3CCQF

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ccqF00
3JCMM 1VQNF 3HAXD 3PAFA 5FLXM 3CMEF 5FJ4C 3CC2F 3RA5A 1KQSF 1N8RH 3CCMF 3OBWA 1ZWZA 3G71F 3NVKE 1VQ8F 5G4UC 3N4ZA 3CD6F 1PXWA 3LWPC 1K9MH 1YITF 3LWVC 3JAMM 1VQMF 3MCAB 3PLAC 2LBXA 2OTJF 1YIJF 1K8AH 3NK6A 3I55F 1VQ7F 3ON1A 4X3LA 3CG6A 2VGMA 3LWRC 3OW2F 2QA4F 1K73H 1RLGA 3V7QA 3J81M 1VQKF 3V7EA 3LWQC 4C4WC 3O85A 3VI6A 2ALEA 1Q7YH 1X52A 1Q82H 1Q86H 2LBWA 5DCVA 2JNBA 3WXMB 2HVYD 3CCJF 3G6EF 3CCQF 2OZBA 3CPWF 2QEXF 2QI2A 1H7MA 1W42A 5GIOC 2KTUA 1KD1H 4BY9D 1X7OA 3I56F 1YJWF 3NVIB 3LWOC 3N4YA 2FC3A 1Q81H 3CCEF 3CCSF 5GANK 2OTLF 1YI2F 3GYQA 3CCUF 1YJNF 2BO1A 1CN7A 2I6DA 1VQOF 1RA4A 5IT9M 3J7AR 1NJIH 2VGNA 3CCVF 4TZZA 1VQ4F 3CCRF 3J80M 1QVFF 1GZ0A 3G4SF 1S72F 1SDSA 1VQ6F 2AIFA 1VQLF 1E7KA 1W41A 1CK2A 1KC8H 1M1KH 1YHQF 5GIPC 3SIVA 5GINC 1QVGF 3RA6A 4LCKA 3LFOA 3VMFB 5A2QM 3CCLF 1M90H 1VQPF 5GAPK 3FFMA 1X7PA 3CPQA 3CXCF 2WALA 1NMUB 2CZWA 3IR9A 3NK7A 3CC4F 3CC7F 3SIUA 4NUTA 3CMAF 1JJ2F 1IPAA 1XBIA 1W2BF 3E1YA 2OHWA 1W40A 1YJ9F 1T0KB 1VQ5F 1DT9A 4BW0B 3HJWC 1GO1A 5EWRA 3AGKA 4X3MA 3E20B 5EO3A 3NMUC 1W3EX 3OBYA 5G4VC 1VQ9F 2KG4A 1GO0A 2KTVA
chains in the Genus database with same CATH superfamily
1VQNF 5FJ4C 4I4TA 1N8RH 3CCMF 3K12A 4O4HA 1TUBB 3ELCA 3I3FA 3OONA 3CD6F 4BT3A 1IV2A 1YITF 2ZF8A 4F6RA 3JAMM 3MCAB 3WPXA 3WJQA 5JQGB 3CYQA 1ODEA 3IMPA 3I55F 1DBFA 5IJ0B 4FFBB 4X3LA 4LNUA 2VGMA 3HKCB 4EI7A 3HKEA 1CLIA 2ZOVA 3DDNA 5LOVA 4BT4A 1K73H 1RLGA 3J81M 1VQKF 1OAPA 3N2GA 4X1KB 3VI6A 3K0TA 2ALEA 4ZI7A 1T0AA 2BTQB 4X1YA 1Q82H 1Q86H 2LBWA 4ZHVA 1IV3A 1KNJA 5J2TA 3LDTA 3FPIA 2KTUA 5LP6A 4BY9D 2RHJA 3JATA 3I56F 3WPWA 3LWOC 1FSZA 2L26A 1YQNA 5EYPB 3DC2A 4IHJA 3FD5A 4O4IA 3CCEF 1OFUA 4IIJB 4NWOB 4ZOLA 3S03A 5HP7A 1W59A 5HXUA 4HNAA 5ITZA 3GHZA 4I55B 3F0GA 4O4LB 1CN7A 2R751 3M4SA 1W5AA 5EIBD 1UFYA 1SA0B 4O2AB 5LA6B 1NJIH 2RHLA 4G4XA 4O2BA 3WGKA 1JY8A 3R0PA 5HXZA 3CCRF 1QVFF 4ZHYB 1TVKA 3I7TA 4X1IA 2H6LA 2Z1EA 3WGLA 1E7KA 2LBTA 2UYNA 4YJ3B 4IHJB 2H8EA 2MQEA 4FFBA 3BYQA 1KC8H 3SIVA 4C8IA 5GIPC 2HP0A 2UZHA 2DT4A 3RA6A 5B8FA 3T80A 2UYJA 1FNJA 4C8GA 1X7PA 2B33A 1NMUB 2CZWA 3IR9A 3RE3A 3S0WA 3RYCA 3CC4F 1IPAA 3HWUA 1W55A 3VCZA 4BT6A 2UYPA 3RYIB 3WJPA 1T0KB 3S06A 1VQ5F 3HJWC 1PF5A 1GO1A 2YXZA 5CA1B 5LXTA 5G4VC 1QU9A 3LYBA 2KTVA 4BVTA 3PAFA 3ESJA 2VAMA 4RQOA 5FNVA 3OBWA 1Q8RA 4YJ2B 2Z01A 5IYZB 5G4UC 3LWPC 1K9MH 4TUYB 3VOBA 3PLAC 3HKDA 2CW4A 3MBMA 1IV1A 4ZK7A 3CB2A 3NK6A 4C82A 3JASA 1YGYA 5MN4A 5JH7A 3ON1A 3CG6A 4BT5A 4BVRA 3L7QA 1W5EA 4G4ZA 4TV9B 5KX5B 3RYCB 3QTYA 3V7EA 1QAHA 3TD4A 4F6RB 4WBNA 3ZOPA 3WXMB 2HVYD 3CCQF 3ZO8A 2QEXF 1H7MA 5GIOC 1KD1H 1U43A 1ONIA 4EI9A 1YJWF 3NVIB 2G9IA 5CB4B 3N4YA 5IYZA 2PHNA 1Q81H 4NQ3A 2LCAA 2OTLF 1YI2F 1JFFA 2EWCA 2VAWA 3CCUF 4G4YA 2GLZA 4R40B 3HKBA 3KIZA 1YJNF 3MQWA 4HNAB 5HY2A 5HY4A 2P6YA 4BT2A 1VQOF 5LOVB 5IT9M 1SA0A 5KMGB 4O4IB 2GVIA 1XV2A 4X1YB 5JCOC 4ZOLB 1SDSA 3ERNA 4BT7A 1VQLF 4I55A 4O4LA 3E22B 4O4JA 4ERHA 1M1KH 1YHQF 4DRXA 2UYNB 4LCKA 3CCLF 5A2QM 1VQPF 5J2UB 2HP3A 3IKEA 5GONA 2WALA 5CB4A 2CSLA 3F0FA 3CC7F 2R6R1 1JJ2F 2RB9A 4YJ3A 4KWEA 1W2BF 3JAWA 3P0ZA 4G4VA 3E1YA 4X1IB 2YYEA 1W40A 1YJ9F 3C9TA 5AVMA 3AGKA 3VO8A 4X3MA 3VTIC 2CWJA 3KJJA 5EO3A 3OBYA 1JD1A 3VIUA 2KG4A 3V4DA 1Z5VA 3N2KB 4O4HB 2AMTA 3ZP7A 5EZYB 1KNKA 3HAXD 3JAKB 3WGJA 5HY0A 3CMEF 3RA5A 5GONB 4EI8A 1KQSF 2F9ZC 3P10A 2VAPA 3RYFB 1VQ8F 3ZP4A 3N4ZA 1PXWA 2GZLA 2IQQA 4DRXB 4ZHQB 4DXDA 3JATB 2QTPA 4TV8B 1RLUA 2LBXA 4B62A 2OTJF 1YIJF 1K8AH 2PMPA 2CHSA 1VQ7F 1W581 3K14A 5HWEA 2HS4A 3OW2F 1JN1A 1VH8A 3M84A 3LWQC 3O85A 5J2UA 5LP6C 2CHTA 5LYJB 4BVQA 3CCJF 2ZAUA 5EB1B 3G6EF 2OZBA 1H48A 3HTNA 3VOAA 4I50A 2HRUA 2HRYA 2Q1XA 4U3JB 4IIJA 2FC3A 5BMVB 2IG8A 4G4WA 3CCSF 2HP0B 5GANK 3VYSC 2ZODA 5EZYA 2BO1A 2Z1UA 2CVLA 2I6DA 4EB6A 1VQVA 3C9RA 1W5BA 3J7AR 5IJ9B 1NQ3A 1RQ2A 2VGNA 2IAFA 1X25A 1Z5WA 2UYKA 3JASB 4M8IA 2VXYA 4U3JA 4BVSA 3Q8HA 1VQ6F 2AIFA 4X20A 4O2BB 1XHOA 3HKBB 4C8EA 3D00A 2V9YA 3WGMA 5CA0B 5EIBC 3KE1A 3LFOA 1M90H 5GAPK 3FFMA 3CPQA 3C9UA 4PWTA 1FNKA 3WGNA 5EB0A 3M1XA 2K1SA 1FFXB 1XBIA 1W57A 2DYYA 2OHWA 1QD9A 2NMUA 5MN5A 5LXTB 3JARA 1DT9A 4BW0B 5JVDA 3E20B 5LP6B 2BTOA 1JFFB 2W8BC 2HX0A 3QUWA 3F0DA 3JVHA 1W3EX 2HS0A 1XRGA 4G88A 3JAWB 3LMEA 1SZQA 5LYJA 5JH7B 1GO0A 3JCMM 3UT5A 2RHOA 1W5FA 5FLXM 3CC2F 2HS3A 3IEWA 5KX5A 3F6MA 1J7HA 3HKEB 1ZWZA 3G71F 3NVKE 3B6NA 2OTMA 5EYPA 4B46A 1H47A 1RQ7A 3LWVC 2Q1YA 3JAKA 4YJ2A 1VQMF 3FBAA 5JQGA 4RHAA 5JVDB 4ZHWA 3TD3A 4TV9A 5J2TB 3MCQA 3VYTC 3VYUC 3TD5A 4LNUB 2BTUA 3RYFA 1FFXA 3C9SA 3LWRC 2QA4F 3S0HA 3CYPB 2H8CA 3V7QA 4EB6B 4C4WC 4TV8A 4U39A 1Q7YH 1U40A 2ZVZA 1X52A 2ZVYA 4ZHQA 5DCVA 3JARB 2JNBA 4B5CA 3QHDA 3CPWF 5C8YA 2QI2A 1W42A 1TUBA 3P4EA 1X7OA 3HKDB 5ITZB 3RYHA 2Z1FA 3S0YA 1UI9A 3F0EA 3C8LA 3GTZA 1R1MA 3N2KA 3E22A 5HY1A 5HP8A 5CA1A 3GYQA 2RHHA 1GX1A 4O4JB 2AIZP 3UT5B 4WBNB 4B45A 1U3PA 5JCOA 3D54A 3RYIA 1RA4A 4O2AA 5LA6A 3JALA 3CCVF 3D01A 4TZZA 1VQ4F 2KGWA 3EORA 3J80M 1GZ0A 3G4SF 1TVKB 1S72F 1VHAA 1W41A 3U0OA 2HQSC 3KJKA 1CK2A 1COMA 5C8YB 2Z1TA 5IJ9A 5GINC 1QVGF 2N48A 5MN6A 1U3LA 3VMFB 3RYHB 5BMVA 3CXCF 3N2GB 4X1KA 4XCQA 5CA0A 4I4TB 3IEQA 2FGYA 3KHNA 4TUYA 3NK7A 3V3TA 3SIUA 3FD6A 4NUTA 3CMAF 4I50B 5KMGA 3K2XA 4X20B 5FNVB 4E6EA 5EWRA 4ZI7B 3IKFA 4C81A 3JALB 5IJ0A 1IV4A 3NMUC 5EAZA 3WJRA 1VQ9F 3HKCA 3MDOA 2I6RA 1VK3A 3S02A
chains in the Genus database with same CATH topology
3JCMM 4BVTA 1VQNF 3HAXD 3PAFA 5FLXM 5HY0A 3CMEF 3CC2F 5FJ4C 3RA5A 4EI8A 1KQSF 1N8RH 3CCMF 3OBWA 2F9ZC 1ZWZA 3G71F 3NVKE 1VQ8F 5G4UC 3N4ZA 3CD6F 1PXWA 3LWPC 1K9MH 1YITF 3LWVC 3JAMM 1VQMF 3MCAB 3PLAC 2LBXA 2OTJF 1YIJF 1K8AH 3NK6A 3I55F 1VQ7F 3ON1A 4X3LA 3CG6A 2VGMA 4BVRA 5HWEA 4EI7A 3LWRC 3OW2F 2QA4F 1K73H 1RLGA 3V7QA 3J81M 1VQKF 3V7EA 3LWQC 4C4WC 3O85A 3VI6A 2ALEA 1Q7YH 1X52A 1Q82H 1Q86H 2LBWA 4BVQA 5DCVA 2JNBA 3WXMB 2HVYD 3CCJF 3G6EF 3CCQF 2OZBA 3CPWF 2QEXF 2QI2A 1H7MA 1W42A 5GIOC 2KTUA 1KD1H 4BY9D 1X7OA 3I56F 4EI9A 1YJWF 3NVIB 3LWOC 3N4YA 2FC3A 1Q81H 4NQ3A 3CCEF 3CCSF 5HY1A 5GANK 2OTLF 1YI2F 3GYQA 3CCUF 1YJNF 2GLZA 2BO1A 5HXUA 5HY2A 1CN7A 5HY4A 2I6DA 1VQOF 1RA4A 5IT9M 3J7AR 1NJIH 2VGNA 3CCVF 4TZZA 5HXZA 1VQ4F 3CCRF 3J80M 1QVFF 1GZ0A 3G4SF 1S72F 1SDSA 1VQ6F 4BVSA 2AIFA 1VQLF 1E7KA 1W41A 1CK2A 3D00A 1KC8H 1M1KH 1YHQF 5GIPC 3SIVA 5GINC 1QVGF 3RA6A 4LCKA 3LFOA 3VMFB 5A2QM 3CCLF 1M90H 1VQPF 5GAPK 3FFMA 1X7PA 3CPQA 4XCQA 3CXCF 2WALA 1NMUB 2CZWA 2FGYA 3IR9A 3NK7A 3CC4F 3V3TA 3CC7F 3SIUA 4NUTA 3CMAF 1JJ2F 1IPAA 1XBIA 1W2BF 3E1YA 2OHWA 1W40A 1YJ9F 1T0KB 1VQ5F 1DT9A 4BW0B 3HJWC 1GO1A 5EWRA 3AGKA 4X3MA 3E20B 5EO3A 3NMUC 1W3EX 3OBYA 5G4VC 1VQ9F 2KG4A 1GO0A 2KTVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCM M;  1VQN F;  3HAX D;  3PAF A;  5FLX M;  3CME F;  5FJ4 C;  3CC2 F;  3RA5 A;  1KQS F;  1N8R H;  3CCM F;  3OBW A;  1ZWZ A;  3G71 F;  3NVK E;  1VQ8 F;  5G4U C;  3N4Z A;  3CD6 F;  1PXW A;  3LWP C;  1K9M H;  1YIT F;  3LWV C;  3JAM M;  1VQM F;  3MCA B;  3PLA C;  2LBX A;  2OTJ F;  1YIJ F;  1K8A H;  3NK6 A;  3I55 F;  1VQ7 F;  3ON1 A;  4X3L A;  3CG6 A;  2VGM A;  3LWR C;  3OW2 F;  2QA4 F;  1K73 H;  1RLG A;  3V7Q A;  3J81 M;  1VQK F;  3V7E A;  3LWQ C;  4C4W C;  3O85 A;  3VI6 A;  2ALE A;  1Q7Y H;  1X52 A;  1Q82 H;  1Q86 H;  2LBW A;  5DCV A;  2JNB A;  3WXM B;  2HVY D;  3CCJ F;  3G6E F;  3CCQ F;  2OZB A;  3CPW F;  2QEX F;  2QI2 A;  1H7M A;  1W42 A;  5GIO C;  2KTU A;  1KD1 H;  4BY9 D;  1X7O A;  3I56 F;  1YJW F;  3NVI B;  3LWO C;  3N4Y A;  2FC3 A;  1Q81 H;  3CCE F;  3CCS F;  5GAN K;  2OTL F;  1YI2 F;  3GYQ A;  3CCU F;  1YJN F;  2BO1 A;  1CN7 A;  2I6D A;  1VQO F;  1RA4 A;  5IT9 M;  3J7A R;  1NJI H;  2VGN A;  3CCV F;  4TZZ A;  1VQ4 F;  3CCR F;  3J80 M;  1QVF F;  1GZ0 A;  3G4S F;  1S72 F;  1SDS A;  1VQ6 F;  2AIF A;  1VQL F;  1E7K A;  1W41 A;  1CK2 A;  1KC8 H;  1M1K H;  1YHQ F;  5GIP C;  3SIV A;  5GIN C;  1QVG F;  3RA6 A;  4LCK A;  3LFO A;  3VMF B;  5A2Q M;  3CCL F;  1M90 H;  1VQP F;  5GAP K;  3FFM A;  1X7P A;  3CPQ A;  3CXC F;  2WAL A;  1NMU B;  2CZW A;  3IR9 A;  3NK7 A;  3CC4 F;  3CC7 F;  3SIU A;  4NUT A;  3CMA F;  1JJ2 F;  1IPA A;  1XBI A;  1W2B F;  3E1Y A;  2OHW A;  1W40 A;  1YJ9 F;  1T0K B;  1VQ5 F;  1DT9 A;  4BW0 B;  3HJW C;  1GO1 A;  5EWR A;  3AGK A;  4X3M A;  3E20 B;  5EO3 A;  3NMU C;  1W3E X;  3OBY A;  5G4V C;  1VQ9 F;  2KG4 A;  1GO0 A;  2KTV A; 
#chains in the Genus database with same CATH topology
 1VQN F;  5FJ4 C;  4I4T A;  1N8R H;  3CCM F;  3K12 A;  4O4H A;  1TUB B;  3ELC A;  3I3F A;  3OON A;  3CD6 F;  4BT3 A;  1IV2 A;  1YIT F;  2ZF8 A;  4F6R A;  3JAM M;  3MCA B;  3WPX A;  3WJQ A;  5JQG B;  3CYQ A;  1ODE A;  3IMP A;  3I55 F;  1DBF A;  5IJ0 B;  4FFB B;  4X3L A;  4LNU A;  2VGM A;  3HKC B;  4EI7 A;  3HKE A;  1CLI A;  2ZOV A;  3DDN A;  5LOV A;  4BT4 A;  1K73 H;  1RLG A;  3J81 M;  1VQK F;  1OAP A;  3N2G A;  4X1K B;  3VI6 A;  3K0T A;  2ALE A;  4ZI7 A;  1T0A A;  2BTQ B;  4X1Y A;  1Q82 H;  1Q86 H;  2LBW A;  4ZHV A;  1IV3 A;  1KNJ A;  5J2T A;  3LDT A;  3FPI A;  2KTU A;  5LP6 A;  4BY9 D;  2RHJ A;  3JAT A;  3I56 F;  3WPW A;  3LWO C;  1FSZ A;  2L26 A;  1YQN A;  5EYP B;  3DC2 A;  4IHJ A;  3FD5 A;  4O4I A;  3CCE F;  1OFU A;  4IIJ B;  4NWO B;  4ZOL A;  3S03 A;  5HP7 A;  1W59 A;  5HXU A;  4HNA A;  5ITZ A;  3GHZ A;  4I55 B;  3F0G A;  4O4L B;  1CN7 A;  2R75 1;  3M4S A;  1W5A A;  5EIB D;  1UFY A;  1SA0 B;  4O2A B;  5LA6 B;  1NJI H;  2RHL A;  4G4X A;  4O2B A;  3WGK A;  1JY8 A;  3R0P A;  5HXZ A;  3CCR F;  1QVF F;  4ZHY B;  1TVK A;  3I7T A;  4X1I A;  2H6L A;  2Z1E A;  3WGL A;  1E7K A;  2LBT A;  2UYN A;  4YJ3 B;  4IHJ B;  2H8E A;  2MQE A;  4FFB A;  3BYQ A;  1KC8 H;  3SIV A;  4C8I A;  5GIP C;  2HP0 A;  2UZH A;  2DT4 A;  3RA6 A;  5B8F A;  3T80 A;  2UYJ A;  1FNJ A;  4C8G A;  1X7P A;  2B33 A;  1NMU B;  2CZW A;  3IR9 A;  3RE3 A;  3S0W A;  3RYC A;  3CC4 F;  1IPA A;  3HWU A;  1W55 A;  3VCZ A;  4BT6 A;  2UYP A;  3RYI B;  3WJP A;  1T0K B;  3S06 A;  1VQ5 F;  3HJW C;  1PF5 A;  1GO1 A;  2YXZ A;  5CA1 B;  5LXT A;  5G4V C;  1QU9 A;  3LYB A;  2KTV A;  4BVT A;  3PAF A;  3ESJ A;  2VAM A;  4RQO A;  5FNV A;  3OBW A;  1Q8R A;  4YJ2 B;  2Z01 A;  5IYZ B;  5G4U C;  3LWP C;  1K9M H;  4TUY B;  3VOB A;  3PLA C;  3HKD A;  2CW4 A;  3MBM A;  1IV1 A;  4ZK7 A;  3CB2 A;  3NK6 A;  4C82 A;  3JAS A;  1YGY A;  5MN4 A;  5JH7 A;  3ON1 A;  3CG6 A;  4BT5 A;  4BVR A;  3L7Q A;  1W5E A;  4G4Z A;  4TV9 B;  5KX5 B;  3RYC B;  3QTY A;  3V7E A;  1QAH A;  3TD4 A;  4F6R B;  4WBN A;  3ZOP A;  3WXM B;  2HVY D;  3CCQ F;  3ZO8 A;  2QEX F;  1H7M A;  5GIO C;  1KD1 H;  1U43 A;  1ONI A;  4EI9 A;  1YJW F;  3NVI B;  2G9I A;  5CB4 B;  3N4Y A;  5IYZ A;  2PHN A;  1Q81 H;  4NQ3 A;  2LCA A;  2OTL F;  1YI2 F;  1JFF A;  2EWC A;  2VAW A;  3CCU F;  4G4Y A;  2GLZ A;  4R40 B;  3HKB A;  3KIZ A;  1YJN F;  3MQW A;  4HNA B;  5HY2 A;  5HY4 A;  2P6Y A;  4BT2 A;  1VQO F;  5LOV B;  5IT9 M;  1SA0 A;  5KMG B;  4O4I B;  2GVI A;  1XV2 A;  4X1Y B;  5JCO C;  4ZOL B;  1SDS A;  3ERN A;  4BT7 A;  1VQL F;  4I55 A;  4O4L A;  3E22 B;  4O4J A;  4ERH A;  1M1K H;  1YHQ F;  4DRX A;  2UYN B;  4LCK A;  3CCL F;  5A2Q M;  1VQP F;  5J2U B;  2HP3 A;  3IKE A;  5GON A;  2WAL A;  5CB4 A;  2CSL A;  3F0F A;  3CC7 F;  2R6R 1;  1JJ2 F;  2RB9 A;  4YJ3 A;  4KWE A;  1W2B F;  3JAW A;  3P0Z A;  4G4V A;  3E1Y A;  4X1I B;  2YYE A;  1W40 A;  1YJ9 F;  3C9T A;  5AVM A;  3AGK A;  3VO8 A;  4X3M A;  3VTI C;  2CWJ A;  3KJJ A;  5EO3 A;  3OBY A;  1JD1 A;  3VIU A;  2KG4 A;  3V4D A;  1Z5V A;  3N2K B;  4O4H B;  2AMT A;  3ZP7 A;  5EZY B;  1KNK A;  3HAX D;  3JAK B;  3WGJ A;  5HY0 A;  3CME F;  3RA5 A;  5GON B;  4EI8 A;  1KQS F;  2F9Z C;  3P10 A;  2VAP A;  3RYF B;  1VQ8 F;  3ZP4 A;  3N4Z A;  1PXW A;  2GZL A;  2IQQ A;  4DRX B;  4ZHQ B;  4DXD A;  3JAT B;  2QTP A;  4TV8 B;  1RLU A;  2LBX A;  4B62 A;  2OTJ F;  1YIJ F;  1K8A H;  2PMP A;  2CHS A;  1VQ7 F;  1W58 1;  3K14 A;  5HWE A;  2HS4 A;  3OW2 F;  1JN1 A;  1VH8 A;  3M84 A;  3LWQ C;  3O85 A;  5J2U A;  5LP6 C;  2CHT A;  5LYJ B;  4BVQ A;  3CCJ F;  2ZAU A;  5EB1 B;  3G6E F;  2OZB A;  1H48 A;  3HTN A;  3VOA A;  4I50 A;  2HRU A;  2HRY A;  2Q1X A;  4U3J B;  4IIJ A;  2FC3 A;  5BMV B;  2IG8 A;  4G4W A;  3CCS F;  2HP0 B;  5GAN K;  3VYS C;  2ZOD A;  5EZY A;  2BO1 A;  2Z1U A;  2CVL A;  2I6D A;  4EB6 A;  1VQV A;  3C9R A;  1W5B A;  3J7A R;  5IJ9 B;  1NQ3 A;  1RQ2 A;  2VGN A;  2IAF A;  1X25 A;  1Z5W A;  2UYK A;  3JAS B;  4M8I A;  2VXY A;  4U3J A;  4BVS A;  3Q8H A;  1VQ6 F;  2AIF A;  4X20 A;  4O2B B;  1XHO A;  3HKB B;  4C8E A;  3D00 A;  2V9Y A;  3WGM A;  5CA0 B;  5EIB C;  3KE1 A;  3LFO A;  1M90 H;  5GAP K;  3FFM A;  3CPQ A;  3C9U A;  4PWT A;  1FNK A;  3WGN A;  5EB0 A;  3M1X A;  2K1S A;  1FFX B;  1XBI A;  1W57 A;  2DYY A;  2OHW A;  1QD9 A;  2NMU A;  5MN5 A;  5LXT B;  3JAR A;  1DT9 A;  4BW0 B;  5JVD A;  3E20 B;  5LP6 B;  2BTO A;  1JFF B;  2W8B C;  2HX0 A;  3QUW A;  3F0D A;  3JVH A;  1W3E X;  2HS0 A;  1XRG A;  4G88 A;  3JAW B;  3LME A;  1SZQ A;  5LYJ A;  5JH7 B;  1GO0 A;  3JCM M;  3UT5 A;  2RHO A;  1W5F A;  5FLX M;  3CC2 F;  2HS3 A;  3IEW A;  5KX5 A;  3F6M A;  1J7H A;  3HKE B;  1ZWZ A;  3G71 F;  3NVK E;  3B6N A;  2OTM A;  5EYP A;  4B46 A;  1H47 A;  1RQ7 A;  3LWV C;  2Q1Y A;  3JAK A;  4YJ2 A;  1VQM F;  3FBA A;  5JQG A;  4RHA A;  5JVD B;  4ZHW A;  3TD3 A;  4TV9 A;  5J2T B;  3MCQ A;  3VYT C;  3VYU C;  3TD5 A;  4LNU B;  2BTU A;  3RYF A;  1FFX A;  3C9S A;  3LWR C;  2QA4 F;  3S0H A;  3CYP B;  2H8C A;  3V7Q A;  4EB6 B;  4C4W C;  4TV8 A;  4U39 A;  1Q7Y H;  1U40 A;  2ZVZ A;  1X52 A;  2ZVY A;  4ZHQ A;  5DCV A;  3JAR B;  2JNB A;  4B5C A;  3QHD A;  3CPW F;  5C8Y A;  2QI2 A;  1W42 A;  1TUB A;  3P4E A;  1X7O A;  3HKD B;  5ITZ B;  3RYH A;  2Z1F A;  3S0Y A;  1UI9 A;  3F0E A;  3C8L A;  3GTZ A;  1R1M A;  3N2K A;  3E22 A;  5HY1 A;  5HP8 A;  5CA1 A;  3GYQ A;  2RHH A;  1GX1 A;  4O4J B;  2AIZ P;  3UT5 B;  4WBN B;  4B45 A;  1U3P A;  5JCO A;  3D54 A;  3RYI A;  1RA4 A;  4O2A A;  5LA6 A;  3JAL A;  3CCV F;  3D01 A;  4TZZ A;  1VQ4 F;  2KGW A;  3EOR A;  3J80 M;  1GZ0 A;  3G4S F;  1TVK B;  1S72 F;  1VHA A;  1W41 A;  3U0O A;  2HQS C;  3KJK A;  1CK2 A;  1COM A;  5C8Y B;  2Z1T A;  5IJ9 A;  5GIN C;  1QVG F;  2N48 A;  5MN6 A;  1U3L A;  3VMF B;  3RYH B;  5BMV A;  3CXC F;  3N2G B;  4X1K A;  4XCQ A;  5CA0 A;  4I4T B;  3IEQ A;  2FGY A;  3KHN A;  4TUY A;  3NK7 A;  3V3T A;  3SIU A;  3FD6 A;  4NUT A;  3CMA F;  4I50 B;  5KMG A;  3K2X A;  4X20 B;  5FNV B;  4E6E A;  5EWR A;  4ZI7 B;  3IKF A;  4C81 A;  3JAL B;  5IJ0 A;  1IV4 A;  3NMU C;  5EAZ A;  3WJR A;  1VQ9 F;  3HKC A;  3MDO A;  2I6R A;  1VK3 A;  3S02 A; 
#chains in the Genus database with same CATH homology
 3JCM M;  4BVT A;  1VQN F;  3HAX D;  3PAF A;  5FLX M;  5HY0 A;  3CME F;  3CC2 F;  5FJ4 C;  3RA5 A;  4EI8 A;  1KQS F;  1N8R H;  3CCM F;  3OBW A;  2F9Z C;  1ZWZ A;  3G71 F;  3NVK E;  1VQ8 F;  5G4U C;  3N4Z A;  3CD6 F;  1PXW A;  3LWP C;  1K9M H;  1YIT F;  3LWV C;  3JAM M;  1VQM F;  3MCA B;  3PLA C;  2LBX A;  2OTJ F;  1YIJ F;  1K8A H;  3NK6 A;  3I55 F;  1VQ7 F;  3ON1 A;  4X3L A;  3CG6 A;  2VGM A;  4BVR A;  5HWE A;  4EI7 A;  3LWR C;  3OW2 F;  2QA4 F;  1K73 H;  1RLG A;  3V7Q A;  3J81 M;  1VQK F;  3V7E A;  3LWQ C;  4C4W C;  3O85 A;  3VI6 A;  2ALE A;  1Q7Y H;  1X52 A;  1Q82 H;  1Q86 H;  2LBW A;  4BVQ A;  5DCV A;  2JNB A;  3WXM B;  2HVY D;  3CCJ F;  3G6E F;  3CCQ F;  2OZB A;  3CPW F;  2QEX F;  2QI2 A;  1H7M A;  1W42 A;  5GIO C;  2KTU A;  1KD1 H;  4BY9 D;  1X7O A;  3I56 F;  4EI9 A;  1YJW F;  3NVI B;  3LWO C;  3N4Y A;  2FC3 A;  1Q81 H;  4NQ3 A;  3CCE F;  3CCS F;  5HY1 A;  5GAN K;  2OTL F;  1YI2 F;  3GYQ A;  3CCU F;  1YJN F;  2GLZ A;  2BO1 A;  5HXU A;  5HY2 A;  1CN7 A;  5HY4 A;  2I6D A;  1VQO F;  1RA4 A;  5IT9 M;  3J7A R;  1NJI H;  2VGN A;  3CCV F;  4TZZ A;  5HXZ A;  1VQ4 F;  3CCR F;  3J80 M;  1QVF F;  1GZ0 A;  3G4S F;  1S72 F;  1SDS A;  1VQ6 F;  4BVS A;  2AIF A;  1VQL F;  1E7K A;  1W41 A;  1CK2 A;  3D00 A;  1KC8 H;  1M1K H;  1YHQ F;  5GIP C;  3SIV A;  5GIN C;  1QVG F;  3RA6 A;  4LCK A;  3LFO A;  3VMF B;  5A2Q M;  3CCL F;  1M90 H;  1VQP F;  5GAP K;  3FFM A;  1X7P A;  3CPQ A;  4XCQ A;  3CXC F;  2WAL A;  1NMU B;  2CZW A;  2FGY A;  3IR9 A;  3NK7 A;  3CC4 F;  3V3T A;  3CC7 F;  3SIU A;  4NUT A;  3CMA F;  1JJ2 F;  1IPA A;  1XBI A;  1W2B F;  3E1Y A;  2OHW A;  1W40 A;  1YJ9 F;  1T0K B;  1VQ5 F;  1DT9 A;  4BW0 B;  3HJW C;  1GO1 A;  5EWR A;  3AGK A;  4X3M A;  3E20 B;  5EO3 A;  3NMU C;  1W3E X;  3OBY A;  5G4V C;  1VQ9 F;  2KG4 A;  1GO0 A;  2KTV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...