3CCQF

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ccqF00
3OW2F 5GIOC 5IT9M 3CD6F 1GZ0A 4BY9D 1K8AH 2OTLF 2OTJF 2WALA 3LWPC 2KG4A 4X3MA 1M90H 2BO1A 1YI2F 1W40A 3G71F 5EWRA 4NUTA 4X3LA 2QEXF 3CCLF 1NJIH 3CCRF 3O85A 3LWVC 3VMFB 1CK2A 3V7QA 1X7PA 2KTUA 1T0KB 3J7AR 2KTVA 3E20B 1K9MH 1YJNF 3PAFA 3NVIB 5GIPC 1S72F 3CCVF 3NMUC 1ZWZA 3OBYA 1H7MA 1Q82H 1CN7A 2LBWA 1GO0A 3HJWC 1PXWA 3WXMB 3CPQA 1N8RH 2VGNA 1VQNF 1M1KH 1Q86H 2JNBA 3CCJF 2QI2A 5EO3A 1XBIA 3JAMM 1VQPF 2ALEA 1VQOF 2LBXA 1W41A 2CZWA 5FLXM 1RLGA 1GO1A 3CXCF 3VI6A 2OHWA 4TZZA 1IPAA 3CCSF 1YHQF 5A2QM 1YJ9F 1VQ4F 5GANK 1SDSA 1KC8H 3RA6A 5G4VC 1VQMF 3LWRC 1QVFF 1K73H 2FC3A 5FJ4C 3HAXD 1W42A 3NK7A 1Q7YH 3CMEF 3OBWA 1VQ9F 3LWOC 5GAPK 3PLAC 3I56F 3CCQF 3SIUA 3LWQC 1Q81H 3AGKA 2I6DA 2HVYD 3NVKE 4LCKA 1X52A 3LFOA 4C4WC 1VQ8F 1YJWF 1VQKF 5G4UC 2VGMA 4BW0B 3RA5A 1E7KA 3V7EA 1VQLF 3SIVA 3N4ZA 3G6EF 1YIJF 1RA4A 3CPWF 3CMAF 1JJ2F 1VQ7F 3NK6A 5GINC 1VQ5F 2AIFA 3GYQA 3CCMF 3J81M 3FFMA 1QVGF 1VQ6F 3MCAB 2OZBA 1KQSF 1W3EX 1YITF 1DT9A 5DCVA 3E1YA 2QA4F 3N4YA 3JCMM 3I55F 1NMUB 3ON1A 3CC2F 3CCEF 3CC4F 3CCUF 3CG6A 3IR9A 3G4SF 3CC7F 3J80M 1W2BF 1KD1H 1X7OA
chains in the Genus database with same CATH superfamily
3OW2F 3CD6F 1QU9A 2FGYA 3IEWA 4ZHVA 5IJ9A 1VK3A 5JQGB 1YI2F 4O4LA 4BT7A 2F9ZC 4X3LA 4I50A 4EI9A 2PHNA 3O85A 4IHJB 4X1IB 2KTUA 2CVLA 1T0KB 4HNAB 4EI7A 3WJQA 2KTVA 4E6EA 1FFXB 4G4VA 4NWOB 1YJNF 3L7QA 4I55A 3NMUC 1TVKA 1J7HA 3OBYA 3JAWB 4YJ3A 2UYNA 4R40B 3RYHA 3UT5B 3EORA 4B62A 2IG8A 2RHOA 2LBWA 3CYPB 1GO0A 2BTQB 4FFBB 3WXMB 3JVHA 5LA6A 1VQNF 5HXZA 5EYPB 5MN5A 5KX5A 1Q86H 2QI2A 4U3JB 4I50B 1VQPF 2Z01A 2LBXA 4O4LB 4EB6A 2RB9A 5IYZA 3F0FA 2R6R1 5ITZB 2CSLA 1FNKA 1UI9A 5A2QM 5EIBD 4IIJA 2W8BC 5EZYB 3HKBB 3TD3A 5J2UA 5G4VC 5KMGB 2ZVYA 1QVFF 3B6NA 3C9UA 4O4JA 2KGWA 5HY2A 3RYIA 2CHTA 3NK7A 4IIJB 3I7TA 4EI8A 3CMEF 1DBFA 1TUBA 2VAPA 3ESJA 4ZK7A 4EB6B 1YQNA 3WGMA 4BVSA 4X20A 2HVYD 4LCKA 2L26A 3F0GA 2PMPA 2RHJA 1H48A 4C4WC 3HKCA 4O2BB 5GONA 4FFBA 1VQKF 5G4UC 4BW0B 3UT5A 2UYNB 4F6RA 4TV8A 5J2TA 3HWUA 5BMVB 3HKDB 3VIUA 3V3TA 4C8IA 3RYFB 3FD5A 2HP0B 3GHZA 2HRUA 3Q8HA 4BT2A 1QD9A 2P6YA 2N48A 3WGNA 3GYQA 3M4SA 2OZBA 4BVRA 1YITF 1DT9A 3JALA 4ZHQA 4BT6A 4O4IA 4X1KB 1PF5A 1IV4A 2Q1YA 3I55F 2YXZA 2Z1FA 1W59A 5KMGA 5EIBC 1SA0B 3K0TA 3CC7F 4M8IA 3J80M 1KD1H 4O4HA 3KE1A 3DDNA 4HNAA 5IT9M 3FD6A 2OTLF 1ODEA 3ZOPA 3LWPC 5ITZA 1M90H 2BO1A 4DRXA 3IKFA 2QTPA 3G71F 4NUTA 2ZOVA 2QEXF 1NJIH 3CCRF 3VMFB 5EB0A 1X7PA 5LA6B 2MQEA 3U0OA 5HY0A 3PAFA 1VH8A 4X1YA 4YJ3B 1ZWZA 4XCQA 3S0HA 4BT5A 5LOVB 2UYKA 4TUYB 5HP8A 4O4IB 4X1KA 3WGLA 1VHAA 4B46A 1M1KH 4IHJA 3P4EA 1VQOF 5CB4A 5FLXM 2VAWA 1GO1A 4TZZA 2OHWA 1IPAA 1YHQF 2EWCA 4ZHYB 4TV9B 3JATA 1YJ9F 4B5CA 5J2TB 1VQ4F 4F6RB 1W57A 1W581 5JCOA 2GZLA 2HP3A 2FC3A 3KIZA 3S06A 1W42A 3I3FA 3JARB 5LYJB 3OBWA 4ERHA 3I56F 3SIUA 1H47A 3AGKA 4G4ZA 3V4DA 1KNKA 1X52A 2UYJA 3WGJA 3N2GB 2B33A 4WBNA 1YJWF 1E7KA 2CHSA 3RA5A 5HY1A 3WPXA 4C81A 4YJ2A 2G9IA 3CPWF 3ZO8A 1RQ7A 5IJ0B 2Z1EA 3NK6A 1XV2A 3JATB 1IV1A 5LXTA 2AIFA 1QVGF 3J81M 3MCAB 3VOBA 3F0EA 3K14A 5DCVA 4I4TA 3TD4A 3N4YA 3ON1A 3CCEF 3JAWA 3E22B 3N2KB 1X25A 3CC4F 1TVKB 3IR9A 4B45A 2BTOA 1XRGA 3P0ZA 4ZOLA 3VYSC 3JASB 1FFXA 5C8YB 1GZ0A 2AIZP 1K8AH 2ZAUA 4BY9D 2OTJF 2WALA 3KHNA 5LP6A 4LNUA 1U3LA 2CW4A 2Z1TA 1W40A 1KNJA 2HQSC 5EWRA 5JQGA 1CK2A 2IAFA 4LNUB 2ZF8A 4C8GA 1W5EA 2BTUA 3C9TA 3VCZA 3J7AR 3E20B 1K9MH 5C8YA 3NVIB 2H6LA 4U39A 3CCVF 1H7MA 5FNVA 2HX0A 1Q82H 1Z5WA 1U40A 1NQ3A 1CN7A 4WBNB 4PWTA 1T0AA 1PXWA 1N8RH 1JFFB 5HP7A 2JNBA 3CCJF 5EO3A 1XBIA 3JALB 4ZHQB 3WJRA 1JN1A 1JD1A 1SZQA 3JAKB 1W41A 3ZP4A 3M84A 3CXCF 3VI6A 3CCSF 3C8LA 1R1MA 5LYJA 3DC2A 3JARA 5IJ0A 4ZHWA 4ZOLB 5GANK 1KC8H 3RA6A 5JH7A 3E22A 3S0WA 1VQMF 1K73H 3BYQA 4C8EA 5FJ4C 4O2AB 3N2GA 3F0DA 3HKCB 3P10A 4G4WA 5EAZA 1IV2A 1W5BA 2HS0A 2I6RA 3OONA 3VYUC 4ZI7B 3LYBA 3RYCA 5CA0A 1VQ9F 5GAPK 3CCQF 3S03A 5CA0B 3VO8A 4ZI7A 1Q81H 1TUBB 2HS4A 5B8FA 3NVKE 2HRYA 3LFOA 1CLIA 1JFFA 3QHDA 3ELCA 2VGMA 3MDOA 4BVQA 2AMTA 1QAHA 3T80A 3SIVA 2IQQA 3N4ZA 1JY8A 3G6EF 1YIJF 1RA4A 2GVIA 3KJKA 3IKEA 3QTYA 3FPIA 3CMAF 1JJ2F 2YYEA 2GLZA 1VQ7F 5GINC 4TV9A 3JAKA 1VQ6F 2LBTA 1UFYA 3WPWA 3CCMF 3F6MA 1KQSF 3K12A 2R751 2H8CA 4DRXB 1OAPA 5EYPA 4O2AA 5MN6A 3E1YA 2QA4F 3TD5A 3JASA 3CC2F 3FBAA 1Z5VA 5JH7B 1Q8RA 3C9SA 3CG6A 3M1XA 1SA0A 3G4SF 1XHOA 1W2BF 3KJJA 1FSZA 2ZVZA 5GIOC 4I4TB 4G88A 4NQ3A 2KG4A 1RQ2A 4X3MA 4X1IA 3RE3A 3ERNA 3QUWA 3CCLF 3K2XA 3LWVC 5LP6B 4BVTA 3V7QA 1U3PA 2DT4A 2HS3A 2RHLA 3RYFA 3MQWA 3HKDA 5GIPC 1OFUA 1S72F 1FNJA 5FNVB 5LOVA 4RQOA 4X1YB 4YJ2B 5JCOC 5CA1A 3HJWC 1VQVA 3CPQA 2VGNA 3IMPA 3D00A 1YGYA 3JAMM 4G4XA 2H8EA 2ALEA 4X20B 2CZWA 5JVDB 1RLGA 2V9YA 2HP0A 3VTIC 1SDSA 4O4HB 5HWEA 4TV8B 3N2KA 4BT4A 2ZODA 3MCQA 3IEQA 3LWRC 2DYYA 3HKEA 2VXYA 3HKBA 2OTMA 3HAXD 1U43A 3HTNA 5EZYA 2VAMA 4RHAA 5AVMA 1Q7YH 3LWOC 2CWJA 3PLAC 5LP6C 1IV3A 5LXTB 3CYQA 4DXDA 3RYCB 3LWQC 2I6DA 3CB2A 3WGKA 2Z1UA 4U3JA 1W5FA 1W55A 2UZHA 3S02A 5BMVA 3D01A 4G4YA 3RYIB 1VQ8F 4O4JB 3C9RA 4KWEA 2UYPA 3GTZA 3HKEB 3V7EA 2RHHA 1VQLF 3R0PA 5HXUA 5J2UB 4O2BA 4I55B 5GONB 2LCAA 3LDTA 3LMEA 3S0YA 5MN4A 1COMA 5HY4A 1VQ5F 5CB4B 3FFMA 5IYZB 5JVDA 1W3EX 2NMUA 3ZP7A 1W5AA 3D54A 3MBMA 2Q1XA 1GX1A 5IJ9B 5KX5B 4C82A 3VOAA 3JCMM 1NMUB 2K1SA 4TUYA 5CA1B 4BT3A 3CCUF 3RYHB 5EB1B 3VYTC 1X7OA 1ONIA 1RLUA 3WJPA
chains in the Genus database with same CATH topology
3OW2F 5GIOC 5IT9M 3CD6F 1GZ0A 4BY9D 2FGYA 1K8AH 2OTLF 2OTJF 2WALA 3LWPC 4NQ3A 2KG4A 4X3MA 1M90H 2BO1A 1YI2F 1W40A 3G71F 5EWRA 4NUTA 2F9ZC 4X3LA 2QEXF 4EI9A 3CCLF 3CCRF 1NJIH 3O85A 3LWVC 3VMFB 1CK2A 3V7QA 4BVTA 1X7PA 2KTUA 1T0KB 4EI7A 3J7AR 2KTVA 3E20B 1K9MH 1YJNF 5HY0A 3PAFA 3NVIB 5GIPC 1S72F 3CCVF 3NMUC 1ZWZA 4XCQA 3OBYA 1H7MA 1Q82H 1CN7A 2LBWA 1GO0A 3HJWC 1PXWA 3WXMB 3CPQA 1N8RH 2VGNA 1VQNF 5HXZA 1M1KH 1Q86H 2JNBA 3CCJF 3D00A 2QI2A 5EO3A 1XBIA 3JAMM 1VQPF 2ALEA 1VQOF 2LBXA 1W41A 2CZWA 5FLXM 1RLGA 1GO1A 3CXCF 3VI6A 2OHWA 4TZZA 1IPAA 3CCSF 1YHQF 5A2QM 1YJ9F 1VQ4F 5GANK 1SDSA 1KC8H 3RA6A 5HWEA 5G4VC 1VQMF 3LWRC 1QVFF 1K73H 2FC3A 5FJ4C 3HAXD 5HY2A 1W42A 3NK7A 1Q7YH 4EI8A 3CMEF 3OBWA 1VQ9F 3LWOC 5GAPK 3PLAC 3I56F 3CCQF 3SIUA 3LWQC 4BVSA 1Q81H 3AGKA 2I6DA 2HVYD 3NVKE 4LCKA 1X52A 3LFOA 4C4WC 1VQ8F 1YJWF 1VQKF 5G4UC 2VGMA 4BW0B 3RA5A 1E7KA 5HY1A 1VQLF 4BVQA 3V7EA 5HXUA 3SIVA 3N4ZA 3G6EF 1YIJF 1RA4A 3CPWF 3V3TA 3CMAF 1JJ2F 2GLZA 3NK6A 5HY4A 1VQ7F 5GINC 1VQ5F 2AIFA 3GYQA 3CCMF 3J81M 3FFMA 1QVGF 1VQ6F 3MCAB 2OZBA 1KQSF 1W3EX 4BVRA 1YITF 1DT9A 5DCVA 3E1YA 2QA4F 3N4YA 3JCMM 3I55F 1NMUB 3ON1A 3CC2F 3CCEF 3CC4F 3CCUF 3CG6A 3IR9A 3G4SF 3CC7F 3J80M 1W2BF 1KD1H 1X7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 F;  5GIO C;  5IT9 M;  3CD6 F;  1GZ0 A;  4BY9 D;  1K8A H;  2OTL F;  2OTJ F;  2WAL A;  3LWP C;  2KG4 A;  4X3M A;  1M90 H;  2BO1 A;  1YI2 F;  1W40 A;  3G71 F;  5EWR A;  4NUT A;  4X3L A;  2QEX F;  3CCL F;  1NJI H;  3CCR F;  3O85 A;  3LWV C;  3VMF B;  1CK2 A;  3V7Q A;  1X7P A;  2KTU A;  1T0K B;  3J7A R;  2KTV A;  3E20 B;  1K9M H;  1YJN F;  3PAF A;  3NVI B;  5GIP C;  1S72 F;  3CCV F;  3NMU C;  1ZWZ A;  3OBY A;  1H7M A;  1Q82 H;  1CN7 A;  2LBW A;  1GO0 A;  3HJW C;  1PXW A;  3WXM B;  3CPQ A;  1N8R H;  2VGN A;  1VQN F;  1M1K H;  1Q86 H;  2JNB A;  3CCJ F;  2QI2 A;  5EO3 A;  1XBI A;  3JAM M;  1VQP F;  2ALE A;  1VQO F;  2LBX A;  1W41 A;  2CZW A;  5FLX M;  1RLG A;  1GO1 A;  3CXC F;  3VI6 A;  2OHW A;  4TZZ A;  1IPA A;  3CCS F;  1YHQ F;  5A2Q M;  1YJ9 F;  1VQ4 F;  5GAN K;  1SDS A;  1KC8 H;  3RA6 A;  5G4V C;  1VQM F;  3LWR C;  1QVF F;  1K73 H;  2FC3 A;  5FJ4 C;  3HAX D;  1W42 A;  3NK7 A;  1Q7Y H;  3CME F;  3OBW A;  1VQ9 F;  3LWO C;  5GAP K;  3PLA C;  3I56 F;  3CCQ F;  3SIU A;  3LWQ C;  1Q81 H;  3AGK A;  2I6D A;  2HVY D;  3NVK E;  4LCK A;  1X52 A;  3LFO A;  4C4W C;  1VQ8 F;  1YJW F;  1VQK F;  5G4U C;  2VGM A;  4BW0 B;  3RA5 A;  1E7K A;  3V7E A;  1VQL F;  3SIV A;  3N4Z A;  3G6E F;  1YIJ F;  1RA4 A;  3CPW F;  3CMA F;  1JJ2 F;  1VQ7 F;  3NK6 A;  5GIN C;  1VQ5 F;  2AIF A;  3GYQ A;  3CCM F;  3J81 M;  3FFM A;  1QVG F;  1VQ6 F;  3MCA B;  2OZB A;  1KQS F;  1W3E X;  1YIT F;  1DT9 A;  5DCV A;  3E1Y A;  2QA4 F;  3N4Y A;  3JCM M;  3I55 F;  1NMU B;  3ON1 A;  3CC2 F;  3CCE F;  3CC4 F;  3CCU F;  3CG6 A;  3IR9 A;  3G4S F;  3CC7 F;  3J80 M;  1W2B F;  1KD1 H;  1X7O A; 
#chains in the Genus database with same CATH topology
 3OW2 F;  3CD6 F;  1QU9 A;  2FGY A;  3IEW A;  4ZHV A;  5IJ9 A;  1VK3 A;  5JQG B;  1YI2 F;  4O4L A;  4BT7 A;  2F9Z C;  4X3L A;  4I50 A;  4EI9 A;  2PHN A;  3O85 A;  4IHJ B;  4X1I B;  2KTU A;  2CVL A;  1T0K B;  4HNA B;  4EI7 A;  3WJQ A;  2KTV A;  4E6E A;  1FFX B;  4G4V A;  4NWO B;  1YJN F;  3L7Q A;  4I55 A;  3NMU C;  1TVK A;  1J7H A;  3OBY A;  3JAW B;  4YJ3 A;  2UYN A;  4R40 B;  3RYH A;  3UT5 B;  3EOR A;  4B62 A;  2IG8 A;  2RHO A;  2LBW A;  3CYP B;  1GO0 A;  2BTQ B;  4FFB B;  3WXM B;  3JVH A;  5LA6 A;  1VQN F;  5HXZ A;  5EYP B;  5MN5 A;  5KX5 A;  1Q86 H;  2QI2 A;  4U3J B;  4I50 B;  1VQP F;  2Z01 A;  2LBX A;  4O4L B;  4EB6 A;  2RB9 A;  5IYZ A;  3F0F A;  2R6R 1;  5ITZ B;  2CSL A;  1FNK A;  1UI9 A;  5A2Q M;  5EIB D;  4IIJ A;  2W8B C;  5EZY B;  3HKB B;  3TD3 A;  5J2U A;  5G4V C;  5KMG B;  2ZVY A;  1QVF F;  3B6N A;  3C9U A;  4O4J A;  2KGW A;  5HY2 A;  3RYI A;  2CHT A;  3NK7 A;  4IIJ B;  3I7T A;  4EI8 A;  3CME F;  1DBF A;  1TUB A;  2VAP A;  3ESJ A;  4ZK7 A;  4EB6 B;  1YQN A;  3WGM A;  4BVS A;  4X20 A;  2HVY D;  4LCK A;  2L26 A;  3F0G A;  2PMP A;  2RHJ A;  1H48 A;  4C4W C;  3HKC A;  4O2B B;  5GON A;  4FFB A;  1VQK F;  5G4U C;  4BW0 B;  3UT5 A;  2UYN B;  4F6R A;  4TV8 A;  5J2T A;  3HWU A;  5BMV B;  3HKD B;  3VIU A;  3V3T A;  4C8I A;  3RYF B;  3FD5 A;  2HP0 B;  3GHZ A;  2HRU A;  3Q8H A;  4BT2 A;  1QD9 A;  2P6Y A;  2N48 A;  3WGN A;  3GYQ A;  3M4S A;  2OZB A;  4BVR A;  1YIT F;  1DT9 A;  3JAL A;  4ZHQ A;  4BT6 A;  4O4I A;  4X1K B;  1PF5 A;  1IV4 A;  2Q1Y A;  3I55 F;  2YXZ A;  2Z1F A;  1W59 A;  5KMG A;  5EIB C;  1SA0 B;  3K0T A;  3CC7 F;  4M8I A;  3J80 M;  1KD1 H;  4O4H A;  3KE1 A;  3DDN A;  4HNA A;  5IT9 M;  3FD6 A;  2OTL F;  1ODE A;  3ZOP A;  3LWP C;  5ITZ A;  1M90 H;  2BO1 A;  4DRX A;  3IKF A;  2QTP A;  3G71 F;  4NUT A;  2ZOV A;  2QEX F;  1NJI H;  3CCR F;  3VMF B;  5EB0 A;  1X7P A;  5LA6 B;  2MQE A;  3U0O A;  5HY0 A;  3PAF A;  1VH8 A;  4X1Y A;  4YJ3 B;  1ZWZ A;  4XCQ A;  3S0H A;  4BT5 A;  5LOV B;  2UYK A;  4TUY B;  5HP8 A;  4O4I B;  4X1K A;  3WGL A;  1VHA A;  4B46 A;  1M1K H;  4IHJ A;  3P4E A;  1VQO F;  5CB4 A;  5FLX M;  2VAW A;  1GO1 A;  4TZZ A;  2OHW A;  1IPA A;  1YHQ F;  2EWC A;  4ZHY B;  4TV9 B;  3JAT A;  1YJ9 F;  4B5C A;  5J2T B;  1VQ4 F;  4F6R B;  1W57 A;  1W58 1;  5JCO A;  2GZL A;  2HP3 A;  2FC3 A;  3KIZ A;  3S06 A;  1W42 A;  3I3F A;  3JAR B;  5LYJ B;  3OBW A;  4ERH A;  3I56 F;  3SIU A;  1H47 A;  3AGK A;  4G4Z A;  3V4D A;  1KNK A;  1X52 A;  2UYJ A;  3WGJ A;  3N2G B;  2B33 A;  4WBN A;  1YJW F;  1E7K A;  2CHS A;  3RA5 A;  5HY1 A;  3WPX A;  4C81 A;  4YJ2 A;  2G9I A;  3CPW F;  3ZO8 A;  1RQ7 A;  5IJ0 B;  2Z1E A;  3NK6 A;  1XV2 A;  3JAT B;  1IV1 A;  5LXT A;  2AIF A;  1QVG F;  3J81 M;  3MCA B;  3VOB A;  3F0E A;  3K14 A;  5DCV A;  4I4T A;  3TD4 A;  3N4Y A;  3ON1 A;  3CCE F;  3JAW A;  3E22 B;  3N2K B;  1X25 A;  3CC4 F;  1TVK B;  3IR9 A;  4B45 A;  2BTO A;  1XRG A;  3P0Z A;  4ZOL A;  3VYS C;  3JAS B;  1FFX A;  5C8Y B;  1GZ0 A;  2AIZ P;  1K8A H;  2ZAU A;  4BY9 D;  2OTJ F;  2WAL A;  3KHN A;  5LP6 A;  4LNU A;  1U3L A;  2CW4 A;  2Z1T A;  1W40 A;  1KNJ A;  2HQS C;  5EWR A;  5JQG A;  1CK2 A;  2IAF A;  4LNU B;  2ZF8 A;  4C8G A;  1W5E A;  2BTU A;  3C9T A;  3VCZ A;  3J7A R;  3E20 B;  1K9M H;  5C8Y A;  3NVI B;  2H6L A;  4U39 A;  3CCV F;  1H7M A;  5FNV A;  2HX0 A;  1Q82 H;  1Z5W A;  1U40 A;  1NQ3 A;  1CN7 A;  4WBN B;  4PWT A;  1T0A A;  1PXW A;  1N8R H;  1JFF B;  5HP7 A;  2JNB A;  3CCJ F;  5EO3 A;  1XBI A;  3JAL B;  4ZHQ B;  3WJR A;  1JN1 A;  1JD1 A;  1SZQ A;  3JAK B;  1W41 A;  3ZP4 A;  3M84 A;  3CXC F;  3VI6 A;  3CCS F;  3C8L A;  1R1M A;  5LYJ A;  3DC2 A;  3JAR A;  5IJ0 A;  4ZHW A;  4ZOL B;  5GAN K;  1KC8 H;  3RA6 A;  5JH7 A;  3E22 A;  3S0W A;  1VQM F;  1K73 H;  3BYQ A;  4C8E A;  5FJ4 C;  4O2A B;  3N2G A;  3F0D A;  3HKC B;  3P10 A;  4G4W A;  5EAZ A;  1IV2 A;  1W5B A;  2HS0 A;  2I6R A;  3OON A;  3VYU C;  4ZI7 B;  3LYB A;  3RYC A;  5CA0 A;  1VQ9 F;  5GAP K;  3CCQ F;  3S03 A;  5CA0 B;  3VO8 A;  4ZI7 A;  1Q81 H;  1TUB B;  2HS4 A;  5B8F A;  3NVK E;  2HRY A;  3LFO A;  1CLI A;  1JFF A;  3QHD A;  3ELC A;  2VGM A;  3MDO A;  4BVQ A;  2AMT A;  1QAH A;  3T80 A;  3SIV A;  2IQQ A;  3N4Z A;  1JY8 A;  3G6E F;  1YIJ F;  1RA4 A;  2GVI A;  3KJK A;  3IKE A;  3QTY A;  3FPI A;  3CMA F;  1JJ2 F;  2YYE A;  2GLZ A;  1VQ7 F;  5GIN C;  4TV9 A;  3JAK A;  1VQ6 F;  2LBT A;  1UFY A;  3WPW A;  3CCM F;  3F6M A;  1KQS F;  3K12 A;  2R75 1;  2H8C A;  4DRX B;  1OAP A;  5EYP A;  4O2A A;  5MN6 A;  3E1Y A;  2QA4 F;  3TD5 A;  3JAS A;  3CC2 F;  3FBA A;  1Z5V A;  5JH7 B;  1Q8R A;  3C9S A;  3CG6 A;  3M1X A;  1SA0 A;  3G4S F;  1XHO A;  1W2B F;  3KJJ A;  1FSZ A;  2ZVZ A;  5GIO C;  4I4T B;  4G88 A;  4NQ3 A;  2KG4 A;  1RQ2 A;  4X3M A;  4X1I A;  3RE3 A;  3ERN A;  3QUW A;  3CCL F;  3K2X A;  3LWV C;  5LP6 B;  4BVT A;  3V7Q A;  1U3P A;  2DT4 A;  2HS3 A;  2RHL A;  3RYF A;  3MQW A;  3HKD A;  5GIP C;  1OFU A;  1S72 F;  1FNJ A;  5FNV B;  5LOV A;  4RQO A;  4X1Y B;  4YJ2 B;  5JCO C;  5CA1 A;  3HJW C;  1VQV A;  3CPQ A;  2VGN A;  3IMP A;  3D00 A;  1YGY A;  3JAM M;  4G4X A;  2H8E A;  2ALE A;  4X20 B;  2CZW A;  5JVD B;  1RLG A;  2V9Y A;  2HP0 A;  3VTI C;  1SDS A;  4O4H B;  5HWE A;  4TV8 B;  3N2K A;  4BT4 A;  2ZOD A;  3MCQ A;  3IEQ A;  3LWR C;  2DYY A;  3HKE A;  2VXY A;  3HKB A;  2OTM A;  3HAX D;  1U43 A;  3HTN A;  5EZY A;  2VAM A;  4RHA A;  5AVM A;  1Q7Y H;  3LWO C;  2CWJ A;  3PLA C;  5LP6 C;  1IV3 A;  5LXT B;  3CYQ A;  4DXD A;  3RYC B;  3LWQ C;  2I6D A;  3CB2 A;  3WGK A;  2Z1U A;  4U3J A;  1W5F A;  1W55 A;  2UZH A;  3S02 A;  5BMV A;  3D01 A;  4G4Y A;  3RYI B;  1VQ8 F;  4O4J B;  3C9R A;  4KWE A;  2UYP A;  3GTZ A;  3HKE B;  3V7E A;  2RHH A;  1VQL F;  3R0P A;  5HXU A;  5J2U B;  4O2B A;  4I55 B;  5GON B;  2LCA A;  3LDT A;  3LME A;  3S0Y A;  5MN4 A;  1COM A;  5HY4 A;  1VQ5 F;  5CB4 B;  3FFM A;  5IYZ B;  5JVD A;  1W3E X;  2NMU A;  3ZP7 A;  1W5A A;  3D54 A;  3MBM A;  2Q1X A;  1GX1 A;  5IJ9 B;  5KX5 B;  4C82 A;  3VOA A;  3JCM M;  1NMU B;  2K1S A;  4TUY A;  5CA1 B;  4BT3 A;  3CCU F;  3RYH B;  5EB1 B;  3VYT C;  1X7O A;  1ONI A;  1RLU A;  3WJP A; 
#chains in the Genus database with same CATH homology
 3OW2 F;  5GIO C;  5IT9 M;  3CD6 F;  1GZ0 A;  4BY9 D;  2FGY A;  1K8A H;  2OTL F;  2OTJ F;  2WAL A;  3LWP C;  4NQ3 A;  2KG4 A;  4X3M A;  1M90 H;  2BO1 A;  1YI2 F;  1W40 A;  3G71 F;  5EWR A;  4NUT A;  2F9Z C;  4X3L A;  2QEX F;  4EI9 A;  3CCL F;  3CCR F;  1NJI H;  3O85 A;  3LWV C;  3VMF B;  1CK2 A;  3V7Q A;  4BVT A;  1X7P A;  2KTU A;  1T0K B;  4EI7 A;  3J7A R;  2KTV A;  3E20 B;  1K9M H;  1YJN F;  5HY0 A;  3PAF A;  3NVI B;  5GIP C;  1S72 F;  3CCV F;  3NMU C;  1ZWZ A;  4XCQ A;  3OBY A;  1H7M A;  1Q82 H;  1CN7 A;  2LBW A;  1GO0 A;  3HJW C;  1PXW A;  3WXM B;  3CPQ A;  1N8R H;  2VGN A;  1VQN F;  5HXZ A;  1M1K H;  1Q86 H;  2JNB A;  3CCJ F;  3D00 A;  2QI2 A;  5EO3 A;  1XBI A;  3JAM M;  1VQP F;  2ALE A;  1VQO F;  2LBX A;  1W41 A;  2CZW A;  5FLX M;  1RLG A;  1GO1 A;  3CXC F;  3VI6 A;  2OHW A;  4TZZ A;  1IPA A;  3CCS F;  1YHQ F;  5A2Q M;  1YJ9 F;  1VQ4 F;  5GAN K;  1SDS A;  1KC8 H;  3RA6 A;  5HWE A;  5G4V C;  1VQM F;  3LWR C;  1QVF F;  1K73 H;  2FC3 A;  5FJ4 C;  3HAX D;  5HY2 A;  1W42 A;  3NK7 A;  1Q7Y H;  4EI8 A;  3CME F;  3OBW A;  1VQ9 F;  3LWO C;  5GAP K;  3PLA C;  3I56 F;  3CCQ F;  3SIU A;  3LWQ C;  4BVS A;  1Q81 H;  3AGK A;  2I6D A;  2HVY D;  3NVK E;  4LCK A;  1X52 A;  3LFO A;  4C4W C;  1VQ8 F;  1YJW F;  1VQK F;  5G4U C;  2VGM A;  4BW0 B;  3RA5 A;  1E7K A;  5HY1 A;  1VQL F;  4BVQ A;  3V7E A;  5HXU A;  3SIV A;  3N4Z A;  3G6E F;  1YIJ F;  1RA4 A;  3CPW F;  3V3T A;  3CMA F;  1JJ2 F;  2GLZ A;  3NK6 A;  5HY4 A;  1VQ7 F;  5GIN C;  1VQ5 F;  2AIF A;  3GYQ A;  3CCM F;  3J81 M;  3FFM A;  1QVG F;  1VQ6 F;  3MCA B;  2OZB A;  1KQS F;  1W3E X;  4BVR A;  1YIT F;  1DT9 A;  5DCV A;  3E1Y A;  2QA4 F;  3N4Y A;  3JCM M;  3I55 F;  1NMU B;  3ON1 A;  3CC2 F;  3CCE F;  3CC4 F;  3CCU F;  3CG6 A;  3IR9 A;  3G4S F;  3CC7 F;  3J80 M;  1W2B F;  1KD1 H;  1X7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...