3CCMV

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ccmV00
3G4SV 3CCEV 3CPWU 3CCQV 1Q81W 1VQ4V 3G6EV 1QVFU 1YI2V 2D3OW 3I56V 4WF9V 1YIJV 4WCEV 1VQ7V 3CC7V 3CCVV 1VQ9V 3CD6V 3CMAV 1VQLV 3CCSV 1VQKV 1KD1W 3CCUV 5DM6V 1VQ6V 3CCRV 1NJIW 1VQ5V 1YJNV 3CC2V 1Q7YW 1JJ2U 1VQPV 3CC4V 1K9MW 3CMEV 1VQ8V 1VQMV 1VQOV 1YHQV 4WFBV 1R73A 1YITV 1YJWV 1S72V 1Q82W 1M1KW 2QA4V 1KC8W 1K8AW 2OTLV 2QEXV 3CCJV 1N8RW 1YJ9V 1W2BU 3I55V 1QVGU 3OW2U 3G71V 1M90W 4WFAV 3CCMV 1K73W 1KQSU 1Q86W 2OTJV 3CXCU 3CCLV 1VQNV
chains in the Genus database with same CATH superfamily
3ZS8C 3H9VA 3SR2C 4WFGA 3ASNB 4IT5A 2ZM6B 4DV3B 2ZE5A 3OTOO 1KP2A 2D2CB 1G4YB 1EN6A 1K97A 5LGUA 4H33A 4ZIBA 1NH2B 5EBLC 1Z5VA 3OUFA 4B3SB 1NTZH 1TA8A 4U3FH 3C90A 2B9ZA 2V1DA 1US6A 1ZLZA 4DUZB 4KHPB 2UXBO 3E83A 3G6BA 1EFRG 2FL4A 2HR3A 4FM2A 1VQKV 1QNMA 4W4LA 3K06A 2A3QA 3S3XA 3WB0A 4AI8A 3M7MX 4H44B 1E79G 3D3QA 3RVZA 4X9QA 3SPGA 3FB6C 1AR1B 1VQ7V 1Z2GA 4D7SA 3RYFA 2Y4UA 5H9CA 1NS1A 5L3FA 1N34B 1NR1A 2CH7A 1VQ8V 3TXSA 3RYIA 2QWQB 3JAWA 2P67A 2ZDIC 4B3TB 1F4MA 4FM0A 3SPJA 4CZZA 2AZ0A 1I0HA 4PA4A 2WA4A 1B06A 4QGPA 5BR8O 3OTFA 4X64B 2XOKG 4K8XA 3QF7A 3B09A 4UV9A 3RFRA 5GTHZ 4LF5B 3K0DA 1URFA 3VOUA 4B3MO 5CBFA 2FYUH 3AG3B 1SQBH 1EM1A 4XBFA 3H1IH 1R6TA 3OMAB 2P22C 3JD4A 3ZMSA 1JFFA 3CC7V 4DV7B 3RBZA 1N0JA 3K79A 4L8JA 4DK1A 3LUTB 1OCRC 5GONA 4XDJA 5J2UA 4JI8O 4O4IB 3BY6A 2GBOA 2B1GA 2JIZG 1L8DA 5CA0A 1JJOA 5LXTB 5ITZB 1H8EG 5DEDA 1I94B 3CCQV 1GAXA 1NZ6A 3T1YO 1S5LZ 3E89A 5EZYB 2P4VA 4IYIA 5JJJB 1FFXB 1MOFA 5DM6V 3JALA 1VIBA 2ODMA 3L72H 2YIAA 1JPXA 3GWKC 4MVQA 4WFHA 1SRYA 3OEEG 4I55A 2ETNA 4DR2B 5FPRA 1BSMA 5K1PA 1ZSPA 3ABLC 2QWPB 2W0FC 1VQ4V 1AB3A 5LHHA 1V54B 4X1KA 2MK3A 1EZJA 2YICA 3ZN1A 1WB7A 3ETGA 5LP6A 4GKJB 4EB6B 1GN6A 3JARB 4O4HA 2LJ2A 3VQWA 1K7DA 3X2QC 3K57A 1ZL8B 1OV9A 2Y0PA 1GM8A 4FJCC 2DYRC 2C2AA 2DJVA 1PNLA 3AG2B 1AJNA 1BQ0A 4LFAO 3ZRWA 3W7SA 1OCZC 3N2KA 1WA8A 3DGEA 3CCRV 4NXMB 4WFFA 2HVKC 2PI5A 3CMEV 4GKKB 1YJWV 5BR8B 2UUCB 4NB5A 1RPRA 2BTQA 1YVWA 4FLVA 5EIBD 3HB3B 3RVYA 2JEUA 5EYPB 4UCTA 3BEHA 3T1HB 2GUZB 3B8MA 3B2EE 3K3WA 5KHJA 2G38A 3L71H 4X1YA 1IBMO 4JI3B 5B3SC 1XL4A 1OCOB 4PHZA 1WAZA 4Q20A 2F66C 1YJ9V 1GM7A 3CEIA 3D8CA 4QIWF 1K73W 2N04A 3G67A 2PI4A 4DV4B 2E3CA 3MD0A 4BIZA 1VF7A 3P32A 2QE7G 3ZHSA 3CRAA 4PD4F 4JI0B 2UXXA 3ZMTA 4AHCA 2VRZA 1Y74A 4MSWC 1R73A 1GRJA 1JCHA 1U96A 2W6IG 1S0VA 2WWWA 5CBGA 3QO7A 2PZSA 5KHHA 3R65A 4X65O 2VQFB 2QWNB 3E22A 4D6TH 1K33A 3APOA 4GX5A 3BA9A 4BWAA 1LUWA 2P7TC 4E2LA 3HKCB 3A8TA 1OZ0A 4I4TA 3JSNA 4MVSA 4LR3A 3JASA 3E8FA 5KAFZ 2A06H 1BHBA 4N21A 3HKEB 4WFAV 3OUSA 1FJGB 1NTMH 2JJ1G 5JVDB 4I5SA 4O2AA 4FLXA 4RQFA 4J9ZB 1NVPD 1AJPA 1R3KC 4MVRA 1DK1A 1XEQA 1F51A 3RYHB 4CC6A 4DV1O 1GN2A 2AHYA 1YJNV 3HKDB 1CPYA 2ZE6A 5CA1A 4IYHA 5L3DA 2Q73A 1TUBB 2FB5A 1AR5A 2OCCB 3U11A 4JAAA 4UCUA 3G71V 2DE0X 3CXCU 4O4JB 4NKGB 2DQ3A 3G4SV 3B77A 2L6LA 2DOSA 2XAHA 5A2QN 1VARA 2LFSA 1ZX3A 2BE3A 5LMUB 2ZT9B 4B7EA 1DF5A 4I0XA 1RFYA 3OR6C 4J7JA 2Q6AA 4DR6O 2UU9B 4LFBO 1HNXB 4BAYA 2YC0A 2CTRA 3KKYA 1NQTA 1TVKA 2QGNA 1BGYH 4F6RB 4AQYB 4DR7O 5LMNO 4PDRA 2QR4A 5B1AB 3GWOA 4TV8B 2QM8A 2QTOA 5LXTA 5IYBO 1AP6A 4LF4B 4MT8A 3ABLB 3I56V 5E79Z 4LWSA 3K5OA 5L3CA 4FZ1A 3LDDA 5KAIZ 1YDXA 2YXLA 4CS4A 1R6KA 5KX5A 3CRQA 1WN7A 4DW0A 3P3PA 1Q5OA 4IIJA 3JATA 3THOA 2JS5A 1KYOF 2XAFA 3NR7A 2IH1C 5CB4B 4JI4O 4TUYB 3X2QB 5CA3A 1QLEB 2Q7EA 3MHHC 2Q68A 1SS3A 3M99B 1N36B 1BQZA 1ORQC 4J9YB 3SYPA 3ZHQA 1ZL8A 2Q0AA 4QJFB 4GLXA 2OCHA 2WLJA 4R50A 1IBLO 3O9OA 1F23A 3FYIB 4LFCB 4DV6B 4GX1A 1B3QA 3WB1A 1NU1H 2ZM6O 4PI2A 4DV3O 3AG3C 3T2MA 1OJHA 5JH7B 1Y66A 3K03A 4O2BA 4UB8Z 1AROP 4EFEA 1K3EA 1XMOB 1N33B 5IJ0B 2LQTA 4ZI7B 2ITDC 2IBZH 2WPDG 2RDCA 1YSCA 3K5MA 4KHPO 2R72A 4DUZO 2XAGA 1IXBA 5IYZB 1KC8W 1L0NH 4NTWA 3ETEA 2QTSA 3UO2A 4KXRA 2ZIMA 3HPLC 2IJJA 3BABA 4YXWG 4HYOA 4JPRA 2M7WA 1WP8A 4DR7B 1F4NA 1AI7A 2EIKB 1P7GA 3ZMUA 3FB5C 2NR5A 1XBLA 3TXQA 3RW0A 3CJHB 1N34O 3ZRVA 3ZJZA 3OW2U 3CSXA 1Q86W 4J7KA 1FXHA 1GMGA 2EX3A 2Q7HA 4F4LA 1B6QA 4UB6Z 4B3TO 2X6AA 5KMGA 1VF6C 2KKWA 1VQ5V 2LFRA 2FMLA 1K5SA 4X64O 5KUMA 1XMQB 1Q82W 1M1KW 4I9QA 2Q8VA 4LF5O 2ZDIA 3WG7C 4I50B 5L3GA 3RN4A 1H38A 5KHKA 2EJ7A 2IJKA 3OT7A 3JCZA 3Q4HB 1JVMA 1YTFD 1I5YA 3BAAA 3AG2C 4HNAA 3SJAC 3H1KH 3EVKA 5J9PC 5KUKA 1OHHG 3A0HZ 1CEZA 2V4DA 4DV7O 2K1EA 1GN4A 3J80N 3H1HH 4JI2B 4B3RB 3OM3B 3P3NA 3WB2A 4DK0A 1AJQA 1DF4A 4ZHQB 3HR0A 4KUMA 3CCUV 1I94O 3ZN0A 1JJ2U 1OCOC 3DSQA 4X20A 1S5JA 2DWDC 3ZCCA 1YEWA 2JDIG 4P9OA 4CS2A 1BHAA 5A9GA 1Y76A 4Z1VA 4GX2A 5IJ9B 4DR2O 2X6BA 2HG5C 5FPOA 4DV5B 4IGGA 4YHHB 5JJEB 2XTAA 2NN4A 1VQOV 3K08A 1LR1A 2XAQA 4JAUA 4CH4A 4DV2O 1R3IC 4FLYA 4JI7B 2Y69C 2YS8A 4GKJO 3F5WC 3JD2A 1QQCA 1MNGA 4MTXA 2ADPA 1ROPA 3BFRA 4C7UA 2CAZC 2KG7A 5LBQA 2PTMA 1AI6A 2PUSA 3CWBH 4J42A 1VMGA 1VEWA 4TUYA 1M90W 2ADQB 4NXMO 2QKSA 2ATKC 2BTOA 4GKKO 2OWOA 1Q81W 2UUCO 1SESA 2E5LB 3J81N 3KG2A 1EN5A 3ZRSA 2WLHA 4X88A 4X1IA 3FB8C 2CE4A 3T1HO 4FLWA 1FPOA 1YF2A 1W59A 4MW8A 3WU2Z 2OCCC 4JV5B 4JI3O 4JTDB 4LNUB 1M57C 1XI1A 2JVDA 2EIMB 2V7QG 3T1CA 4TT3G 1XHXA 2ZR3A 5EBWC 2LP7A 1NH2D 3IAYA 3CX5F 4DV4O 1VF5B 1DTOA 1N0NA 2N74A 3K0GA 2QA4V 1WPXA 4IHJB 2UXCB 4JI0O 2YI8A 1QU7A 4FLZA 1IVSA 1Q90D 5LGTA 3OAAG 4EFBA 2EULA 4PJ0Z 2VQFO 4DYLA 2OIEA 4X89A 3R66A 5IYZA 4RUEA 4DR5B 3JAKB 2PY5A 5B1AC 2CDYA 1Q6UA 4X66O 3DXRA 2XAJA 4NXNO 1BMFG 2F4VB 2YEVA 4MVZA 1GN3A 3OEHG 1Y6XA 1SA0B 3C3TA 4B7KA 1FJGO 1THZA 1D2DA 4KFMA 4JI1B 4K8ZA 1HW7A 4PA6A 1PM9A 5IDJA 4LF8B 2IJHA 4DV2B 2ZCEA 3ZRXA 5KHGA 3WG7B 3OGIB 3APQA 4TOIA 5FNVA 3BVOA 3F5TA 4CH3A 5BXZA 1GKFA 4P2ZA 1QLEC 3NXSA 3IGAC 1DLBA 1YI2V 4K3AA 3E35A 1R3JC 4UVAA 5BMVA 3LNMB 3W7WA 2WLIA 1UPGA 4P9PA 1U97A 4TV9A 2WLLA 1QLNA 5EBMC 3CRMA 2W0XA 3SYQA 5LMUO 5B5EZ 3Q4HA 1PD3A 3CD6V 1NTKH 1H2LA 5LYJB 2YIBA 4LF7B 1YCIA 4CH5A 3RWRD 2UU9O 1HNXO 1SQFA 2CGNA 1AR4A 1L1FA 2BCCH 3T4DA 1QVGU 5F2VO 1CXZB 4U7NA 4AQYO 4H13B 4DXWA 4OPAA 1KB9F 1KMIZ 4PA3A 2XT9A 4FFBB 4DRXB 1I5XA 1HNZB 5H6QA 4LF4O 4BIOA 1N32B 1G8MA 4R8CA 3N2GB 2Q67A 4LF6O 2X7RB 5J2TB 4OX9O 4Q6GA 2E76B 1Y4MA 3GB7C 2JGDB 5K1XA 4DR3O 2CUGA 2Y69B 2EILC 4DR1B 4WF9V 3CP1A 3OD4A 2EIKC 1N4CA 4PDLA 4YY3O 2VWKA 4QE7A 4FLTA 2LO1A 4AILC 1KU9A 4X66B 4WBNB 3UM7A 4GX0A 4NXNB 1N36O 1R3LC 1IDSA 3LSUA 1FAFA 2PF4E 4KL1A 2N05A 3TGUH 2JK5C 1PV0A 4J7ZA 3STLC 2RJZA 1XREA 3D36A 5LOVB 4LFCO 3U0ZA 4DV6O 2UXDB 2RQ6A 3DTUB 2P4KA 3UT5B 1T5EA 1X4TA 4UUJC 1GK9A 1M57B 4JASA 2D3OW 2YXYA 2ZNJA 1FYJA 2GTSA 3DC6A 1WPBA 5IWAB 1DGSA 2CTWA 2YIDA 3JD3A 2WLMA 1XMOO 1N33O 2HLDG 1R6NA 3SPHA 4UCSA 4GYCB 4JI5B 1MA1A 5C8YB 4DR4O 3OMNB 1N8RW 3OR7C 5B1BC 2AGAA 1WNSA 5B1NA 4LNUA 2X0LA 1QR9A 2GHYA 3ZMVA 4DUYB 2A9HA 3SJQC 1YXBA 2A7WA 4NVPA 3K59A 1M5IA 2PYJA 4FIPC 1Q6HA 3O65A 4O4IA 1Q43A 2F93B 2B5UA 5ITZA 1JA8A 4Z1MG 3SJCC 3LDEA 3LSQA 4LF6B 2CTQA 1UJWB 2QSAA 5EZYA 4OX9B 2Z3YA 1FFXA 2LGWA 4DV0B 2M6YA 1M56B 4DR3B 2QKCA 3QVNA 4JYYA 3CCMV 3B40A 2PGGA 3VQXA 1MG1A 4YY3B 1XMQO 2ZE8A 1SQPH 1PL4A 5JCOC 2Z5UA 4F6EA 3ZBHA 3SPIA 3G80A 1VF6A 3OE7G 3TJTA 1K92A 1SQGA 2CH7B 4NR1A 4JYCA 2ITCC 3UQ8A 1JX9A 4EB6A 1IBKO 1S72V 3JARA 2VQEB 3RYIB 2OYQA 1K8AW 2H8PC 2WAMA 1P49A 1O9HA 4JI2O 4B3RO 3AG1C 1GO3F 2BSKB 3H1LH 1H2MA 2DWEC 3DC5A 3ZHVA 3K9AA 3KCYA 5EYPA 1QCEA 2L35A 3B4SA 2OT5A 2GUZA 3CCEV 5H5NA 2EIMC 2CTPA 5IYCO 1JFFB 1WLEA 3OGCC 1NKDA 1SC5B 1D5NA 2ZE7A 4DR4B 1JMKC 2Q69A 4CBCA 4JI6B 4LC1A 3L74H 5GONB 3SJBC 1PNKA 1I7FA 2DW4A 3UO3A 4DV5O 1BE3H 4YHHO 5CA0B 5H6RA 4D7TA 4X62B 3CPWU 5AG2A 4FFBA 1ZAUA 1Q6IA 2EILB 4OGQB 4DRXA 2UUAB 4CC5A 2B1IA 3BPZA 4JI7O 3JALB 3VBBA 4GZRB 1K9MW 2EZPA 3ABKC 2OTLV 4JTCB 4MTOA 1EBOA 3FYEB 1R1BA 4HBNA 2JGDA 4I55B 2LW1A 1RPOA 2WLNA 3HKBB 3OMIB 2GV9A 4UCVA 4X1KB 2ARHA 4PDMA 1PKXA 4MVMA 4FMTA 4OPHA 2RNBA 2YXHA 2BOBC 2CGOA 3HKCA 3PN1A 3ZX6A 3BRCA 1ZTEA 3IC7A 2E5LO 3A0RA 4MW3A 2Q5ZA 1Q8IA 3CYOA 5LP6B 3N27A 4MTGA 4B08A 4O4HB 1XHZA 1HDJA 1J95A 3HKEA 4YIOA 3CXHF 3GVMA 1RM1C 5JVDA 4RQEA 2OIGA 5B66Z 2H94A 4JV5O 1IBKB 5D5PA 1MZEA 3RYHA 4NYKA 3N2KB 3JD1A 1WA8B 3HKDA 1SQVH 1FXKC 3VQVA 1VQPV 2DMXA 1AP5A 1SQQH 1TUBA 3UT5A 2BTQB 2ZINA 4TSFG 3AK2A 5B1BB 1SQXH 1MABG 4O4JA 2F23A 3L70H 3RYCB 1ZWIC 3MHSC 1B04A 2NNUA 2UXCO 4JYAB 4CS3A 1M9NA 1XDCA 4A5UB 1BL8A 1HNWB 1AI4A 1G1XB 4G2KA 4X1YB 4UV8A 4H0LB 5C8YA 4JZ2A 4FK5C 4G28B 4K0KB 5BY1A 1YZBA 4JGSA 2EJRA 2QM4A 4DR5O 3SGIA 3TCUA 4DO2A 3QG5A 5CBHA 5FLXN 2Q7GA 3K5NA 5IT9N 4ICGA 2F4VO 2QDOA 4L87A 4NTXA 4UFZA 1KECA 4F6RA 3K04A 1XL6A 3SDLA 3KCXA 2XHBA 4Z2WA 1YITV 2EZOA 2F43G 1Y74B 3STZC 2KSDA 4OXSA 4TV8A 5E1AC 3LNNA 1UFIA 1K5QA 1OCCC 4JI1O 5HFMA 2YUAA 4LF8O 3E22B 3SYOA 1A32A 1EN4A 1COWG 2JGUA 1J5EB 2X6CA 2RMKB 3CRCA 4I4TB 1XQ8A 4GUNA 3JASB 3ZHUA 5CB4A 3L73H 2GSMB 3E2EA 3H01A 4R7CA 4MS2A 4MVUA 2Y0IA 2YIBD 4O2AB 3JCUZ 4DW1A 3FD9A 2YI9A 1S3JA 1TAEA 2XUMA 3U10A 1MSDA 1Y67A 2ZIOA 2GTAA 3E8HA 3AG1B 1PPJH 3IFXA 1SERA 5CA1B 5D5QA 1KKCA 4QNHB 4LF7O 3JSLA 2HKOA 4O4LB 3AG4B 2JS3A 2DYSC 1NI8A 3ICXA 1K4CC 1P4RA 3ABUA 3CMAV 2IW5A 3PJSK 1IX9A 2HHHB 2BSKA 4LF9O 2E74B 2LW7A 2IU0A 4J41A 4ZOLB 5KA5A 1HNZO 5JH7A 3TK1A 3ZMZA 1N32O 4I0XB 5L3BA 4RO2A 2VWJA 2R9AA 3K5LA 5IJ0A 2ILMA 5IY5B 4ZI7A 3CE2A 2A79B 1XNRO 1X59A 4PELA 3LDCA 2RN9A 2GDSA 1XNQO 1TVKB 4HAMA 4DR1O 3CC2V 5JQGB 1JQ0A 4ASUG 1NR7A 3ABKB 4YJ3B 2QEXV 4BR6A 2JRIA 3OTOB 5DN6G 1K34A 1V55C 2KB1A 3ASOB 1V9PA 3G6EV 1AVMA 1QHTA 3FKSG 3JD0A 1KKDA 4EKWA 4LWSB 1VQ9V 1TUEB 4HZ3A 1H8HG 1TGOA 2WA3A 5LHGA 2Q4PA 1RSOB 1GTOA 4BW9A 1NJIW 2ZD9A 3ETQA 1PL0A 3SYCA 1M56C 5KX5B 3CJHA 3ABTA 4IIJB 4P30A 2UXBB 3JATB 3HKBA 5KLVH 3CCLV 1FS0G 4ZBMA 1RM1B 3MDSA 4TQDA 2R9RB 4G27B 3K58A 3F7VC 2XASA 2UXDO 1IXMA 4UXNA 3ZHRA 3CCVV 3CS5A 1HR0O 5LL6Y 3FAVB 3C3SA 1FXKB 3H1JH 5IWAO 4I50A 4FVMA 2EIJC 2ZKOA 3LSSA 1VQNV 4JI5O 3SYAA 2EINB 1QR8A 2BOCC 4GT1A 2K9PA 4U3JB 4J11A 1Z5WA 4DUYO 2Q9LA 1NVPB 4H37A 2VS0A 3E8GA 3FX7A 3ABMC 2QWOB 3RYCA 3IC9A 5DECA 4O2BB 4UVBA 4FFKA 1XOUA 4B3MB 4LF9B 2FTKA 4ZHQA 1SETA 4NTYA 1L0LH 4QPJA 2UUBO 4YJ2B 2HP8A 3CB2A 1SZTA 2ZXWC 4FZ0A 1OCCB 3I55V 2Z0AA 1XNRB 4DV0O 1WP7A 2KQXA 3W7XA 4JZGA 4FM1A 3FB7C 1XNQB 1CP9A 3ZIAG 1LUVA 5IJ9A 2AHZA 2O57A 2HVJC 2YSUB 4JI8B 4FPPA 3TETA 3K9SA 5B1OA 5EK0A 4X8AA 1E1QG 4WFBV 1YHQV 2HFEC 3A2FA 2DQ0A 3T1YB 4PI0A 3CCJV 2F95B 2R9IA 2IH3C 1FXVA 1D5AA 2VQEO 1QVFU 5JCOA 4TWKA 4XDKA 4PDVA 5L3EA 4PA9A 4UVCA 5KMGB 4LH7A 4IL6Z 2ZQMA 4J80A 5IYDO 3OFNG 3W7UA 5LP6C 2DN9A 3UKMA 3MAQA 1HR0B 2LGQA 2DYSB 3AG7A 1RP3B 1FD9A 5FL7G 1P7BA 1M4UA 4HNAB 5LA6B 3QO8A 3T4ZA 2ZR2A 3CRRA 4ZKIA 4O4LA 2P06A 1W2BU 4LFAB 1Q3EA 4JI6O 2JJ2G 2R70A 4FLUA 4QE9A 1W0JG 2IM9A 3QTCA 1SF9A 3QNEA 1S5HC 3L9DA 4TQFA 1KD1W 1P84F 4I9WA 4LP8A 4PV1B 5TISZ 4X62O 3VQYA 3J7AU 4ZOLA 1OCRB 2P5OA 1IURA 2UUAO 1JR9A 4LCUC 4X20B 4IHJA 4MVOA 5EC1C 3ZEDA 1V55B 1S76D 1E1RG 3ASNC 1IBMB 1VP7A 3RGBA 4RWUA 1Y76B 4PA7A 2UUBB 1MZFA 1VQLV 2P6JA 1MMMA 3ML0A 2F1MA 3IJ4A 4UCOA 3AEIA 5JQGA 3L75H 4UCRA 3JAKA 2ZNIA 3S3WA 2Y4TA 3FFQA 4YJ3A 3CHXA 4YIPA 2AW9A 5IE9A 1JOYA 1XUQA 1FKAO 1H2GA 3ETDA 3P30A 4W4KA 2QJ1A 3UCSC 1XILA 3BCCH 4EEQA 3W7TA 2AXTZ 1SA0A 2EBOA 5HFLA 3RT3C 2YDEA 3RYFB 1RSOA 4LH6A 3SPCA 3F7YC 2P90A 4BW5A 1F7YA 3EHBB 1NBMG 4X65B 2PYLA 5BZBA 2KG7B 4MTFA 1PNMA 3JAWB 2H3OA 2QWRB 3M8AA 2EIJB 4LBEC 5EC2C 1ENVA 2DYRB 5H2FZ 3AK3A 1WJZA 1BT8A 3FAVA 1M93A 1OCZB 4X1IB 4CH6A 3D36C 1FXKA 1SZXA 1KP3A 1VQMV 5LGNA 4JYAO 3EXAA 3AK1A 1K4DC 1HNWO 1BCCH 1HWYA 3ABMB 3AG4C 1IZ3A 4DV1B 1EZVH 1HP8A 4WCEV 4U3JA 4K0KO 5LYJA 3BA8A 5JJNB 3WFVA 1YTFB 5B3SB 3CC4V 2NLJC 1W0KG 3ZHTA 2A0LA 2ZXWB 5J2UB 3D3IA 1H2SB 1KQSU 1FFTB 1NT2B 5EIBC 5IY5C 5LHIA 1YIJV 1H2NA 4XDLA 4B3SO 1VQ6V 3N2GA 3KZIZ 4YJ2A 3JAMN 5J2TA 5JWPA 1GM9A 5KHIA 4WFEA 2UXNA 4DR6B 1J5EO 4LFBB 2HJFC 2E75B 4QPKA 2IU3A 3DXRB 3ASOC 2YEVB 5LMNB 1KUQA 4BIUA 1AI5A 4WBNA 4N23A 1BS3A 1GH6A 2QKAA 2IJIA 3I5DA 2XNDG 3E8BA 3E86A 2QM7A 5FNVB 2W6JG 4KP4A 1PP9H 1ZUQA 1V54C 3B8NA 4RAIA 1BZKA 1QBZA 5BMVB 4R6ZA 3EFFK 3CCSV 4GCZA 2Q0OC 4J10A 2HEPA 3ZRWB 1S77D 4JYBA 2WLIB 5C93A 5LOVA 4JI4B 1AILA 1Q7YW 1KBHA 1O9GA 2FKXA 3QO5A 4TV9B 2WLLB 2HHHO 4JTAB 2WSSG 2Y48A 5CMUA 2OTJV 1I08A 4RUFA 2HJDA 2JEXA 4K35A 2MW2B 1LNQA 2EINC 5KA6A 2RCVA 5LA6A 5GW7A 1MSWD 2WLKA 4U7OA 3A0BZ 2CK3G 1WB8A 1H2KA 2AZ2A 4I7ZB 3BHPA 3JYCA 4ABMA 1SKVA 5CN0A 5GTIZ 4E4EA 1IBLB 1G6UA 4JAVA 4JF3A
chains in the Genus database with same CATH topology
2WLJA 3ASOB 4R50A 3G6EV 4WFGA 3FKSG 3ASNB 3JD0A 1KKDA 1F23A 3FYIB 4EKWA 1VQ9V 2JK5C 1KP2A 1TUEB 4GX1A 4HZ3A 3STLC 1G4YB 1H8HG 5LHGA 1K97A 1GTOA 4H33A 5LGUA 1NJIW 2ZD9A 3D36A 1PL0A 3SYCA 1M56C 3AG3C 3T2MA 1NH2B 3ABTA 3DTUB 4P30A 5EBLC 3OUFA 1Y66A 3K03A 3CCLV 1FS0G 4ZBMA 1RM1B 1AROP 4UUJC 1GK9A 2R9RB 4G27B 1K3EA 3F7VC 1M57B 2XASA 2V1DA 1IXMA 4JASA 4UXNA 2D3OW 3E83A 2ITDC 3CCVV 1EFRG 2HR3A 1VQKV 2WPDG 3JD3A 3K06A 2WLMA 1YSCA 2HLDG 1R6NA 3SPHA 2XAGA 1FXKB 1KC8W 3OMNB 1N8RW 3OR7C 1E79G 5B1BC 3RVZA 3ETEA 2EIJC 5B1NA 3SPGA 3LSSA 3HPLC 1VQNV 2IJJA 2X0LA 3FB6C 1QR9A 2GHYA 3SYAA 3ZMVA 2EINB 1AR1B 1QR8A 2BOCC 4YXWG 4HYOA 4JPRA 1VQ7V 2M7WA 4GT1A 2A9HA 1F4NA 5H9CA 1AI7A 2EIKB 3SJQC 5L3FA 1NR1A 3ZMUA 3FB5C 1NVPB 4FIPC 1VQ8V 4H37A 3RW0A 3ZRVA 3ZJZA 2P67A 2ZDIC 3E8GA 3OW2U 3ABMC 1F4MA 3SPJA 2B5UA 4CZZA 1Q86W 1FXHA 4PA4A 4Z1MG 1GMGA 4UVBA 3LDEA 3LSQA 2XOKG 4F4LA 1K34A 1B6QA 2FTKA 1UJWB 1SETA 2X6AA 2Z3YA 4UV9A 3K0DA 3VOUA 4QPJA 1VQ5V 2LFRA 1K5SA 5KUMA 5CBFA 1M56B 3AG3B 1SZTA 1Q82W 1M1KW 2ZXWC 2ZDIA 3WG7C 1OCCB 3I55V 5L3GA 3CCMV 4XBFA 1H38A 3W7XA 1MG1A 2IJKA 3FB7C 3JCZA 3OMAB 1YTFD 1JVMA 1CP9A 1I5YA 3JD4A 3ZIAG 3ZMSA 2Z5UA 3AG2C 2AHZA 2HVJC 3CC7V 2YSUB 3SPIA 5J9PC 3RBZA 1OHHG 4FPPA 5KUKA 3OE7G 3TETA 1K92A 5B1OA 5EK0A 4X8AA 3K79A 3LUTB 1OCRC 4JYCA 1CEZA 4XDJA 2ITCC 1E1QG 1JX9A 4WFBV 2HFEC 1YHQV 2DQ0A 1S72V 3CCJV 2K1EA 3BY6A 2B1GA 2JIZG 1K8AW 2R9IA 2IH3C 1FXVA 1H8EG 3CCQV 2H8PC 2WAMA 1QVFU 4TWKA 3OM3B 4XDKA 4PDVA 3E89A 5L3EA 1AJQA 1DF4A 4PA9A 4UVCA 1MOFA 4KUMA 3CCUV 5DM6V 3AG1C 3ZN0A 2ZQMA 1GO3F 1JJ2U 1JPXA 1OCOC 5IYDO 3OFNG 3W7UA 4MVQA 4WFHA 3UKMA 2DWEC 2DWDC 1SRYA 3K9AA 3ZCCA 3OEEG 2JDIG 4P9OA 1QCEA 2OT5A 3ABLC 1BHAA 2W0FC 3CCEV 2DYSB 1VQ4V 5LHHA 5FL7G 1P7BA 2EIMC 1V54B 5IYCO 4GX2A 1WLEA 2MK3A 3QO8A 3OGCC 1EZJA 1NKDA 2X6BA 2HG5C 3T4ZA 2Q69A 3ZN1A 2ZR2A 4CBCA 4LC1A 3ETGA 1VQOV 3K08A 1PNKA 4ZKIA 2XAQA 2DW4A 1W2BU 1K7DA 4JAUA 3X2QC 2JJ2G 5H6RA 1R3IC 4QE9A 1W0JG 2Y69C 1GM8A 4FJCC 2DYRC 3CPWU 2C2AA 1PNLA 3F5WC 2EILB 3AG2B 3JD2A 3QNEA 1AJNA 1S5HC 2B1IA 3ZRWA 1KD1W 4I9WA 4LP8A 3W7SA 1OCZC 4MTXA 3DGEA 3CCRV 4WFFA 3VBBA 1OCRB 1ROPA 2HVKC 2PI5A 1K9MW 3CMEV 2EZPA 1YJWV 3ABKC 4LCUC 1RPRA 4MVOA 4JTCB 4MTOA 5LBQA 2OTLV 1EBOA 1AI6A 3FYEB 1M90W 3HB3B 2QKSA 5EC1C 2JEUA 3RVYA 2ATKC 1V55B 1RPOA 1S76D 2WLNA 3BEHA 1Q81W 1E1RG 3ASNC 3OMIB 3B8MA 4PA7A 3K3WA 1SESA 3KG2A 2P6JA 4PDMA 1VQLV 1PKXA 4MVMA 4FMTA 3ML0A 3ZRSA 2BOBC 2WLHA 4X88A 3FB8C 3AEIA 5B3SC 1XL4A 1OCOB 3IC7A 3A0RA 4MW3A 3CYOA 4MTGA 4Q20A 4MW8A 2OCCC 1YJ9V 1JOYA 1J95A 1GM7A 1H2GA 3ETDA 4QIWF 3P30A 4JTDB 1K73W 1RM1C 4RQEA 1M57C 2PI4A 2EIMB 3W7TA 3MD0A 2V7QG 4BIZA 3T1CA 4TT3G 2H94A 2EBOA 5HFLA 3P32A 2ZR3A 5EBWC 2LP7A 2QE7G 3SPCA 1NH2D 3F7YC 2P90A 4BW5A 3JD1A 3EHBB 1NBMG 2UXXA 3ZMTA 1FXKC 1VQPV 5BZBA 1DTOA 4MSWC 1R73A 3K0GA 1JCHA 2QA4V 1WPXA 2W6IG 1S0VA 2WWWA 5CBGA 4TSFG 3QO7A 4MTFA 1PNMA 5B1BB 1MABG 3R65A 2EIJB 4LBEC 5EC2C 1ENVA 1ZWIC 2DYRB 1K33A 4GX5A 3MHSC 5LGTA 3OAAG 2NNUA 1M9NA 2P7TC 4E2LA 1OCZB 1BL8A 1OZ0A 1AI4A 4X89A 4G2KA 1FXKA 4MVSA 1KP3A 4RUEA 4UV8A 1VQMV 5LGNA 3E8FA 5B1AC 4FK5C 4G28B 1K4DC 4JGSA 1BHBA 1HWYA 2EJRA 4N21A 3ABMB 3OUSA 3AG4C 4WFAV 2XAJA 2JJ1G 4I5SA 1BMFG 2YEVA 4MVZA 3OEHG 3TCUA 4RQFA 4J9ZB 4WCEV 1NVPD 1AJPA 1R3KC 4MVRA 4DO2A 5CBHA 1THZA 1F51A 4KFMA 3WFVA 4L87A 1YTFB 2AHYA 4PA6A 1KECA 1YJNV 3K04A 1XL6A 5B3SB 1CPYA 5IDJA 2IJHA 2NLJC 1W0KG 3CC4V 5L3DA 1YITV 2EZOA 2A0LA 2F43G 3STZC 4OXSA 5E1AC 1K5QA 1OCCC 2ZXWB 2OCCB 3ZRXA 5HFMA 3WG7B 3G71V 3D3IA 1KQSU 3CXCU 1GKFA 4P2ZA 1QLEC 3NXSA 3IGAC 2DQ3A 3SYOA 1DLBA 1FFTB 3B77A 3G4SV 1YI2V 5IY5C 5LHIA 3E35A 2XAHA 4XDLA 1YIJV 1R3JC 4UVAA 1COWG 3LNMB 3W7WA 1VQ6V 2X6CA 2WLIA 4P9PA 2LFSA 1GM9A 4WFEA 2UXNA 1DF5A 2WLLA 1QLNA 5EBMC 2GSMB 2HJFC 3E2EA 3OR6C 3H01A 4QPKA 2IU3A 3SYQA 4R7CA 1PD3A 3CD6V 3ASOC 4MS2A 4MVUA 2Q6AA 2YEVB 4BAYA 1S3JA 4BIUA 1AI5A 1NQTA 4N23A 3E8HA 3AG1B 3IFXA 1SERA 4PDRA 5B1AB 2IJIA 1L1FA 3GWOA 4QNHB 2QM8A 3T4DA 1QVGU 2QTOA 2XNDG 4U7NA 2HKOA 3E8BA 3E86A 2QM7A 3AG4B 5IYBO 2W6JG 4KP4A 2DYSC 4DXWA 4MT8A 3ABLB 1V54C 3B8NA 4PA3A 4RAIA 1K4CC 3I56V 1P4RA 1QBZA 3ABUA 3CMAV 2IW5A 4R6ZA 5L3CA 3EFFK 3CCSV 4GCZA 1I5XA 5H6QA 3LDDA 3PJSK 1G8MA 3ZRWB 4R8CA 1S77D 4JYBA 2Q67A 2WLIB 5C93A 2X7RB 1Q7YW 2IU0A 1R6KA 5KA5A 3QO5A 1Y4MA 2XAFA 2WLLB 3TK1A 3ZMZA 2IH1C 3GB7C 4JTAB 2WSSG 5L3BA 2Y48A 5CMUA 3X2QB 4RO2A 2OTJV 5CA3A 4RUFA 1QLEB 2JEXA 2Y69B 1LNQA 3MHHC 2EILC 2EINC 2Q68A 5IY5B 5KA6A 4WF9V 2A79B 3CP1A 3M99B 5GW7A 1MSWD 2WLKA 4U7OA 2EIKC 4PELA 4PDLA 2CK3G 3LDCA 4QE7A 3JYCA 4HAMA 5CN0A 3CC2V 1JQ0A 3UM7A 1ORQC 4GX0A 4ASUG 1NR7A 1R3LC 3ABKB 4J9YB 2QEXV 3SYPA 4JAVA 4JF3A 5DN6G 4QJFB 1V55C 2KB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S V;  3CCE V;  3CPW U;  3CCQ V;  1Q81 W;  1VQ4 V;  3G6E V;  1QVF U;  1YI2 V;  2D3O W;  3I56 V;  4WF9 V;  1YIJ V;  4WCE V;  1VQ7 V;  3CC7 V;  3CCV V;  1VQ9 V;  3CD6 V;  3CMA V;  1VQL V;  3CCS V;  1VQK V;  1KD1 W;  3CCU V;  5DM6 V;  1VQ6 V;  3CCR V;  1NJI W;  1VQ5 V;  1YJN V;  3CC2 V;  1Q7Y W;  1JJ2 U;  1VQP V;  3CC4 V;  1K9M W;  3CME V;  1VQ8 V;  1VQM V;  1VQO V;  1YHQ V;  4WFB V;  1R73 A;  1YIT V;  1YJW V;  1S72 V;  1Q82 W;  1M1K W;  2QA4 V;  1KC8 W;  1K8A W;  2OTL V;  2QEX V;  3CCJ V;  1N8R W;  1YJ9 V;  1W2B U;  3I55 V;  1QVG U;  3OW2 U;  3G71 V;  1M90 W;  4WFA V;  3CCM V;  1K73 W;  1KQS U;  1Q86 W;  2OTJ V;  3CXC U;  3CCL V;  1VQN V; 
#chains in the Genus database with same CATH topology
 3ZS8 C;  3H9V A;  3SR2 C;  4WFG A;  3ASN B;  4IT5 A;  2ZM6 B;  4DV3 B;  2ZE5 A;  3OTO O;  1KP2 A;  2D2C B;  1G4Y B;  1EN6 A;  1K97 A;  5LGU A;  4H33 A;  4ZIB A;  1NH2 B;  5EBL C;  1Z5V A;  3OUF A;  4B3S B;  1NTZ H;  1TA8 A;  4U3F H;  3C90 A;  2B9Z A;  2V1D A;  1US6 A;  1ZLZ A;  4DUZ B;  4KHP B;  2UXB O;  3E83 A;  3G6B A;  1EFR G;  2FL4 A;  2HR3 A;  4FM2 A;  1VQK V;  1QNM A;  4W4L A;  3K06 A;  2A3Q A;  3S3X A;  3WB0 A;  4AI8 A;  3M7M X;  4H44 B;  1E79 G;  3D3Q A;  3RVZ A;  4X9Q A;  3SPG A;  3FB6 C;  1AR1 B;  1VQ7 V;  1Z2G A;  4D7S A;  3RYF A;  2Y4U A;  5H9C A;  1NS1 A;  5L3F A;  1N34 B;  1NR1 A;  2CH7 A;  1VQ8 V;  3TXS A;  3RYI A;  2QWQ B;  3JAW A;  2P67 A;  2ZDI C;  4B3T B;  1F4M A;  4FM0 A;  3SPJ A;  4CZZ A;  2AZ0 A;  1I0H A;  4PA4 A;  2WA4 A;  1B06 A;  4QGP A;  5BR8 O;  3OTF A;  4X64 B;  2XOK G;  4K8X A;  3QF7 A;  3B09 A;  4UV9 A;  3RFR A;  5GTH Z;  4LF5 B;  3K0D A;  1URF A;  3VOU A;  4B3M O;  5CBF A;  2FYU H;  3AG3 B;  1SQB H;  1EM1 A;  4XBF A;  3H1I H;  1R6T A;  3OMA B;  2P22 C;  3JD4 A;  3ZMS A;  1JFF A;  3CC7 V;  4DV7 B;  3RBZ A;  1N0J A;  3K79 A;  4L8J A;  4DK1 A;  3LUT B;  1OCR C;  5GON A;  4XDJ A;  5J2U A;  4JI8 O;  4O4I B;  3BY6 A;  2GBO A;  2B1G A;  2JIZ G;  1L8D A;  5CA0 A;  1JJO A;  5LXT B;  5ITZ B;  1H8E G;  5DED A;  1I94 B;  3CCQ V;  1GAX A;  1NZ6 A;  3T1Y O;  1S5L Z;  3E89 A;  5EZY B;  2P4V A;  4IYI A;  5JJJ B;  1FFX B;  1MOF A;  5DM6 V;  3JAL A;  1VIB A;  2ODM A;  3L72 H;  2YIA A;  1JPX A;  3GWK C;  4MVQ A;  4WFH A;  1SRY A;  3OEE G;  4I55 A;  2ETN A;  4DR2 B;  5FPR A;  1BSM A;  5K1P A;  1ZSP A;  3ABL C;  2QWP B;  2W0F C;  1VQ4 V;  1AB3 A;  5LHH A;  1V54 B;  4X1K A;  2MK3 A;  1EZJ A;  2YIC A;  3ZN1 A;  1WB7 A;  3ETG A;  5LP6 A;  4GKJ B;  4EB6 B;  1GN6 A;  3JAR B;  4O4H A;  2LJ2 A;  3VQW A;  1K7D A;  3X2Q C;  3K57 A;  1ZL8 B;  1OV9 A;  2Y0P A;  1GM8 A;  4FJC C;  2DYR C;  2C2A A;  2DJV A;  1PNL A;  3AG2 B;  1AJN A;  1BQ0 A;  4LFA O;  3ZRW A;  3W7S A;  1OCZ C;  3N2K A;  1WA8 A;  3DGE A;  3CCR V;  4NXM B;  4WFF A;  2HVK C;  2PI5 A;  3CME V;  4GKK B;  1YJW V;  5BR8 B;  2UUC B;  4NB5 A;  1RPR A;  2BTQ A;  1YVW A;  4FLV A;  5EIB D;  3HB3 B;  3RVY A;  2JEU A;  5EYP B;  4UCT A;  3BEH A;  3T1H B;  2GUZ B;  3B8M A;  3B2E E;  3K3W A;  5KHJ A;  2G38 A;  3L71 H;  4X1Y A;  1IBM O;  4JI3 B;  5B3S C;  1XL4 A;  1OCO B;  4PHZ A;  1WAZ A;  4Q20 A;  2F66 C;  1YJ9 V;  1GM7 A;  3CEI A;  3D8C A;  4QIW F;  1K73 W;  2N04 A;  3G67 A;  2PI4 A;  4DV4 B;  2E3C A;  3MD0 A;  4BIZ A;  1VF7 A;  3P32 A;  2QE7 G;  3ZHS A;  3CRA A;  4PD4 F;  4JI0 B;  2UXX A;  3ZMT A;  4AHC A;  2VRZ A;  1Y74 A;  4MSW C;  1R73 A;  1GRJ A;  1JCH A;  1U96 A;  2W6I G;  1S0V A;  2WWW A;  5CBG A;  3QO7 A;  2PZS A;  5KHH A;  3R65 A;  4X65 O;  2VQF B;  2QWN B;  3E22 A;  4D6T H;  1K33 A;  3APO A;  4GX5 A;  3BA9 A;  4BWA A;  1LUW A;  2P7T C;  4E2L A;  3HKC B;  3A8T A;  1OZ0 A;  4I4T A;  3JSN A;  4MVS A;  4LR3 A;  3JAS A;  3E8F A;  5KAF Z;  2A06 H;  1BHB A;  4N21 A;  3HKE B;  4WFA V;  3OUS A;  1FJG B;  1NTM H;  2JJ1 G;  5JVD B;  4I5S A;  4O2A A;  4FLX A;  4RQF A;  4J9Z B;  1NVP D;  1AJP A;  1R3K C;  4MVR A;  1DK1 A;  1XEQ A;  1F51 A;  3RYH B;  4CC6 A;  4DV1 O;  1GN2 A;  2AHY A;  1YJN V;  3HKD B;  1CPY A;  2ZE6 A;  5CA1 A;  4IYH A;  5L3D A;  2Q73 A;  1TUB B;  2FB5 A;  1AR5 A;  2OCC B;  3U11 A;  4JAA A;  4UCU A;  3G71 V;  2DE0 X;  3CXC U;  4O4J B;  4NKG B;  2DQ3 A;  3G4S V;  3B77 A;  2L6L A;  2DOS A;  2XAH A;  5A2Q N;  1VAR A;  2LFS A;  1ZX3 A;  2BE3 A;  5LMU B;  2ZT9 B;  4B7E A;  1DF5 A;  4I0X A;  1RFY A;  3OR6 C;  4J7J A;  2Q6A A;  4DR6 O;  2UU9 B;  4LFB O;  1HNX B;  4BAY A;  2YC0 A;  2CTR A;  3KKY A;  1NQT A;  1TVK A;  2QGN A;  1BGY H;  4F6R B;  4AQY B;  4DR7 O;  5LMN O;  4PDR A;  2QR4 A;  5B1A B;  3GWO A;  4TV8 B;  2QM8 A;  2QTO A;  5LXT A;  5IYB O;  1AP6 A;  4LF4 B;  4MT8 A;  3ABL B;  3I56 V;  5E79 Z;  4LWS A;  3K5O A;  5L3C A;  4FZ1 A;  3LDD A;  5KAI Z;  1YDX A;  2YXL A;  4CS4 A;  1R6K A;  5KX5 A;  3CRQ A;  1WN7 A;  4DW0 A;  3P3P A;  1Q5O A;  4IIJ A;  3JAT A;  3THO A;  2JS5 A;  1KYO F;  2XAF A;  3NR7 A;  2IH1 C;  5CB4 B;  4JI4 O;  4TUY B;  3X2Q B;  5CA3 A;  1QLE B;  2Q7E A;  3MHH C;  2Q68 A;  1SS3 A;  3M99 B;  1N36 B;  1BQZ A;  1ORQ C;  4J9Y B;  3SYP A;  3ZHQ A;  1ZL8 A;  2Q0A A;  4QJF B;  4GLX A;  2OCH A;  2WLJ A;  4R50 A;  1IBL O;  3O9O A;  1F23 A;  3FYI B;  4LFC B;  4DV6 B;  4GX1 A;  1B3Q A;  3WB1 A;  1NU1 H;  2ZM6 O;  4PI2 A;  4DV3 O;  3AG3 C;  3T2M A;  1OJH A;  5JH7 B;  1Y66 A;  3K03 A;  4O2B A;  4UB8 Z;  1ARO P;  4EFE A;  1K3E A;  1XMO B;  1N33 B;  5IJ0 B;  2LQT A;  4ZI7 B;  2ITD C;  2IBZ H;  2WPD G;  2RDC A;  1YSC A;  3K5M A;  4KHP O;  2R72 A;  4DUZ O;  2XAG A;  1IXB A;  5IYZ B;  1KC8 W;  1L0N H;  4NTW A;  3ETE A;  2QTS A;  3UO2 A;  4KXR A;  2ZIM A;  3HPL C;  2IJJ A;  3BAB A;  4YXW G;  4HYO A;  4JPR A;  2M7W A;  1WP8 A;  4DR7 B;  1F4N A;  1AI7 A;  2EIK B;  1P7G A;  3ZMU A;  3FB5 C;  2NR5 A;  1XBL A;  3TXQ A;  3RW0 A;  3CJH B;  1N34 O;  3ZRV A;  3ZJZ A;  3OW2 U;  3CSX A;  1Q86 W;  4J7K A;  1FXH A;  1GMG A;  2EX3 A;  2Q7H A;  4F4L A;  1B6Q A;  4UB6 Z;  4B3T O;  2X6A A;  5KMG A;  1VF6 C;  2KKW A;  1VQ5 V;  2LFR A;  2FML A;  1K5S A;  4X64 O;  5KUM A;  1XMQ B;  1Q82 W;  1M1K W;  4I9Q A;  2Q8V A;  4LF5 O;  2ZDI A;  3WG7 C;  4I50 B;  5L3G A;  3RN4 A;  1H38 A;  5KHK A;  2EJ7 A;  2IJK A;  3OT7 A;  3JCZ A;  3Q4H B;  1JVM A;  1YTF D;  1I5Y A;  3BAA A;  3AG2 C;  4HNA A;  3SJA C;  3H1K H;  3EVK A;  5J9P C;  5KUK A;  1OHH G;  3A0H Z;  1CEZ A;  2V4D A;  4DV7 O;  2K1E A;  1GN4 A;  3J80 N;  3H1H H;  4JI2 B;  4B3R B;  3OM3 B;  3P3N A;  3WB2 A;  4DK0 A;  1AJQ A;  1DF4 A;  4ZHQ B;  3HR0 A;  4KUM A;  3CCU V;  1I94 O;  3ZN0 A;  1JJ2 U;  1OCO C;  3DSQ A;  4X20 A;  1S5J A;  2DWD C;  3ZCC A;  1YEW A;  2JDI G;  4P9O A;  4CS2 A;  1BHA A;  5A9G A;  1Y76 A;  4Z1V A;  4GX2 A;  5IJ9 B;  4DR2 O;  2X6B A;  2HG5 C;  5FPO A;  4DV5 B;  4IGG A;  4YHH B;  5JJE B;  2XTA A;  2NN4 A;  1VQO V;  3K08 A;  1LR1 A;  2XAQ A;  4JAU A;  4CH4 A;  4DV2 O;  1R3I C;  4FLY A;  4JI7 B;  2Y69 C;  2YS8 A;  4GKJ O;  3F5W C;  3JD2 A;  1QQC A;  1MNG A;  4MTX A;  2ADP A;  1ROP A;  3BFR A;  4C7U A;  2CAZ C;  2KG7 A;  5LBQ A;  2PTM A;  1AI6 A;  2PUS A;  3CWB H;  4J42 A;  1VMG A;  1VEW A;  4TUY A;  1M90 W;  2ADQ B;  4NXM O;  2QKS A;  2ATK C;  2BTO A;  4GKK O;  2OWO A;  1Q81 W;  2UUC O;  1SES A;  2E5L B;  3J81 N;  3KG2 A;  1EN5 A;  3ZRS A;  2WLH A;  4X88 A;  4X1I A;  3FB8 C;  2CE4 A;  3T1H O;  4FLW A;  1FPO A;  1YF2 A;  1W59 A;  4MW8 A;  3WU2 Z;  2OCC C;  4JV5 B;  4JI3 O;  4JTD B;  4LNU B;  1M57 C;  1XI1 A;  2JVD A;  2EIM B;  2V7Q G;  3T1C A;  4TT3 G;  1XHX A;  2ZR3 A;  5EBW C;  2LP7 A;  1NH2 D;  3IAY A;  3CX5 F;  4DV4 O;  1VF5 B;  1DTO A;  1N0N A;  2N74 A;  3K0G A;  2QA4 V;  1WPX A;  4IHJ B;  2UXC B;  4JI0 O;  2YI8 A;  1QU7 A;  4FLZ A;  1IVS A;  1Q90 D;  5LGT A;  3OAA G;  4EFB A;  2EUL A;  4PJ0 Z;  2VQF O;  4DYL A;  2OIE A;  4X89 A;  3R66 A;  5IYZ A;  4RUE A;  4DR5 B;  3JAK B;  2PY5 A;  5B1A C;  2CDY A;  1Q6U A;  4X66 O;  3DXR A;  2XAJ A;  4NXN O;  1BMF G;  2F4V B;  2YEV A;  4MVZ A;  1GN3 A;  3OEH G;  1Y6X A;  1SA0 B;  3C3T A;  4B7K A;  1FJG O;  1THZ A;  1D2D A;  4KFM A;  4JI1 B;  4K8Z A;  1HW7 A;  4PA6 A;  1PM9 A;  5IDJ A;  4LF8 B;  2IJH A;  4DV2 B;  2ZCE A;  3ZRX A;  5KHG A;  3WG7 B;  3OGI B;  3APQ A;  4TOI A;  5FNV A;  3BVO A;  3F5T A;  4CH3 A;  5BXZ A;  1GKF A;  4P2Z A;  1QLE C;  3NXS A;  3IGA C;  1DLB A;  1YI2 V;  4K3A A;  3E35 A;  1R3J C;  4UVA A;  5BMV A;  3LNM B;  3W7W A;  2WLI A;  1UPG A;  4P9P A;  1U97 A;  4TV9 A;  2WLL A;  1QLN A;  5EBM C;  3CRM A;  2W0X A;  3SYQ A;  5LMU O;  5B5E Z;  3Q4H A;  1PD3 A;  3CD6 V;  1NTK H;  1H2L A;  5LYJ B;  2YIB A;  4LF7 B;  1YCI A;  4CH5 A;  3RWR D;  2UU9 O;  1HNX O;  1SQF A;  2CGN A;  1AR4 A;  1L1F A;  2BCC H;  3T4D A;  1QVG U;  5F2V O;  1CXZ B;  4U7N A;  4AQY O;  4H13 B;  4DXW A;  4OPA A;  1KB9 F;  1KMI Z;  4PA3 A;  2XT9 A;  4FFB B;  4DRX B;  1I5X A;  1HNZ B;  5H6Q A;  4LF4 O;  4BIO A;  1N32 B;  1G8M A;  4R8C A;  3N2G B;  2Q67 A;  4LF6 O;  2X7R B;  5J2T B;  4OX9 O;  4Q6G A;  2E76 B;  1Y4M A;  3GB7 C;  2JGD B;  5K1X A;  4DR3 O;  2CUG A;  2Y69 B;  2EIL C;  4DR1 B;  4WF9 V;  3CP1 A;  3OD4 A;  2EIK C;  1N4C A;  4PDL A;  4YY3 O;  2VWK A;  4QE7 A;  4FLT A;  2LO1 A;  4AIL C;  1KU9 A;  4X66 B;  4WBN B;  3UM7 A;  4GX0 A;  4NXN B;  1N36 O;  1R3L C;  1IDS A;  3LSU A;  1FAF A;  2PF4 E;  4KL1 A;  2N05 A;  3TGU H;  2JK5 C;  1PV0 A;  4J7Z A;  3STL C;  2RJZ A;  1XRE A;  3D36 A;  5LOV B;  4LFC O;  3U0Z A;  4DV6 O;  2UXD B;  2RQ6 A;  3DTU B;  2P4K A;  3UT5 B;  1T5E A;  1X4T A;  4UUJ C;  1GK9 A;  1M57 B;  4JAS A;  2D3O W;  2YXY A;  2ZNJ A;  1FYJ A;  2GTS A;  3DC6 A;  1WPB A;  5IWA B;  1DGS A;  2CTW A;  2YID A;  3JD3 A;  2WLM A;  1XMO O;  1N33 O;  2HLD G;  1R6N A;  3SPH A;  4UCS A;  4GYC B;  4JI5 B;  1MA1 A;  5C8Y B;  4DR4 O;  3OMN B;  1N8R W;  3OR7 C;  5B1B C;  2AGA A;  1WNS A;  5B1N A;  4LNU A;  2X0L A;  1QR9 A;  2GHY A;  3ZMV A;  4DUY B;  2A9H A;  3SJQ C;  1YXB A;  2A7W A;  4NVP A;  3K59 A;  1M5I A;  2PYJ A;  4FIP C;  1Q6H A;  3O65 A;  4O4I A;  1Q43 A;  2F93 B;  2B5U A;  5ITZ A;  1JA8 A;  4Z1M G;  3SJC C;  3LDE A;  3LSQ A;  4LF6 B;  2CTQ A;  1UJW B;  2QSA A;  5EZY A;  4OX9 B;  2Z3Y A;  1FFX A;  2LGW A;  4DV0 B;  2M6Y A;  1M56 B;  4DR3 B;  2QKC A;  3QVN A;  4JYY A;  3CCM V;  3B40 A;  2PGG A;  3VQX A;  1MG1 A;  4YY3 B;  1XMQ O;  2ZE8 A;  1SQP H;  1PL4 A;  5JCO C;  2Z5U A;  4F6E A;  3ZBH A;  3SPI A;  3G80 A;  1VF6 A;  3OE7 G;  3TJT A;  1K92 A;  1SQG A;  2CH7 B;  4NR1 A;  4JYC A;  2ITC C;  3UQ8 A;  1JX9 A;  4EB6 A;  1IBK O;  1S72 V;  3JAR A;  2VQE B;  3RYI B;  2OYQ A;  1K8A W;  2H8P C;  2WAM A;  1P49 A;  1O9H A;  4JI2 O;  4B3R O;  3AG1 C;  1GO3 F;  2BSK B;  3H1L H;  1H2M A;  2DWE C;  3DC5 A;  3ZHV A;  3K9A A;  3KCY A;  5EYP A;  1QCE A;  2L35 A;  3B4S A;  2OT5 A;  2GUZ A;  3CCE V;  5H5N A;  2EIM C;  2CTP A;  5IYC O;  1JFF B;  1WLE A;  3OGC C;  1NKD A;  1SC5 B;  1D5N A;  2ZE7 A;  4DR4 B;  1JMK C;  2Q69 A;  4CBC A;  4JI6 B;  4LC1 A;  3L74 H;  5GON B;  3SJB C;  1PNK A;  1I7F A;  2DW4 A;  3UO3 A;  4DV5 O;  1BE3 H;  4YHH O;  5CA0 B;  5H6R A;  4D7T A;  4X62 B;  3CPW U;  5AG2 A;  4FFB A;  1ZAU A;  1Q6I A;  2EIL B;  4OGQ B;  4DRX A;  2UUA B;  4CC5 A;  2B1I A;  3BPZ A;  4JI7 O;  3JAL B;  3VBB A;  4GZR B;  1K9M W;  2EZP A;  3ABK C;  2OTL V;  4JTC B;  4MTO A;  1EBO A;  3FYE B;  1R1B A;  4HBN A;  2JGD A;  4I55 B;  2LW1 A;  1RPO A;  2WLN A;  3HKB B;  3OMI B;  2GV9 A;  4UCV A;  4X1K B;  2ARH A;  4PDM A;  1PKX A;  4MVM A;  4FMT A;  4OPH A;  2RNB A;  2YXH A;  2BOB C;  2CGO A;  3HKC A;  3PN1 A;  3ZX6 A;  3BRC A;  1ZTE A;  3IC7 A;  2E5L O;  3A0R A;  4MW3 A;  2Q5Z A;  1Q8I A;  3CYO A;  5LP6 B;  3N27 A;  4MTG A;  4B08 A;  4O4H B;  1XHZ A;  1HDJ A;  1J95 A;  3HKE A;  4YIO A;  3CXH F;  3GVM A;  1RM1 C;  5JVD A;  4RQE A;  2OIG A;  5B66 Z;  2H94 A;  4JV5 O;  1IBK B;  5D5P A;  1MZE A;  3RYH A;  4NYK A;  3N2K B;  3JD1 A;  1WA8 B;  3HKD A;  1SQV H;  1FXK C;  3VQV A;  1VQP V;  2DMX A;  1AP5 A;  1SQQ H;  1TUB A;  3UT5 A;  2BTQ B;  2ZIN A;  4TSF G;  3AK2 A;  5B1B B;  1SQX H;  1MAB G;  4O4J A;  2F23 A;  3L70 H;  3RYC B;  1ZWI C;  3MHS C;  1B04 A;  2NNU A;  2UXC O;  4JYA B;  4CS3 A;  1M9N A;  1XDC A;  4A5U B;  1BL8 A;  1HNW B;  1AI4 A;  1G1X B;  4G2K A;  4X1Y B;  4UV8 A;  4H0L B;  5C8Y A;  4JZ2 A;  4FK5 C;  4G28 B;  4K0K B;  5BY1 A;  1YZB A;  4JGS A;  2EJR A;  2QM4 A;  4DR5 O;  3SGI A;  3TCU A;  4DO2 A;  3QG5 A;  5CBH A;  5FLX N;  2Q7G A;  3K5N A;  5IT9 N;  4ICG A;  2F4V O;  2QDO A;  4L87 A;  4NTX A;  4UFZ A;  1KEC A;  4F6R A;  3K04 A;  1XL6 A;  3SDL A;  3KCX A;  2XHB A;  4Z2W A;  1YIT V;  2EZO A;  2F43 G;  1Y74 B;  3STZ C;  2KSD A;  4OXS A;  4TV8 A;  5E1A C;  3LNN A;  1UFI A;  1K5Q A;  1OCC C;  4JI1 O;  5HFM A;  2YUA A;  4LF8 O;  3E22 B;  3SYO A;  1A32 A;  1EN4 A;  1COW G;  2JGU A;  1J5E B;  2X6C A;  2RMK B;  3CRC A;  4I4T B;  1XQ8 A;  4GUN A;  3JAS B;  3ZHU A;  5CB4 A;  3L73 H;  2GSM B;  3E2E A;  3H01 A;  4R7C A;  4MS2 A;  4MVU A;  2Y0I A;  2YIB D;  4O2A B;  3JCU Z;  4DW1 A;  3FD9 A;  2YI9 A;  1S3J A;  1TAE A;  2XUM A;  3U10 A;  1MSD A;  1Y67 A;  2ZIO A;  2GTA A;  3E8H A;  3AG1 B;  1PPJ H;  3IFX A;  1SER A;  5CA1 B;  5D5Q A;  1KKC A;  4QNH B;  4LF7 O;  3JSL A;  2HKO A;  4O4L B;  3AG4 B;  2JS3 A;  2DYS C;  1NI8 A;  3ICX A;  1K4C C;  1P4R A;  3ABU A;  3CMA V;  2IW5 A;  3PJS K;  1IX9 A;  2HHH B;  2BSK A;  4LF9 O;  2E74 B;  2LW7 A;  2IU0 A;  4J41 A;  4ZOL B;  5KA5 A;  1HNZ O;  5JH7 A;  3TK1 A;  3ZMZ A;  1N32 O;  4I0X B;  5L3B A;  4RO2 A;  2VWJ A;  2R9A A;  3K5L A;  5IJ0 A;  2ILM A;  5IY5 B;  4ZI7 A;  3CE2 A;  2A79 B;  1XNR O;  1X59 A;  4PEL A;  3LDC A;  2RN9 A;  2GDS A;  1XNQ O;  1TVK B;  4HAM A;  4DR1 O;  3CC2 V;  5JQG B;  1JQ0 A;  4ASU G;  1NR7 A;  3ABK B;  4YJ3 B;  2QEX V;  4BR6 A;  2JRI A;  3OTO B;  5DN6 G;  1K34 A;  1V55 C;  2KB1 A;  3ASO B;  1V9P A;  3G6E V;  1AVM A;  1QHT A;  3FKS G;  3JD0 A;  1KKD A;  4EKW A;  4LWS B;  1VQ9 V;  1TUE B;  4HZ3 A;  1H8H G;  1TGO A;  2WA3 A;  5LHG A;  2Q4P A;  1RSO B;  1GTO A;  4BW9 A;  1NJI W;  2ZD9 A;  3ETQ A;  1PL0 A;  3SYC A;  1M56 C;  5KX5 B;  3CJH A;  3ABT A;  4IIJ B;  4P30 A;  2UXB B;  3JAT B;  3HKB A;  5KLV H;  3CCL V;  1FS0 G;  4ZBM A;  1RM1 B;  3MDS A;  4TQD A;  2R9R B;  4G27 B;  3K58 A;  3F7V C;  2XAS A;  2UXD O;  1IXM A;  4UXN A;  3ZHR A;  3CCV V;  3CS5 A;  1HR0 O;  5LL6 Y;  3FAV B;  3C3S A;  1FXK B;  3H1J H;  5IWA O;  4I50 A;  4FVM A;  2EIJ C;  2ZKO A;  3LSS A;  1VQN V;  4JI5 O;  3SYA A;  2EIN B;  1QR8 A;  2BOC C;  4GT1 A;  2K9P A;  4U3J B;  4J11 A;  1Z5W A;  4DUY O;  2Q9L A;  1NVP B;  4H37 A;  2VS0 A;  3E8G A;  3FX7 A;  3ABM C;  2QWO B;  3RYC A;  3IC9 A;  5DEC A;  4O2B B;  4UVB A;  4FFK A;  1XOU A;  4B3M B;  4LF9 B;  2FTK A;  4ZHQ A;  1SET A;  4NTY A;  1L0L H;  4QPJ A;  2UUB O;  4YJ2 B;  2HP8 A;  3CB2 A;  1SZT A;  2ZXW C;  4FZ0 A;  1OCC B;  3I55 V;  2Z0A A;  1XNR B;  4DV0 O;  1WP7 A;  2KQX A;  3W7X A;  4JZG A;  4FM1 A;  3FB7 C;  1XNQ B;  1CP9 A;  3ZIA G;  1LUV A;  5IJ9 A;  2AHZ A;  2O57 A;  2HVJ C;  2YSU B;  4JI8 B;  4FPP A;  3TET A;  3K9S A;  5B1O A;  5EK0 A;  4X8A A;  1E1Q G;  4WFB V;  1YHQ V;  2HFE C;  3A2F A;  2DQ0 A;  3T1Y B;  4PI0 A;  3CCJ V;  2F95 B;  2R9I A;  2IH3 C;  1FXV A;  1D5A A;  2VQE O;  1QVF U;  5JCO A;  4TWK A;  4XDK A;  4PDV A;  5L3E A;  4PA9 A;  4UVC A;  5KMG B;  4LH7 A;  4IL6 Z;  2ZQM A;  4J80 A;  5IYD O;  3OFN G;  3W7U A;  5LP6 C;  2DN9 A;  3UKM A;  3MAQ A;  1HR0 B;  2LGQ A;  2DYS B;  3AG7 A;  1RP3 B;  1FD9 A;  5FL7 G;  1P7B A;  1M4U A;  4HNA B;  5LA6 B;  3QO8 A;  3T4Z A;  2ZR2 A;  3CRR A;  4ZKI A;  4O4L A;  2P06 A;  1W2B U;  4LFA B;  1Q3E A;  4JI6 O;  2JJ2 G;  2R70 A;  4FLU A;  4QE9 A;  1W0J G;  2IM9 A;  3QTC A;  1SF9 A;  3QNE A;  1S5H C;  3L9D A;  4TQF A;  1KD1 W;  1P84 F;  4I9W A;  4LP8 A;  4PV1 B;  5TIS Z;  4X62 O;  3VQY A;  3J7A U;  4ZOL A;  1OCR B;  2P5O A;  1IUR A;  2UUA O;  1JR9 A;  4LCU C;  4X20 B;  4IHJ A;  4MVO A;  5EC1 C;  3ZED A;  1V55 B;  1S76 D;  1E1R G;  3ASN C;  1IBM B;  1VP7 A;  3RGB A;  4RWU A;  1Y76 B;  4PA7 A;  2UUB B;  1MZF A;  1VQL V;  2P6J A;  1MMM A;  3ML0 A;  2F1M A;  3IJ4 A;  4UCO A;  3AEI A;  5JQG A;  3L75 H;  4UCR A;  3JAK A;  2ZNI A;  3S3W A;  2Y4T A;  3FFQ A;  4YJ3 A;  3CHX A;  4YIP A;  2AW9 A;  5IE9 A;  1JOY A;  1XUQ A;  1FKA O;  1H2G A;  3ETD A;  3P30 A;  4W4K A;  2QJ1 A;  3UCS C;  1XIL A;  3BCC H;  4EEQ A;  3W7T A;  2AXT Z;  1SA0 A;  2EBO A;  5HFL A;  3RT3 C;  2YDE A;  3RYF B;  1RSO A;  4LH6 A;  3SPC A;  3F7Y C;  2P90 A;  4BW5 A;  1F7Y A;  3EHB B;  1NBM G;  4X65 B;  2PYL A;  5BZB A;  2KG7 B;  4MTF A;  1PNM A;  3JAW B;  2H3O A;  2QWR B;  3M8A A;  2EIJ B;  4LBE C;  5EC2 C;  1ENV A;  2DYR B;  5H2F Z;  3AK3 A;  1WJZ A;  1BT8 A;  3FAV A;  1M93 A;  1OCZ B;  4X1I B;  4CH6 A;  3D36 C;  1FXK A;  1SZX A;  1KP3 A;  1VQM V;  5LGN A;  4JYA O;  3EXA A;  3AK1 A;  1K4D C;  1HNW O;  1BCC H;  1HWY A;  3ABM B;  3AG4 C;  1IZ3 A;  4DV1 B;  1EZV H;  1HP8 A;  4WCE V;  4U3J A;  4K0K O;  5LYJ A;  3BA8 A;  5JJN B;  3WFV A;  1YTF B;  5B3S B;  3CC4 V;  2NLJ C;  1W0K G;  3ZHT A;  2A0L A;  2ZXW B;  5J2U B;  3D3I A;  1H2S B;  1KQS U;  1FFT B;  1NT2 B;  5EIB C;  5IY5 C;  5LHI A;  1YIJ V;  1H2N A;  4XDL A;  4B3S O;  1VQ6 V;  3N2G A;  3KZI Z;  4YJ2 A;  3JAM N;  5J2T A;  5JWP A;  1GM9 A;  5KHI A;  4WFE A;  2UXN A;  4DR6 B;  1J5E O;  4LFB B;  2HJF C;  2E75 B;  4QPK A;  2IU3 A;  3DXR B;  3ASO C;  2YEV B;  5LMN B;  1KUQ A;  4BIU A;  1AI5 A;  4WBN A;  4N23 A;  1BS3 A;  1GH6 A;  2QKA A;  2IJI A;  3I5D A;  2XND G;  3E8B A;  3E86 A;  2QM7 A;  5FNV B;  2W6J G;  4KP4 A;  1PP9 H;  1ZUQ A;  1V54 C;  3B8N A;  4RAI A;  1BZK A;  1QBZ A;  5BMV B;  4R6Z A;  3EFF K;  3CCS V;  4GCZ A;  2Q0O C;  4J10 A;  2HEP A;  3ZRW B;  1S77 D;  4JYB A;  2WLI B;  5C93 A;  5LOV A;  4JI4 B;  1AIL A;  1Q7Y W;  1KBH A;  1O9G A;  2FKX A;  3QO5 A;  4TV9 B;  2WLL B;  2HHH O;  4JTA B;  2WSS G;  2Y48 A;  5CMU A;  2OTJ V;  1I08 A;  4RUF A;  2HJD A;  2JEX A;  4K35 A;  2MW2 B;  1LNQ A;  2EIN C;  5KA6 A;  2RCV A;  5LA6 A;  5GW7 A;  1MSW D;  2WLK A;  4U7O A;  3A0B Z;  2CK3 G;  1WB8 A;  1H2K A;  2AZ2 A;  4I7Z B;  3BHP A;  3JYC A;  4ABM A;  1SKV A;  5CN0 A;  5GTI Z;  4E4E A;  1IBL B;  1G6U A;  4JAV A;  4JF3 A; 
#chains in the Genus database with same CATH homology
 2WLJ A;  3ASO B;  4R50 A;  3G6E V;  4WFG A;  3FKS G;  3ASN B;  3JD0 A;  1KKD A;  1F23 A;  3FYI B;  4EKW A;  1VQ9 V;  2JK5 C;  1KP2 A;  1TUE B;  4GX1 A;  4HZ3 A;  3STL C;  1G4Y B;  1H8H G;  5LHG A;  1K97 A;  1GTO A;  4H33 A;  5LGU A;  1NJI W;  2ZD9 A;  3D36 A;  1PL0 A;  3SYC A;  1M56 C;  3AG3 C;  3T2M A;  1NH2 B;  3ABT A;  3DTU B;  4P30 A;  5EBL C;  3OUF A;  1Y66 A;  3K03 A;  3CCL V;  1FS0 G;  4ZBM A;  1RM1 B;  1ARO P;  4UUJ C;  1GK9 A;  2R9R B;  4G27 B;  1K3E A;  3F7V C;  1M57 B;  2XAS A;  2V1D A;  1IXM A;  4JAS A;  4UXN A;  2D3O W;  3E83 A;  2ITD C;  3CCV V;  1EFR G;  2HR3 A;  1VQK V;  2WPD G;  3JD3 A;  3K06 A;  2WLM A;  1YSC A;  2HLD G;  1R6N A;  3SPH A;  2XAG A;  1FXK B;  1KC8 W;  3OMN B;  1N8R W;  3OR7 C;  1E79 G;  5B1B C;  3RVZ A;  3ETE A;  2EIJ C;  5B1N A;  3SPG A;  3LSS A;  3HPL C;  1VQN V;  2IJJ A;  2X0L A;  3FB6 C;  1QR9 A;  2GHY A;  3SYA A;  3ZMV A;  2EIN B;  1AR1 B;  1QR8 A;  2BOC C;  4YXW G;  4HYO A;  4JPR A;  1VQ7 V;  2M7W A;  4GT1 A;  2A9H A;  1F4N A;  5H9C A;  1AI7 A;  2EIK B;  3SJQ C;  5L3F A;  1NR1 A;  3ZMU A;  3FB5 C;  1NVP B;  4FIP C;  1VQ8 V;  4H37 A;  3RW0 A;  3ZRV A;  3ZJZ A;  2P67 A;  2ZDI C;  3E8G A;  3OW2 U;  3ABM C;  1F4M A;  3SPJ A;  2B5U A;  4CZZ A;  1Q86 W;  1FXH A;  4PA4 A;  4Z1M G;  1GMG A;  4UVB A;  3LDE A;  3LSQ A;  2XOK G;  4F4L A;  1K34 A;  1B6Q A;  2FTK A;  1UJW B;  1SET A;  2X6A A;  2Z3Y A;  4UV9 A;  3K0D A;  3VOU A;  4QPJ A;  1VQ5 V;  2LFR A;  1K5S A;  5KUM A;  5CBF A;  1M56 B;  3AG3 B;  1SZT A;  1Q82 W;  1M1K W;  2ZXW C;  2ZDI A;  3WG7 C;  1OCC B;  3I55 V;  5L3G A;  3CCM V;  4XBF A;  1H38 A;  3W7X A;  1MG1 A;  2IJK A;  3FB7 C;  3JCZ A;  3OMA B;  1YTF D;  1JVM A;  1CP9 A;  1I5Y A;  3JD4 A;  3ZIA G;  3ZMS A;  2Z5U A;  3AG2 C;  2AHZ A;  2HVJ C;  3CC7 V;  2YSU B;  3SPI A;  5J9P C;  3RBZ A;  1OHH G;  4FPP A;  5KUK A;  3OE7 G;  3TET A;  1K92 A;  5B1O A;  5EK0 A;  4X8A A;  3K79 A;  3LUT B;  1OCR C;  4JYC A;  1CEZ A;  4XDJ A;  2ITC C;  1E1Q G;  1JX9 A;  4WFB V;  2HFE C;  1YHQ V;  2DQ0 A;  1S72 V;  3CCJ V;  2K1E A;  3BY6 A;  2B1G A;  2JIZ G;  1K8A W;  2R9I A;  2IH3 C;  1FXV A;  1H8E G;  3CCQ V;  2H8P C;  2WAM A;  1QVF U;  4TWK A;  3OM3 B;  4XDK A;  4PDV A;  3E89 A;  5L3E A;  1AJQ A;  1DF4 A;  4PA9 A;  4UVC A;  1MOF A;  4KUM A;  3CCU V;  5DM6 V;  3AG1 C;  3ZN0 A;  2ZQM A;  1GO3 F;  1JJ2 U;  1JPX A;  1OCO C;  5IYD O;  3OFN G;  3W7U A;  4MVQ A;  4WFH A;  3UKM A;  2DWE C;  2DWD C;  1SRY A;  3K9A A;  3ZCC A;  3OEE G;  2JDI G;  4P9O A;  1QCE A;  2OT5 A;  3ABL C;  1BHA A;  2W0F C;  3CCE V;  2DYS B;  1VQ4 V;  5LHH A;  5FL7 G;  1P7B A;  2EIM C;  1V54 B;  5IYC O;  4GX2 A;  1WLE A;  2MK3 A;  3QO8 A;  3OGC C;  1EZJ A;  1NKD A;  2X6B A;  2HG5 C;  3T4Z A;  2Q69 A;  3ZN1 A;  2ZR2 A;  4CBC A;  4LC1 A;  3ETG A;  1VQO V;  3K08 A;  1PNK A;  4ZKI A;  2XAQ A;  2DW4 A;  1W2B U;  1K7D A;  4JAU A;  3X2Q C;  2JJ2 G;  5H6R A;  1R3I C;  4QE9 A;  1W0J G;  2Y69 C;  1GM8 A;  4FJC C;  2DYR C;  3CPW U;  2C2A A;  1PNL A;  3F5W C;  2EIL B;  3AG2 B;  3JD2 A;  3QNE A;  1AJN A;  1S5H C;  2B1I A;  3ZRW A;  1KD1 W;  4I9W A;  4LP8 A;  3W7S A;  1OCZ C;  4MTX A;  3DGE A;  3CCR V;  4WFF A;  3VBB A;  1OCR B;  1ROP A;  2HVK C;  2PI5 A;  1K9M W;  3CME V;  2EZP A;  1YJW V;  3ABK C;  4LCU C;  1RPR A;  4MVO A;  4JTC B;  4MTO A;  5LBQ A;  2OTL V;  1EBO A;  1AI6 A;  3FYE B;  1M90 W;  3HB3 B;  2QKS A;  5EC1 C;  2JEU A;  3RVY A;  2ATK C;  1V55 B;  1RPO A;  1S76 D;  2WLN A;  3BEH A;  1Q81 W;  1E1R G;  3ASN C;  3OMI B;  3B8M A;  4PA7 A;  3K3W A;  1SES A;  3KG2 A;  2P6J A;  4PDM A;  1VQL V;  1PKX A;  4MVM A;  4FMT A;  3ML0 A;  3ZRS A;  2BOB C;  2WLH A;  4X88 A;  3FB8 C;  3AEI A;  5B3S C;  1XL4 A;  1OCO B;  3IC7 A;  3A0R A;  4MW3 A;  3CYO A;  4MTG A;  4Q20 A;  4MW8 A;  2OCC C;  1YJ9 V;  1JOY A;  1J95 A;  1GM7 A;  1H2G A;  3ETD A;  4QIW F;  3P30 A;  4JTD B;  1K73 W;  1RM1 C;  4RQE A;  1M57 C;  2PI4 A;  2EIM B;  3W7T A;  3MD0 A;  2V7Q G;  4BIZ A;  3T1C A;  4TT3 G;  2H94 A;  2EBO A;  5HFL A;  3P32 A;  2ZR3 A;  5EBW C;  2LP7 A;  2QE7 G;  3SPC A;  1NH2 D;  3F7Y C;  2P90 A;  4BW5 A;  3JD1 A;  3EHB B;  1NBM G;  2UXX A;  3ZMT A;  1FXK C;  1VQP V;  5BZB A;  1DTO A;  4MSW C;  1R73 A;  3K0G A;  1JCH A;  2QA4 V;  1WPX A;  2W6I G;  1S0V A;  2WWW A;  5CBG A;  4TSF G;  3QO7 A;  4MTF A;  1PNM A;  5B1B B;  1MAB G;  3R65 A;  2EIJ B;  4LBE C;  5EC2 C;  1ENV A;  1ZWI C;  2DYR B;  1K33 A;  4GX5 A;  3MHS C;  5LGT A;  3OAA G;  2NNU A;  1M9N A;  2P7T C;  4E2L A;  1OCZ B;  1BL8 A;  1OZ0 A;  1AI4 A;  4X89 A;  4G2K A;  1FXK A;  4MVS A;  1KP3 A;  4RUE A;  4UV8 A;  1VQM V;  5LGN A;  3E8F A;  5B1A C;  4FK5 C;  4G28 B;  1K4D C;  4JGS A;  1BHB A;  1HWY A;  2EJR A;  4N21 A;  3ABM B;  3OUS A;  3AG4 C;  4WFA V;  2XAJ A;  2JJ1 G;  4I5S A;  1BMF G;  2YEV A;  4MVZ A;  3OEH G;  3TCU A;  4RQF A;  4J9Z B;  4WCE V;  1NVP D;  1AJP A;  1R3K C;  4MVR A;  4DO2 A;  5CBH A;  1THZ A;  1F51 A;  4KFM A;  3WFV A;  4L87 A;  1YTF B;  2AHY A;  4PA6 A;  1KEC A;  1YJN V;  3K04 A;  1XL6 A;  5B3S B;  1CPY A;  5IDJ A;  2IJH A;  2NLJ C;  1W0K G;  3CC4 V;  5L3D A;  1YIT V;  2EZO A;  2A0L A;  2F43 G;  3STZ C;  4OXS A;  5E1A C;  1K5Q A;  1OCC C;  2ZXW B;  2OCC B;  3ZRX A;  5HFM A;  3WG7 B;  3G71 V;  3D3I A;  1KQS U;  3CXC U;  1GKF A;  4P2Z A;  1QLE C;  3NXS A;  3IGA C;  2DQ3 A;  3SYO A;  1DLB A;  1FFT B;  3B77 A;  3G4S V;  1YI2 V;  5IY5 C;  5LHI A;  3E35 A;  2XAH A;  4XDL A;  1YIJ V;  1R3J C;  4UVA A;  1COW G;  3LNM B;  3W7W A;  1VQ6 V;  2X6C A;  2WLI A;  4P9P A;  2LFS A;  1GM9 A;  4WFE A;  2UXN A;  1DF5 A;  2WLL A;  1QLN A;  5EBM C;  2GSM B;  2HJF C;  3E2E A;  3OR6 C;  3H01 A;  4QPK A;  2IU3 A;  3SYQ A;  4R7C A;  1PD3 A;  3CD6 V;  3ASO C;  4MS2 A;  4MVU A;  2Q6A A;  2YEV B;  4BAY A;  1S3J A;  4BIU A;  1AI5 A;  1NQT A;  4N23 A;  3E8H A;  3AG1 B;  3IFX A;  1SER A;  4PDR A;  5B1A B;  2IJI A;  1L1F A;  3GWO A;  4QNH B;  2QM8 A;  3T4D A;  1QVG U;  2QTO A;  2XND G;  4U7N A;  2HKO A;  3E8B A;  3E86 A;  2QM7 A;  3AG4 B;  5IYB O;  2W6J G;  4KP4 A;  2DYS C;  4DXW A;  4MT8 A;  3ABL B;  1V54 C;  3B8N A;  4PA3 A;  4RAI A;  1K4C C;  3I56 V;  1P4R A;  1QBZ A;  3ABU A;  3CMA V;  2IW5 A;  4R6Z A;  5L3C A;  3EFF K;  3CCS V;  4GCZ A;  1I5X A;  5H6Q A;  3LDD A;  3PJS K;  1G8M A;  3ZRW B;  4R8C A;  1S77 D;  4JYB A;  2Q67 A;  2WLI B;  5C93 A;  2X7R B;  1Q7Y W;  2IU0 A;  1R6K A;  5KA5 A;  3QO5 A;  1Y4M A;  2XAF A;  2WLL B;  3TK1 A;  3ZMZ A;  2IH1 C;  3GB7 C;  4JTA B;  2WSS G;  5L3B A;  2Y48 A;  5CMU A;  3X2Q B;  4RO2 A;  2OTJ V;  5CA3 A;  4RUF A;  1QLE B;  2JEX A;  2Y69 B;  1LNQ A;  3MHH C;  2EIL C;  2EIN C;  2Q68 A;  5IY5 B;  5KA6 A;  4WF9 V;  2A79 B;  3CP1 A;  3M99 B;  5GW7 A;  1MSW D;  2WLK A;  4U7O A;  2EIK C;  4PEL A;  4PDL A;  2CK3 G;  3LDC A;  4QE7 A;  3JYC A;  4HAM A;  5CN0 A;  3CC2 V;  1JQ0 A;  3UM7 A;  1ORQ C;  4GX0 A;  4ASU G;  1NR7 A;  1R3L C;  3ABK B;  4J9Y B;  2QEX V;  3SYP A;  4JAV A;  4JF3 A;  5DN6 G;  4QJF B;  1V55 C;  2KB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...