3CCQF

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ccqF00
1YJWF 3CXCF 2KTVA 4C4WC 3NK6A 3CCJF 3VMFB 2KTUA 3RA5A 3OBWA 2QEXF 3IR9A 3CG6A 3NVKE 1ZWZA 1XBIA 2HVYD 2VGMA 1GZ0A 3ON1A 5GIOC 1Q81H 1VQLF 1M1KH 4BW0B 3LWQC 1QVFF 3OBYA 3N4YA 3LWPC 2QA4F 1H7MA 1X52A 3HAXD 1YJ9F 5GINC 1W3EX 3NMUC 5GANK 3SIVA 3CCRF 1N8RH 4LCKA 3CMAF 2LBWA 4TZZA 3AGKA 4X3MA 2OTLF 1RA4A 3O85A 3J80M 3CCUF 2JNBA 3CPWF 3CC2F 3N4ZA 3LWVC 2VGNA 3VI6A 3G6EF 3HJWC 2CZWA 1GO0A 3NVIB 3LWOC 2ALEA 1YIJF 1JJ2F 4X3LA 5GAPK 1W41A 1Q7YH 5GIPC 3OW2F 3CD6F 3LWRC 3CCEF 5EWRA 1VQ5F 3G71F 3MCAB 3CMEF 1CK2A 1Q82H 1K8AH 3CC4F 1YI2F 3E1YA 1VQ9F 5DCVA 1W40A 2QI2A 5A2QM 1VQMF 1VQ7F 1K9MH 4BY9D 3SIUA 3V7QA 1S72F 2KG4A 1QVGF 1K73H 3I55F 3E20B 1IPAA 5FLXM 1GO1A 1CN7A 1SDSA 1T0KB 3CCVF 3NK7A 1M90H 1VQPF 3CCMF 1KD1H 1VQOF 3CC7F 1E7KA 3I56F 2AIFA 3CCSF 2OHWA 5FJ4C 1W42A 3J81M 3JCMM 1YITF 1VQ6F 2OZBA 3WXMB 1VQ8F 2LBXA 3CCQF 5IT9M 1VQNF 3G4SF 2OTJF 1Q86H 2FC3A 1X7PA 1KC8H 3PLAC 5EO3A 2I6DA 3JAMM 5G4UC 1RLGA 3RA6A 3J7AR 3GYQA 1DT9A 3FFMA 1VQ4F 3LFOA 3PAFA 1VQKF 1PXWA 2WALA 3CCLF 1W2BF 1NMUB 5G4VC 3V7EA 1X7OA 1YJNF 1YHQF 1NJIH 1KQSF 4NUTA 3CPQA 2BO1A
chains in the Genus database with same CATH superfamily
2BTUA 5ITZA 3CXCF 4C4WC 3D01A 1W5EA 2HX0A 3CCJF 3E22A 5HP7A 2KTUA 3RA5A 2AMTA 3ELCA 1QAHA 2QEXF 4IIJA 1VHAA 3RYCB 2GVIA 1ZWZA 3S0WA 3WGNA 4B5CA 3FPIA 3S02A 5JVDB 4O4JB 1M1KH 2RHHA 4G88A 4BW0B 1SZQA 3IMPA 3FD6A 2PMPA 4PWTA 3RYHA 2ZOVA 3C8LA 5LP6B 1T0AA 2F9ZC 2ZF8A 3P0ZA 4X1IB 3IEWA 4DRXA 2Z1FA 5LOVA 4LCKA 1W5AA 5JCOA 3JAWB 2RHOA 5EYPB 4I4TB 2H8EA 3VOBA 4ERHA 2CHTA 2HP3A 2Q1XA 3WPXA 5LYJA 4TV8B 1W581 3NVIB 5GONA 4ZI7B 3LWOC 5MN4A 3TD3A 3GHZA 3N2GB 5GIPC 1J7HA 4WBNA 2AIZP 3VOAA 1VQ5F 3G71F 5FNVA 3MCAB 4B62A 2K1SA 4BT6A 1K8AH 3WJRA 4R40B 3E1YA 3HWUA 3HKCA 2B33A 1RLUA 4O2BA 3I7TA 1W40A 5CA0A 5A2QM 4BVQA 4I55B 4EI9A 2RHLA 1VQ7F 4TV8A 3SIUA 1S72F 2KG4A 4ZI7A 1FFXB 3E20B 1IPAA 1QU9A 1CN7A 3MBMA 3N2GA 5LXTA 2BTOA 1W59A 4M8IA 2Z1TA 3RYIA 3JARB 2G9IA 4ZHYB 4EI7A 1KD1H 3QHDA 1IV3A 4O4HB 3J81M 3ZOPA 1VQ6F 4C82A 3JATA 2OZBA 1Z5WA 1VQNF 4YJ3A 3JAKB 4BT4A 5CB4B 2R6R1 5IYZB 4I55A 3JASB 3M84A 3PLAC 1RLGA 3V4DA 3GYQA 2DYYA 1DBFA 2NMUA 5LP6C 2CSLA 1GX1A 3CCLF 5G4VC 1U3LA 2UYKA 3R0PA 2CWJA 2HS3A 4HNAB 1KQSF 2UYNA 3V3TA 2UYNB 1YJWF 3NK6A 5ITZB 1SA0A 4C81A 3E22B 5IJ0A 3D54A 3IR9A 4IIJB 2IAFA 3VIUA 1X25A 5J2TA 2P6YA 3ESJA 3HKBA 3HTNA 2BO1A 5IJ9B 5CB4A 2CVLA 3CYPB 3LWPC 2QA4F 3K14A 1H7MA 1U3PA 1X52A 1YJ9F 5GINC 4G4WA 5C8YB 3RYHB 3EORA 2CHSA 4BT5A 4G4YA 1OFUA 4DRXB 3SIVA 2N48A 3WPWA 4TV9A 3QUWA 3CCRF 2DT4A 3ZP4A 5LOVB 1N8RH 3QTYA 3UT5A 1XRGA 3O85A 3CB2A 5AVMA 3J80M 3S0YA 3S0HA 3CCUF 5EB1B 3CPWF 4BT3A 2MQEA 3LWVC 3HJWC 3MCQA 5J2UB 1GO0A 4YJ2A 5LYJB 5IJ9A 4X20A 4C8EA 2Z1UA 5GONB 4LNUA 2W8BC 2YXZA 4X3LA 5C8YA 1YIJF 1W41A 1TUBA 1Q7YH 3OW2F 3CD6F 3LWRC 4WBNB 3CCEF 5EWRA 5FNVB 3U0OA 2HS4A 3K0TA 2ZVZA 4B45A 3CC4F 1VQ9F 3HKCB 3F0DA 4O2BB 1IV2A 1W55A 4FFBA 3P10A 1JN1A 3VTIC 5CA0B 5J2UA 4BY9D 1QD9A 5CA1B 1VQVA 3ERNA 1ODEA 4F6RA 2Z1EA 5HXZA 5LXTB 5JH7A 3CCMF 1UI9A 4IHJA 3RYIB 4ZHWA 1FSZA 2OHWA 2UZHA 4BVSA 5FJ4C 2LBTA 3JCMM 2I6RA 2CW4A 3JATB 3WXMB 4I50A 5IT9M 1IV4A 4O2AA 3KJJA 4YJ3B 2H8CA 2VXYA 5EO3A 5LA6A 3JAMM 5CA1A 3FFMA 2OTMA 2UYPA 3PAFA 3MDOA 1PXWA 3F0EA 1NMUB 5JCOC 4X1KA 4XCQA 2ZODA 3VMFB 2HRUA 1SA0B 1W5FA 3VO8A 2VAMA 5IJ0B 1FNJA 4KWEA 2LCAA 3CG6A 3NVKE 3JALB 3RE3A 3C9TA 5J2TB 2VGMA 5GIOC 3ON1A 1JD1A 3IKEA 1VQLF 3HKBB 3LWQC 3HKDA 3OBYA 3N4YA 4BVTA 3I3FA 3HAXD 3DDNA 1W57A 2RHJA 1W3EX 3S06A 3NMUC 4EI8A 1H47A 1TVKB 1XHOA 4TV9B 3CMAF 2KGWA 4RHAA 3MQWA 4TZZA 3AGKA 4X3MA 4X1YB 3UT5B 5HP8A 3HKEA 3WJQA 3JALA 3WGKA 4ZK7A 3VI6A 1KNJA 1KNKA 3N2KA 1H48A 2CZWA 5MN5A 5EZYB 4YJ2B 3RYFB 4X20B 2HQSC 4EB6A 1R1MA 4TUYA 3LYBA 4LNUB 3KIZA 4BVRA 1TUBB 2ZAUA 2L26A 3VCZA 3D00A 1VH8A 3CMEF 1TVKA 1CK2A 1Q82H 4O4IA 4X1YA 3VYTC 4O4LB 5HY4A 2QI2A 4FFBB 3LDTA 3IEQA 1VQMF 5EZYA 1K9MH 4BT2A 3RYFA 3V7QA 5HY2A 5JQGB 1XV2A 3KE1A 4F6RB 1VK3A 1K73H 2Q1YA 4E6EA 5FLXM 1SDSA 5JH7B 5KX5A 1VQPF 3T80A 3GTZA 3L7QA 5EIBC 3CC7F 4IHJB 2R751 5BMVB 4C8GA 1PF5A 4O4LA 1YITF 1W5BA 3WGJA 2V9YA 5HXUA 1VQ8F 4I50B 2LBXA 5B8FA 3CCQF 3VYSC 3F0GA 1NQ3A 2HP0A 2Z01A 3ZP7A 2OTJF 4O2AB 5EAZA 1Q86H 2FC3A 2GLZA 4ZHQA 4NQ3A 5G4UC 1OAPA 5LA6B 3RA6A 5JQGA 3BYQA 1DT9A 1YGYA 2BTQB 1VQ4F 2H6LA 4C8IA 1VQKF 3P4EA 3V7EA 4X1KB 4ZHVA 2KTVA 1JFFB 3C9UA 5BMVA 3TD4A 1YQNA 2GZLA 3OBWA 1RQ7A 3RYCA 4ZOLB 1XBIA 2HVYD 1GZ0A 2RB9A 1JY8A 5JVDA 4O4JA 1Q81H 1QVFF 4NWOB 3HKDB 3S03A 4B46A 3WGMA 3M4SA 3LMEA 5LP6A 4X1IA 2PHNA 5GANK 1ONIA 2EWCA 3C9SA 3JAWA 5EYPA 2LBWA 2ZVYA 1CLIA 1JFFA 4I4TA 2OTLF 1RA4A 1Z5VA 3F0FA 4BT7A 3B6NA 2UYJA 3HKEB 3M1XA 4DXDA 1RQ2A 4ZOLA 2JNBA 5MN6A 3FD5A 4G4ZA 3N4ZA 3CC2F 2VAWA 2VGNA 3G6EF 3N2KB 4EB6B 4TUYB 2ALEA 5EIBD 1JJ2F 5GAPK 1FNKA 5KMGB 3OONA 3KJKA 2VAPA 3F6MA 3IKFA 4O4IB 1COMA 1YI2F 1IV1A 3Q8HA 5DCVA 2HRYA 2IG8A 4U3JB 4G4XA 5HY1A 3C9RA 5HY0A 1QVGF 1FFXA 3I55F 2FGYA 1GO1A 1Q8RA 5KMGA 1T0KB 3CCVF 3NK7A 4G4VA 2HS0A 4RQOA 1M90H 5KX5B 3JARA 1U40A 1VQOF 1E7KA 3I56F 2AIFA 2QTPA 4O4HA 3CCSF 1U43A 3K2XA 1W42A 2YYEA 2IQQA 5HWEA 4U39A 2HP0B 3G4SF 3JAKA 3KHNA 5IYZA 4U3JA 3JASA 3WJPA 1X7PA 1KC8H 4ZHQB 2I6DA 3ZO8A 3J7AR 3TD5A 5EB0A 3CYQA 3LFOA 2WALA 1W2BF 1UFYA 4HNAA 1X7OA 3VYUC 1YHQF 3JVHA 3WGLA 1YJNF 3FBAA 1NJIH 4NUTA 3CPQA 3K12A 3DC2A
chains in the Genus database with same CATH topology
4XCQA 3CXCF 2KTVA 1YJWF 3NK6A 4C4WC 3CCJF 3VMFB 2KTUA 3RA5A 3OBWA 2QEXF 3IR9A 3CG6A 3NVKE 1ZWZA 1XBIA 2HVYD 2VGMA 1GZ0A 3ON1A 5GIOC 1Q81H 1VQLF 1M1KH 4BW0B 3LWQC 1QVFF 3OBYA 3N4YA 3LWPC 2QA4F 4BVTA 1H7MA 1X52A 3HAXD 1YJ9F 5GINC 1W3EX 2F9ZC 3NMUC 4EI8A 5GANK 3SIVA 3CCRF 1N8RH 4LCKA 3CMAF 2LBWA 4TZZA 3AGKA 4X3MA 2OTLF 1RA4A 3O85A 3J80M 3CCUF 2JNBA 3CPWF 3CC2F 3N4ZA 3LWVC 2VGNA 3VI6A 3G6EF 3HJWC 2CZWA 1GO0A 3NVIB 3LWOC 2ALEA 1YIJF 1JJ2F 4X3LA 5GAPK 4BVRA 1W41A 1Q7YH 5GIPC 3OW2F 3CD6F 3LWRC 3CCEF 5EWRA 1VQ5F 3D00A 3G71F 3MCAB 3CMEF 1CK2A 1Q82H 1K8AH 3CC4F 1YI2F 3E1YA 1VQ9F 5HY4A 5DCVA 1W40A 2QI2A 5A2QM 4BVQA 4EI9A 1VQMF 1VQ7F 1K9MH 4BY9D 3SIUA 3V7QA 5HY2A 5HY1A 1S72F 2KG4A 5HY0A 1QVGF 1K73H 3I55F 3E20B 1IPAA 2FGYA 1GO1A 5FLXM 1SDSA 5HXZA 1T0KB 1CN7A 3CCVF 3NK7A 1M90H 1VQPF 3CCMF 1KD1H 1VQOF 3CC7F 1E7KA 4EI7A 3I56F 2AIFA 3CCSF 2OHWA 4BVSA 5FJ4C 1W42A 3J81M 5HWEA 3JCMM 1YITF 1VQ6F 2OZBA 5HXUA 3WXMB 1VQ8F 2LBXA 3CCQF 5IT9M 1VQNF 3G4SF 2OTJF 1Q86H 2FC3A 2GLZA 1X7PA 1KC8H 4NQ3A 3PLAC 5EO3A 2I6DA 3JAMM 5G4UC 1RLGA 3RA6A 3J7AR 3GYQA 1DT9A 3FFMA 1VQ4F 3LFOA 3PAFA 1VQKF 1PXWA 2WALA 3CCLF 1W2BF 1NMUB 5G4VC 3V7EA 1X7OA 1YJNF 1YHQF 1NJIH 1KQSF 3V3TA 4NUTA 3CPQA 2BO1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJW F;  3CXC F;  2KTV A;  4C4W C;  3NK6 A;  3CCJ F;  3VMF B;  2KTU A;  3RA5 A;  3OBW A;  2QEX F;  3IR9 A;  3CG6 A;  3NVK E;  1ZWZ A;  1XBI A;  2HVY D;  2VGM A;  1GZ0 A;  3ON1 A;  5GIO C;  1Q81 H;  1VQL F;  1M1K H;  4BW0 B;  3LWQ C;  1QVF F;  3OBY A;  3N4Y A;  3LWP C;  2QA4 F;  1H7M A;  1X52 A;  3HAX D;  1YJ9 F;  5GIN C;  1W3E X;  3NMU C;  5GAN K;  3SIV A;  3CCR F;  1N8R H;  4LCK A;  3CMA F;  2LBW A;  4TZZ A;  3AGK A;  4X3M A;  2OTL F;  1RA4 A;  3O85 A;  3J80 M;  3CCU F;  2JNB A;  3CPW F;  3CC2 F;  3N4Z A;  3LWV C;  2VGN A;  3VI6 A;  3G6E F;  3HJW C;  2CZW A;  1GO0 A;  3NVI B;  3LWO C;  2ALE A;  1YIJ F;  1JJ2 F;  4X3L A;  5GAP K;  1W41 A;  1Q7Y H;  5GIP C;  3OW2 F;  3CD6 F;  3LWR C;  3CCE F;  5EWR A;  1VQ5 F;  3G71 F;  3MCA B;  3CME F;  1CK2 A;  1Q82 H;  1K8A H;  3CC4 F;  1YI2 F;  3E1Y A;  1VQ9 F;  5DCV A;  1W40 A;  2QI2 A;  5A2Q M;  1VQM F;  1VQ7 F;  1K9M H;  4BY9 D;  3SIU A;  3V7Q A;  1S72 F;  2KG4 A;  1QVG F;  1K73 H;  3I55 F;  3E20 B;  1IPA A;  5FLX M;  1GO1 A;  1CN7 A;  1SDS A;  1T0K B;  3CCV F;  3NK7 A;  1M90 H;  1VQP F;  3CCM F;  1KD1 H;  1VQO F;  3CC7 F;  1E7K A;  3I56 F;  2AIF A;  3CCS F;  2OHW A;  5FJ4 C;  1W42 A;  3J81 M;  3JCM M;  1YIT F;  1VQ6 F;  2OZB A;  3WXM B;  1VQ8 F;  2LBX A;  3CCQ F;  5IT9 M;  1VQN F;  3G4S F;  2OTJ F;  1Q86 H;  2FC3 A;  1X7P A;  1KC8 H;  3PLA C;  5EO3 A;  2I6D A;  3JAM M;  5G4U C;  1RLG A;  3RA6 A;  3J7A R;  3GYQ A;  1DT9 A;  3FFM A;  1VQ4 F;  3LFO A;  3PAF A;  1VQK F;  1PXW A;  2WAL A;  3CCL F;  1W2B F;  1NMU B;  5G4V C;  3V7E A;  1X7O A;  1YJN F;  1YHQ F;  1NJI H;  1KQS F;  4NUT A;  3CPQ A;  2BO1 A; 
#chains in the Genus database with same CATH topology
 2BTU A;  5ITZ A;  3CXC F;  4C4W C;  3D01 A;  1W5E A;  2HX0 A;  3CCJ F;  3E22 A;  5HP7 A;  2KTU A;  3RA5 A;  2AMT A;  3ELC A;  1QAH A;  2QEX F;  4IIJ A;  1VHA A;  3RYC B;  2GVI A;  1ZWZ A;  3S0W A;  3WGN A;  4B5C A;  3FPI A;  3S02 A;  5JVD B;  4O4J B;  1M1K H;  2RHH A;  4G88 A;  4BW0 B;  1SZQ A;  3IMP A;  3FD6 A;  2PMP A;  4PWT A;  3RYH A;  2ZOV A;  3C8L A;  5LP6 B;  1T0A A;  2F9Z C;  2ZF8 A;  3P0Z A;  4X1I B;  3IEW A;  4DRX A;  2Z1F A;  5LOV A;  4LCK A;  1W5A A;  5JCO A;  3JAW B;  2RHO A;  5EYP B;  4I4T B;  2H8E A;  3VOB A;  4ERH A;  2CHT A;  2HP3 A;  2Q1X A;  3WPX A;  5LYJ A;  4TV8 B;  1W58 1;  3NVI B;  5GON A;  4ZI7 B;  3LWO C;  5MN4 A;  3TD3 A;  3GHZ A;  3N2G B;  5GIP C;  1J7H A;  4WBN A;  2AIZ P;  3VOA A;  1VQ5 F;  3G71 F;  5FNV A;  3MCA B;  4B62 A;  2K1S A;  4BT6 A;  1K8A H;  3WJR A;  4R40 B;  3E1Y A;  3HWU A;  3HKC A;  2B33 A;  1RLU A;  4O2B A;  3I7T A;  1W40 A;  5CA0 A;  5A2Q M;  4BVQ A;  4I55 B;  4EI9 A;  2RHL A;  1VQ7 F;  4TV8 A;  3SIU A;  1S72 F;  2KG4 A;  4ZI7 A;  1FFX B;  3E20 B;  1IPA A;  1QU9 A;  1CN7 A;  3MBM A;  3N2G A;  5LXT A;  2BTO A;  1W59 A;  4M8I A;  2Z1T A;  3RYI A;  3JAR B;  2G9I A;  4ZHY B;  4EI7 A;  1KD1 H;  3QHD A;  1IV3 A;  4O4H B;  3J81 M;  3ZOP A;  1VQ6 F;  4C82 A;  3JAT A;  2OZB A;  1Z5W A;  1VQN F;  4YJ3 A;  3JAK B;  4BT4 A;  5CB4 B;  2R6R 1;  5IYZ B;  4I55 A;  3JAS B;  3M84 A;  3PLA C;  1RLG A;  3V4D A;  3GYQ A;  2DYY A;  1DBF A;  2NMU A;  5LP6 C;  2CSL A;  1GX1 A;  3CCL F;  5G4V C;  1U3L A;  2UYK A;  3R0P A;  2CWJ A;  2HS3 A;  4HNA B;  1KQS F;  2UYN A;  3V3T A;  2UYN B;  1YJW F;  3NK6 A;  5ITZ B;  1SA0 A;  4C81 A;  3E22 B;  5IJ0 A;  3D54 A;  3IR9 A;  4IIJ B;  2IAF A;  3VIU A;  1X25 A;  5J2T A;  2P6Y A;  3ESJ A;  3HKB A;  3HTN A;  2BO1 A;  5IJ9 B;  5CB4 A;  2CVL A;  3CYP B;  3LWP C;  2QA4 F;  3K14 A;  1H7M A;  1U3P A;  1X52 A;  1YJ9 F;  5GIN C;  4G4W A;  5C8Y B;  3RYH B;  3EOR A;  2CHS A;  4BT5 A;  4G4Y A;  1OFU A;  4DRX B;  3SIV A;  2N48 A;  3WPW A;  4TV9 A;  3QUW A;  3CCR F;  2DT4 A;  3ZP4 A;  5LOV B;  1N8R H;  3QTY A;  3UT5 A;  1XRG A;  3O85 A;  3CB2 A;  5AVM A;  3J80 M;  3S0Y A;  3S0H A;  3CCU F;  5EB1 B;  3CPW F;  4BT3 A;  2MQE A;  3LWV C;  3HJW C;  3MCQ A;  5J2U B;  1GO0 A;  4YJ2 A;  5LYJ B;  5IJ9 A;  4X20 A;  4C8E A;  2Z1U A;  5GON B;  4LNU A;  2W8B C;  2YXZ A;  4X3L A;  5C8Y A;  1YIJ F;  1W41 A;  1TUB A;  1Q7Y H;  3OW2 F;  3CD6 F;  3LWR C;  4WBN B;  3CCE F;  5EWR A;  5FNV B;  3U0O A;  2HS4 A;  3K0T A;  2ZVZ A;  4B45 A;  3CC4 F;  1VQ9 F;  3HKC B;  3F0D A;  4O2B B;  1IV2 A;  1W55 A;  4FFB A;  3P10 A;  1JN1 A;  3VTI C;  5CA0 B;  5J2U A;  4BY9 D;  1QD9 A;  5CA1 B;  1VQV A;  3ERN A;  1ODE A;  4F6R A;  2Z1E A;  5HXZ A;  5LXT B;  5JH7 A;  3CCM F;  1UI9 A;  4IHJ A;  3RYI B;  4ZHW A;  1FSZ A;  2OHW A;  2UZH A;  4BVS A;  5FJ4 C;  2LBT A;  3JCM M;  2I6R A;  2CW4 A;  3JAT B;  3WXM B;  4I50 A;  5IT9 M;  1IV4 A;  4O2A A;  3KJJ A;  4YJ3 B;  2H8C A;  2VXY A;  5EO3 A;  5LA6 A;  3JAM M;  5CA1 A;  3FFM A;  2OTM A;  2UYP A;  3PAF A;  3MDO A;  1PXW A;  3F0E A;  1NMU B;  5JCO C;  4X1K A;  4XCQ A;  2ZOD A;  3VMF B;  2HRU A;  1SA0 B;  1W5F A;  3VO8 A;  2VAM A;  5IJ0 B;  1FNJ A;  4KWE A;  2LCA A;  3CG6 A;  3NVK E;  3JAL B;  3RE3 A;  3C9T A;  5J2T B;  2VGM A;  5GIO C;  3ON1 A;  1JD1 A;  3IKE A;  1VQL F;  3HKB B;  3LWQ C;  3HKD A;  3OBY A;  3N4Y A;  4BVT A;  3I3F A;  3HAX D;  3DDN A;  1W57 A;  2RHJ A;  1W3E X;  3S06 A;  3NMU C;  4EI8 A;  1H47 A;  1TVK B;  1XHO A;  4TV9 B;  3CMA F;  2KGW A;  4RHA A;  3MQW A;  4TZZ A;  3AGK A;  4X3M A;  4X1Y B;  3UT5 B;  5HP8 A;  3HKE A;  3WJQ A;  3JAL A;  3WGK A;  4ZK7 A;  3VI6 A;  1KNJ A;  1KNK A;  3N2K A;  1H48 A;  2CZW A;  5MN5 A;  5EZY B;  4YJ2 B;  3RYF B;  4X20 B;  2HQS C;  4EB6 A;  1R1M A;  4TUY A;  3LYB A;  4LNU B;  3KIZ A;  4BVR A;  1TUB B;  2ZAU A;  2L26 A;  3VCZ A;  3D00 A;  1VH8 A;  3CME F;  1TVK A;  1CK2 A;  1Q82 H;  4O4I A;  4X1Y A;  3VYT C;  4O4L B;  5HY4 A;  2QI2 A;  4FFB B;  3LDT A;  3IEQ A;  1VQM F;  5EZY A;  1K9M H;  4BT2 A;  3RYF A;  3V7Q A;  5HY2 A;  5JQG B;  1XV2 A;  3KE1 A;  4F6R B;  1VK3 A;  1K73 H;  2Q1Y A;  4E6E A;  5FLX M;  1SDS A;  5JH7 B;  5KX5 A;  1VQP F;  3T80 A;  3GTZ A;  3L7Q A;  5EIB C;  3CC7 F;  4IHJ B;  2R75 1;  5BMV B;  4C8G A;  1PF5 A;  4O4L A;  1YIT F;  1W5B A;  3WGJ A;  2V9Y A;  5HXU A;  1VQ8 F;  4I50 B;  2LBX A;  5B8F A;  3CCQ F;  3VYS C;  3F0G A;  1NQ3 A;  2HP0 A;  2Z01 A;  3ZP7 A;  2OTJ F;  4O2A B;  5EAZ A;  1Q86 H;  2FC3 A;  2GLZ A;  4ZHQ A;  4NQ3 A;  5G4U C;  1OAP A;  5LA6 B;  3RA6 A;  5JQG A;  3BYQ A;  1DT9 A;  1YGY A;  2BTQ B;  1VQ4 F;  2H6L A;  4C8I A;  1VQK F;  3P4E A;  3V7E A;  4X1K B;  4ZHV A;  2KTV A;  1JFF B;  3C9U A;  5BMV A;  3TD4 A;  1YQN A;  2GZL A;  3OBW A;  1RQ7 A;  3RYC A;  4ZOL B;  1XBI A;  2HVY D;  1GZ0 A;  2RB9 A;  1JY8 A;  5JVD A;  4O4J A;  1Q81 H;  1QVF F;  4NWO B;  3HKD B;  3S03 A;  4B46 A;  3WGM A;  3M4S A;  3LME A;  5LP6 A;  4X1I A;  2PHN A;  5GAN K;  1ONI A;  2EWC A;  3C9S A;  3JAW A;  5EYP A;  2LBW A;  2ZVY A;  1CLI A;  1JFF A;  4I4T A;  2OTL F;  1RA4 A;  1Z5V A;  3F0F A;  4BT7 A;  3B6N A;  2UYJ A;  3HKE B;  3M1X A;  4DXD A;  1RQ2 A;  4ZOL A;  2JNB A;  5MN6 A;  3FD5 A;  4G4Z A;  3N4Z A;  3CC2 F;  2VAW A;  2VGN A;  3G6E F;  3N2K B;  4EB6 B;  4TUY B;  2ALE A;  5EIB D;  1JJ2 F;  5GAP K;  1FNK A;  5KMG B;  3OON A;  3KJK A;  2VAP A;  3F6M A;  3IKF A;  4O4I B;  1COM A;  1YI2 F;  1IV1 A;  3Q8H A;  5DCV A;  2HRY A;  2IG8 A;  4U3J B;  4G4X A;  5HY1 A;  3C9R A;  5HY0 A;  1QVG F;  1FFX A;  3I55 F;  2FGY A;  1GO1 A;  1Q8R A;  5KMG A;  1T0K B;  3CCV F;  3NK7 A;  4G4V A;  2HS0 A;  4RQO A;  1M90 H;  5KX5 B;  3JAR A;  1U40 A;  1VQO F;  1E7K A;  3I56 F;  2AIF A;  2QTP A;  4O4H A;  3CCS F;  1U43 A;  3K2X A;  1W42 A;  2YYE A;  2IQQ A;  5HWE A;  4U39 A;  2HP0 B;  3G4S F;  3JAK A;  3KHN A;  5IYZ A;  4U3J A;  3JAS A;  3WJP A;  1X7P A;  1KC8 H;  4ZHQ B;  2I6D A;  3ZO8 A;  3J7A R;  3TD5 A;  5EB0 A;  3CYQ A;  3LFO A;  2WAL A;  1W2B F;  1UFY A;  4HNA A;  1X7O A;  3VYU C;  1YHQ F;  3JVH A;  3WGL A;  1YJN F;  3FBA A;  1NJI H;  4NUT A;  3CPQ A;  3K12 A;  3DC2 A; 
#chains in the Genus database with same CATH homology
 4XCQ A;  3CXC F;  2KTV A;  1YJW F;  3NK6 A;  4C4W C;  3CCJ F;  3VMF B;  2KTU A;  3RA5 A;  3OBW A;  2QEX F;  3IR9 A;  3CG6 A;  3NVK E;  1ZWZ A;  1XBI A;  2HVY D;  2VGM A;  1GZ0 A;  3ON1 A;  5GIO C;  1Q81 H;  1VQL F;  1M1K H;  4BW0 B;  3LWQ C;  1QVF F;  3OBY A;  3N4Y A;  3LWP C;  2QA4 F;  4BVT A;  1H7M A;  1X52 A;  3HAX D;  1YJ9 F;  5GIN C;  1W3E X;  2F9Z C;  3NMU C;  4EI8 A;  5GAN K;  3SIV A;  3CCR F;  1N8R H;  4LCK A;  3CMA F;  2LBW A;  4TZZ A;  3AGK A;  4X3M A;  2OTL F;  1RA4 A;  3O85 A;  3J80 M;  3CCU F;  2JNB A;  3CPW F;  3CC2 F;  3N4Z A;  3LWV C;  2VGN A;  3VI6 A;  3G6E F;  3HJW C;  2CZW A;  1GO0 A;  3NVI B;  3LWO C;  2ALE A;  1YIJ F;  1JJ2 F;  4X3L A;  5GAP K;  4BVR A;  1W41 A;  1Q7Y H;  5GIP C;  3OW2 F;  3CD6 F;  3LWR C;  3CCE F;  5EWR A;  1VQ5 F;  3D00 A;  3G71 F;  3MCA B;  3CME F;  1CK2 A;  1Q82 H;  1K8A H;  3CC4 F;  1YI2 F;  3E1Y A;  1VQ9 F;  5HY4 A;  5DCV A;  1W40 A;  2QI2 A;  5A2Q M;  4BVQ A;  4EI9 A;  1VQM F;  1VQ7 F;  1K9M H;  4BY9 D;  3SIU A;  3V7Q A;  5HY2 A;  5HY1 A;  1S72 F;  2KG4 A;  5HY0 A;  1QVG F;  1K73 H;  3I55 F;  3E20 B;  1IPA A;  2FGY A;  1GO1 A;  5FLX M;  1SDS A;  5HXZ A;  1T0K B;  1CN7 A;  3CCV F;  3NK7 A;  1M90 H;  1VQP F;  3CCM F;  1KD1 H;  1VQO F;  3CC7 F;  1E7K A;  4EI7 A;  3I56 F;  2AIF A;  3CCS F;  2OHW A;  4BVS A;  5FJ4 C;  1W42 A;  3J81 M;  5HWE A;  3JCM M;  1YIT F;  1VQ6 F;  2OZB A;  5HXU A;  3WXM B;  1VQ8 F;  2LBX A;  3CCQ F;  5IT9 M;  1VQN F;  3G4S F;  2OTJ F;  1Q86 H;  2FC3 A;  2GLZ A;  1X7P A;  1KC8 H;  4NQ3 A;  3PLA C;  5EO3 A;  2I6D A;  3JAM M;  5G4U C;  1RLG A;  3RA6 A;  3J7A R;  3GYQ A;  1DT9 A;  3FFM A;  1VQ4 F;  3LFO A;  3PAF A;  1VQK F;  1PXW A;  2WAL A;  3CCL F;  1W2B F;  1NMU B;  5G4V C;  3V7E A;  1X7O A;  1YJN F;  1YHQ F;  1NJI H;  1KQS F;  3V3T A;  4NUT A;  3CPQ A;  2BO1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...