRX A;  3P32 A;  1Y4M A;  3VQX A;  4W4K A;  4DV1 O;  2HHH O;  4IT5 A;  3HKB B;  4J10 A;  2E5L O;  4LWS A;  3G67 A;  2Q4P A;  2ZE7 A;  2Z0A A;  3J7A U;  5FPR A;  2WLJ A;  1DF4 A;  4JI2 O;  5LA6 B;  3CC2 V;  1MSW D;  2IW5 A;  4JPR A;  1NR1 A;  5KMG A;  2ZR3 A;  4YHH O;  1WB7 A;  2NLJ C;  4JTC B;  5LGU A;  1AP6 A;  2PI5 A;  2QSA A;  3AK3 A;  4LF4 O;  5JQG B;  3TXQ A;  1W0J G;  1XBL A;  4O4L A;  3ZRW B;  3ABK B;  4UXN A;  3CD6 V;  2K1E A;  5AG2 A;  4PA9 A;  4FZ1 A;  1AB3 A;  1WPB A;  4X1Y B;  3BRC A;  3ASN B;  5C8Y B;  4FJC C;  3HKE B;  1BSM A;  3RVY A;  4F4L A;  5LL6 Y;  3U0Z A;  2QA4 V;  1VF7 A;  4I50 A;  2GDS A;  5EC2 C;  2CH7 B;  3SPI A;  1SET A;  4X89 A;  2X0L A;  5H9C A;  1YF2 A;  4JI4 O;  1K4C C;  2YIC A;  4NXN B;  1CXZ B;  4R7C A;  2GSM B;  3UM7 A;  4JV5 O;  1SER A;  5GTH Z;  2EIL B;  3HKD B;  3QF7 A;  4O2B B;  4CC6 A;  3G71 V;  4LF9 O;  2W0X A;  3C90 A;  3G80 A;  1K34 A;  2FTK A;  1AJP A;  2UUB B;  1EFR G;  1J95 A;  1GTO A;  4GKK B;  3K5L A;  1YJW V;  1BMF G;  3CYO A;  1F4N A;  1JFF B;  4PI0 A;  3APO A;  3E8H A;  3RYH B;  4L8J A;  1O9G A;  1A32 A;  3RT3 C;  2Q68 A;  1VF6 A;  4OXS A;  2ZM6 O;  5LMU B;  4GKJ B;  4UCU A;  2RJZ A;  1N32 O;  2Y4U A;  1AI4 A;  1PKX A;  1PNL A;  2LFS A;  3IFX A;  4G28 B;  1VQ6 V;  4AHC A;  2ZR2 A;  4Z2W A;  3WG7 C;  4N21 A;  1WA8 A;  2XAH A;  5GON B;  1S72 V;  3E8B A;  1PL4 A;  4JGS A;  3ABU A;  4NXM B;  2QGN A;  4CC5 A;  1OCO B;  1Y74 A;  1RPO A;  1CPY A;  3EHB B;  1AJQ A;  5E79 Z;  1MMM A;  2CDY A;  3OFN G;  4OX9 B;  2IBZ H;  4U3J B;  3ABM C;  4QE7 A;  4UVB A;  4FFB B;  2QM7 A;  3MHS C;  1M56 C;  1L8D A;  3CCV V;  1E79 G;  2WLI A;  3SJB C;  4PDL A;  4TQF A;  4JI3 B;  5BR8 O;  3N2K A;  4IIJ B;  1QR9 A;  3CCS V;  2QKA A;  3THO A;  3N2G B;  1AJN A;  3BEH A;  3ZIA G;  3HKC A;  4JI5 B;  1S5J A;  1H8E G;  2Q0O C;  1S5L Z;  3SDL A;  3OW2 U;  2X6C A;  4CH4 A;  1QHT A;  3L70 H;  1YEW A;  3WB0 A;  3L75 H;  4IGG A;  3CC7 V;  3RYC B;  2IJI A;  2ETN A;  4DYL A;  1RFY A;  1NT2 B;  4NKG B;  1MG1 A;  5JVD A;  3UCS C;  3M8A A;  4QJF B;  2QWR B;  3QTC A;  5IY5 C;  1EN5 A;  4I9Q A;  4TWK A;  3E8G A;  1YJN V;  3ML0 A;  5CB4 B;  2CTP A;  1NKD A;  3DGE A;  3UT5 B;  4DV2 B;  3K9S A; 
#chains in the Genus database with same CATH homology
 1ARO P;  2WLM A;  4JAS A;  2P90 A;  1M56 B;  1KKD A;  1KP2 A;  2ITD C;  1ZWI C;  4JTD B;  3VOU A;  1QLE C;  4GX0 A;  1L1F A;  1OCR B;  3OMA B;  4MVS A;  3CCM V;  4PA4 A;  2V1D A;  5DM6 V;  1V55 B;  3AG3 C;  4P30 A;  4DO2 A;  1BL8 A;  3F5W C;  1FXK C;  3IGA C;  5LGT A;  4JTA B;  1QBZ A;  2OT5 A;  1R73 A;  3TCU A;  2WPD G;  1KD1 W;  3IC7 A;  2HG5 C;  3I55 V;  3G6E V;  5KA6 A;  1H2G A;  4MS2 A;  1NH2 D;  4PEL A;  1RM1 C;  1QLN A;  1QVG U;  3E35 A;  3W7T A;  2LP7 A;  1K33 A;  2JK5 C;  3AG4 C;  4GX5 A;  2HFE C;  1JCH A;  1F51 A;  4G2K A;  1S76 D;  4YXW G;  5IY5 B;  1BHB A;  3E86 A;  4WCE V;  1R6K A;  3JD0 A;  2MK3 A;  1LNQ A;  3JD3 A;  3RBZ A;  3ETG A;  2EIJ B;  4P9P A;  1E1R G;  5L3G A;  2QE7 G;  2WLH A;  1AR1 B;  3LSS A;  3ASO C;  2DWD C;  1DLB A;  3MD0 A;  5H6R A;  2DYS C;  3I56 V;  1VQ8 V;  3OGC C;  4MTX A;  3K03 A;  2C2A A;  3OEE G;  4LCU C;  3KG2 A;  3BY6 A;  1QLE B;  3E2E A;  4HYO A;  2UXX A;  5EBW C;  5B1A C;  1G8M A;  3SYA A;  5J9P C;  1KQS U;  3QO5 A;  4MTF A;  4R8C A;  3ZRS A;  5B1N A;  1NVP B;  3AG3 B;  4PDR A;  3SPH A;  3K0D A;  3B8M A;  1OZ0 A;  3ETE A;  1EBO A;  4GCZ A;  1EZJ A;  1FXK B;  2OCC C;  4JYC A;  3ZMV A;  4PDV A;  2Z3Y A;  1YTF B;  4ZKI A;  4RQE A;  3GWO A;  3SYP A;  3ZN1 A;  5FL7 G;  5L3B A;  1RM1 B;  2JJ2 G;  5LHI A;  5LHG A;  3E83 A;  4JF3 A;  2W0F C;  4MTG A;  5CA3 A;  2QTO A;  5H6Q A;  3AG4 B;  4RUE A;  1W0K G;  3ZMS A;  4ZBM A;  5IYB O;  4J9Y B;  2OTL V;  1ENV A;  1FFT B;  5B1B C;  3JD4 A;  1NR7 A;  2HKO A;  3AG2 C;  2ZXW C;  1KC8 W;  3NXS A;  5GW7 A;  1QR8 A;  3SPJ A;  5KUM A;  1ROP A;  2H94 A;  1VQ5 V;  4LBE C;  1VQ7 V;  3LDD A;  1YI2 V;  3OUF A;  3M99 B;  2KB1 A;  1Q86 W;  1XL4 A;  2BOC C;  4QNH B;  3ASO B;  4UV9 A;  1NVP D;  2XAG A;  2DYS B;  3W7U A;  2CK3 G;  5KA5 A;  3OAA G;  4P9O A;  1QVF U;  2YEV B;  4MVO A;  3LDE A;  1I5Y A;  4WFE A;  1YTF D;  5B1A B;  3T2M A;  3CME V;  2Q69 A;  3B8N A;  3HPL C;  4R50 A;  2P7T C;  4U7O A;  2OCC B;  2Y69 C;  3OR7 C;  4QIW F;  1GO3 F;  2ZDI A;  3FB5 C;  4N23 A;  4MVU A;  5CBF A;  2B1G A;  3K06 A;  1GM9 A;  3D36 A;  1P7B A;  3MHH C;  4HAM A;  4RAI A;  5B3S C;  4UVA A;  3D3I A;  1DF5 A;  4JAU A;  3W7W A;  4G27 B;  1YSC A;  2JDI G;  3QO7 A;  1AI7 A;  3T4D A;  1K3E A;  2XAF A;  3F7V C;  4LC1 A;  5IYD O;  2IH3 C;  1JX9 A;  4RUF A;  3CPW U;  4DXW A;  1VQO V;  3OMI B;  2AHZ A;  5EC1 C;  1Q7Y W;  2EJR A;  1DTO A;  2A9H A;  1K8A W;  1AI5 A;  2PI4 A;  4MT8 A;  3B77 A;  5B1B B;  5CBG A;  3AG2 B;  2ZXW B;  2EIM C;  4ASU G;  2WLN A;  3ZCC A;  3W7X A;  3CMA V;  2W6I G;  1K4D C;  4JAV A;  5L3E A;  5IDJ A;  1R6N A;  1UJW B;  1FS0 G;  2IJK A;  1FXK A;  3ABT A;  4BIU A;  3ZMU A;  1K7D A;  1WLE A;  2HVJ C;  4QE9 A;  2IJJ A;  4XBF A;  2DWE C;  2M7W A;  5LHH A;  2HJF C;  3ZJZ A;  2A0L A;  4J9Z B;  2B1I A;  1GK9 A;  1JVM A;  2WLL B;  1THZ A;  2XAJ A;  1P4R A;  2XND G;  3ABK C;  3UKM A;  2DQ3 A;  2B5U A;  4QPK A;  3FB6 C;  3K79 A;  2Y69 B;  2LFR A;  2XOK G;  5EBL C;  4Z1M G;  3SYO A;  3W7S A;  2UXN A;  1H8H G;  3ASN C;  3ZRX A;  5B3S B;  5E1A C;  3P32 A;  1Y4M A;  4PDM A;  1MAB G;  3K08 A;  1SZT A;  1Y66 A;  2WLK A;  4MW3 A;  1SES A;  2OTJ V;  1PD3 A;  4LP8 A;  2XAS A;  3G4S V;  5L3C A;  2YEV A;  3CP1 A;  3CCQ V;  2EIM B;  2WLJ A;  2EIK C;  1DF4 A;  2EBO A;  3CC2 V;  4GX1 A;  3X2Q C;  1FXV A;  1MSW D;  2QM8 A;  2IW5 A;  4JPR A;  1NR1 A;  4I9W A;  2ZR3 A;  3K0G A;  2NLJ C;  3FYI B;  4JTC B;  4MTO A;  5LGU A;  2EIL C;  2PI5 A;  2Q6A A;  1AI6 A;  3CCR V;  1JJ2 U;  3FB8 C;  1MOF A;  1W0J G;  1SRY A;  1PL0 A;  3ZRW B;  3ABK B;  4UXN A;  3K3W A;  3CD6 V;  1R3J C;  4X88 A;  2K1E A;  1PNK A;  3ZMT A;  1K5Q A;  4PA9 A;  4MVM A;  1YIJ V;  2EZO A;  2AHY A;  4L87 A;  3P30 A;  3LSQ A;  3ZRV A;  3SPG A;  3ASN B;  1S0V A;  3DTU B;  3CC4 V;  4FJC C;  2QKS A;  1NBM G;  4TSF G;  3OEH G;  2DYR C;  4FK5 C;  1K97 A;  4MVZ A;  3RVY A;  4F4L A;  1GMG A;  2WWW A;  3QNE A;  2QA4 V;  3TET A;  2JIZ G;  4BIZ A;  3SYC A;  3ETD A;  2W6J G;  4KFM A;  1GKF A;  1JQ0 A;  1NQT A;  2EIN C;  2JJ1 G;  5EC2 C;  1Q82 W;  1M90 W;  1S77 D;  5KUK A;  3F7Y C;  4TT3 G;  3SPI A;  1TUE B;  1SET A;  1R3L C;  4FIP C;  5IYC O;  4X89 A;  1OHH G;  4RQF A;  2EIK B;  2P6J A;  2X0L A;  5H9C A;  1G4Y B;  1VQL V;  2F43 G;  3GB7 C;  1CEZ A;  4MW8 A;  1K4C C;  1NJI W;  2ZD9 A;  4R7C A;  1JPX A;  2GSM B;  1B6Q A;  1S5H C;  1NH2 B;  3UM7 A;  2HVK C;  4RO2 A;  5LBQ A;  1SER A;  1K9M W;  3RVZ A;  2EIL B;  2WSS G;  4PA6 A;  3FKS G;  5EK0 A;  3G71 V;  4WFH A;  3OE7 G;  2WLI B;  1R3I C;  3K04 A;  1KEC A;  1V54 C;  4MVR A;  4CZZ A;  1VQM V;  1K34 A;  4KUM A;  1OCO C;  2FTK A;  3OR6 C;  1AJP A;  4WFG A;  4X8A A;  1YIT V;  4WFF A;  1EFR G;  1J95 A;  4XDJ A;  3ZMZ A;  5L3F A;  1GTO A;  5HFM A;  3E8F A;  1VQ4 V;  1YJW V;  1BMF G;  4FMT A;  5HFL A;  3CYO A;  3STZ C;  3JCZ A;  4BW5 A;  2QEX V;  2X7R B;  2ZQM A;  2DYR B;  1F4N A;  1M9N A;  3STL C;  2JEU A;  3AG1 C;  3OMN B;  1XL6 A;  3E8H A;  2IU0 A;  2DQ0 A;  1KP3 A;  3FYE B;  1QCE A;  3JYC A;  4PA7 A;  1GM7 A;  4PA3 A;  2EIN B;  1ORQ C;  2ITC C;  2Q68 A;  4UUJ C;  2ATK C;  2NNU A;  4OXS A;  1OCC C;  5CBH A;  3SJQ C;  3ZRW A;  3OM3 B;  3TK1 A;  3LUT B;  1OCZ C;  1AI4 A;  1PKX A;  3SYQ A;  1PNL A;  2LFS A;  5CN0 A;  3CCE V;  4MVQ A;  3IFX A;  1YJ9 V;  3FB7 C;  4Q20 A;  4G28 B;  3RW0 A;  4XDK A;  1VQ6 V;  3QO8 A;  3T1C A;  3H01 A;  4UV8 A;  2ZR2 A;  5B1O A;  4CBC A;  4WFB V;  3T4Z A;  1WPX A;  3WG7 C;  1GM8 A;  2IU3 A;  4N21 A;  1I5X A;  2XAH A;  1S72 V;  4BAY A;  5DN6 G;  3E8B A;  3CCJ V;  2GHY A;  1COW G;  3K9A A;  4JGS A;  2JEX A;  1K5S A;  1V54 B;  2V7Q G;  3ABU A;  2YSU B;  4JYB A;  4H37 A;  3HB3 B;  1OCO B;  2HLD G;  4FPP A;  4GT1 A;  5LGN A;  1M57 C;  1K92 A;  1RPO A;  1S3J A;  5EBM C;  2BOB C;  1CPY A;  3EHB B;  1AJQ A;  3SPC A;  2R9R B;  3OFN G;  2WAM A;  4WF9 V;  1M1K W;  3JD1 A;  4I5S A;  3ABM C;  4QE7 A;  3AG1 B;  4MSW C;  4U7N A;  3ABL C;  1CP9 A;  1W2B U;  2Q67 A;  3PJS K;  4UVB A;  1RPR A;  2QM7 A;  1VQP V;  3MHS C;  1M56 C;  1OCC B;  4EKW A;  3CCV V;  1E79 G;  5C93 A;  2WLI A;  1OCR C;  3R65 A;  4PDL A;  3CCL V;  1OCZ B;  1R3K C;  1K73 W;  1PNM A;  4E2L A;  1Q81 W;  1V55 C;  4R6Z A;  1QR9 A;  3CCS V;  3VBB A;  2IJH A;  2Z5U A;  1AJN A;  3BEH A;  3ZIA G;  1E1Q G;  2X6B A;  3WG7 B;  1H8E G;  2IH1 C;  2A79 B;  3LDC A;  3OW2 U;  4XDL A;  2X6C A;  2WLL A;  4QPJ A;  1VQN V;  3E89 A;  2D3O W;  3ZN0 A;  3CC7 V;  1JOY A;  2H8P C;  2IJI A;  3X2Q B;  4WFA V;  1FXH A;  2P67 A;  1HWY A;  3OUS A;  5CMU A;  1MG1 A;  3A0R A;  1F4M A;  3AEI A;  4HZ3 A;  1IXM A;  4QJF B;  1M57 B;  3LNM B;  1BHA A;  3EFF K;  5IY5 C;  2ZDI C;  5L3D A;  4H33 A;  2DW4 A;  2Y48 A;  2R9I A;  4TWK A;  3E8G A;  1YJN V;  4P2Z A;  3ML0 A;  4UVC A;  1F23 A;  2EIJ C;  1VQ9 V;  3ABM B;  3WFV A;  1H38 A;  3CXC U;  1YHQ V;  3JD2 A;  1NKD A;  2X6A A;  4GX2 A;  3DGE A;  5BZB A;  3CCU V;  3ABL B;  2EZP A;  2XAQ A;  4KP4 A;  1VQK V;  1N8R W;  2HR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...