3CCQF

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ccqF00
2OTJF 1W2BF 1W42A 3HJWC 1RLGA 5GAPK 1GZ0A 1YIJF 3CC2F 4X3LA 1VQ4F 1X52A 3CD6F 2LBXA 3LWRC 3CPQA 3HAXD 3E1YA 1NJIH 3OW2F 3SIUA 3LFOA 2ALEA 3MCAB 4TZZA 2KG4A 1YJNF 2I6DA 3CCVF 1QVGF 3SIVA 3CCQF 3CXCF 3J81M 1Q7YH 1YI2F 2KTVA 1S72F 1YHQF 3N4YA 2WALA 2BO1A 3CMAF 1Q81H 1VQKF 1T0KB 3CCRF 5FLXM 3PAFA 3ON1A 3CCEF 3CCSF 3CCUF 3NVIB 2KTUA 3RA5A 3CCLF 1YITF 1Q86H 3LWPC 5GIPC 3RA6A 1NMUB 1W40A 5EO3A 3OBYA 3NMUC 5EWRA 2AIFA 3WXMB 3AGKA 1K9MH 1VQLF 5G4UC 3CCJF 2VGMA 2OTLF 4C4WC 1CK2A 5FJ4C 3J80M 3JCMM 3N4ZA 4BW0B 3V7EA 2FC3A 3CCMF 5GINC 3NK7A 2JNBA 3VI6A 1CN7A 1KC8H 4NUTA 1VQ9F 3V7QA 1VQ8F 3NVKE 3IR9A 1VQPF 2QA4F 1IPAA 1X7PA 1K73H 1GO0A 5GIOC 1X7OA 3O85A 3G4SF 3VMFB 3JAMM 2QI2A 1Q82H 1GO1A 1JJ2F 1DT9A 2QEXF 1N8RH 1E7KA 3G71F 1YJ9F 3E20B 3CC7F 1W41A 4X3MA 1KQSF 1RA4A 1VQ5F 2OHWA 1VQ7F 3LWVC 2HVYD 4BY9D 2VGNA 1YJWF 2OZBA 2CZWA 3CC4F 3GYQA 1ZWZA 3CMEF 1PXWA 1W3EX 1VQNF 5IT9M 3LWOC 5G4VC 3CPWF 4LCKA 2LBWA 3CG6A 3OBWA 1VQ6F 1SDSA 3NK6A 1K8AH 3PLAC 3J7AR 1XBIA 1M90H 3FFMA 1H7MA 5GANK 1KD1H 3G6EF 1M1KH 3I56F 1VQMF 5DCVA 1QVFF 5A2QM 3I55F 3LWQC 1VQOF
chains in the Genus database with same CATH superfamily
3MDOA 2OTJF 1W2BF 1W42A 3S06A 2B33A 2RHHA 3N2GB 3V4DA 1GZ0A 1XRGA 1RLUA 4DXDA 3I3FA 3CYPB 3LWRC 4ZI7A 4YJ3B 3JVHA 1QU9A 3E1YA 4EI8A 2RB9A 3OW2F 1NQ3A 4G4VA 2ALEA 3MCQA 3HKCA 1QVGF 3SIVA 5EYPA 2CW4A 4EI7A 4I55B 4WBNB 2YYEA 3VYTC 1W5FA 1S72F 1IV1A 1YHQF 3CMAF 1Q81H 3L7QA 1VQKF 2ZODA 4R40B 5BMVB 2IQQA 3PAFA 1COMA 4I4TB 2AIZP 1YITF 5GIPC 3RA6A 5ITZB 3RYHB 5EO3A 3NMUC 4ZOLA 2AIFA 1W59A 3AGKA 2NMUA 5KMGA 3IEWA 5G4UC 5HY2A 3N2KA 2VGMA 4BVTA 3JCMM 3N4ZA 2FC3A 4RQOA 5EB0A 4X1IA 2GLZA 2MQEA 4U3JA 4O4HA 2VAMA 1CLIA 2Z1UA 3UT5A 3CB2A 4BVSA 4X20A 1KNKA 2HP3A 4TUYA 2UYKA 5JQGA 4IHJB 1W581 1OAPA 2EWCA 3JATA 3MQWA 5IJ9A 4X1KB 1Q82H 1JJ2F 2RHJA 2N48A 4B45A 1JN1A 4X1YB 3G71F 3N2GA 1SA0B 3E20B 2Q1YA 3R0PA 3WPWA 1KQSF 1RA4A 5LYJB 1W55A 3LWVC 4YJ3A 1XV2A 3IEQA 2VGNA 3WGLA 3JALA 3F6MA 3LMEA 3MBMA 1PXWA 4EI9A 1W57A 3LWOC 4I50B 4I55A 3WJRA 4WBNA 3OBWA 4U39A 1SDSA 3NK6A 3C9TA 4XCQA 3TD3A 1H7MA 3D54A 5BMVA 3G6EF 3V3TA 1VQMF 1UI9A 3E22B 3S03A 1DBFA 5MN4A 1YQNA 2UYNB 5ITZA 1Q8RA 3S0WA 1T0AA 2OTMA 1YIJF 1VQ4F 4HNAB 1X52A 3CD6F 2LBXA 4E6EA 2F9ZC 2R6R1 3VTIC 3K12A 3CPQA 3DDNA 2BTOA 3SIUA 4BT6A 3MCAB 2KG4A 2I6DA 2Z01A 5GONB 2ZOVA 3CCQF 5LP6B 4C8EA 2V9YA 4IHJA 1JFFB 2L26A 2ZVYA 3JAKB 1Q7YH 2IG8A 1GX1A 2WALA 2BO1A 1R1MA 1VHAA 3FD6A 4RHAA 4BT3A 3CCRF 1T0KB 4X1KA 3WJPA 3BYQA 3CCEF 2VXYA 4X1YA 1SA0A 1Q86H 3LWPC 1VQVA 5HP7A 3QTYA 1W40A 3EORA 1IV2A 3RYCB 2R751 5LYJA 3KHNA 1K9MH 2BTUA 2HRUA 1J7HA 1CK2A 5FJ4C 3JAWB 4C8IA 5LOVB 3CCMF 3ZOPA 2CVLA 3VIUA 1YGYA 2JNBA 4I50A 1CN7A 1VQ9F 5JVDB 1UFYA 3V7QA 1VQ8F 3NVKE 2HP0B 3HKBB 2QA4F 5IYZA 1ONIA 1IPAA 1X7PA 2GZLA 2RHLA 3WGKA 1GO0A 3S0YA 3E22A 3GTZA 3JAMM 1U3LA 1JD1A 1GO1A 5JCOA 1U3PA 1N8RH 1KNJA 3VYUC 2W8BC 3F0EA 4EB6B 1W41A 4TV8B 1VQOF 4HNAA 3M84A 2RHOA 4O2BB 2OHWA 2DT4A 2ZAUA 2HVYD 2DYYA 3RYFB 4ZHWA 3Q8HA 1YJWF 1FNKA 4G88A 3KE1A 2HS0A 5GONA 5IT9M 2HRYA 5LP6A 3HKDB 5G4VC 4O2AB 5EZYB 4LCKA 1JFFA 1VQ6F 3JAKA 4TV9B 2PHNA 5JH7B 3J7AR 3FFMA 5CA0B 1KD1H 3F0DA 5LA6B 1M1KH 3I56F 5CB4B 5A2QM 4NQ3A 3IKEA 5JCOC 3FPIA 4ZHQB 1H47A 4BVQA 5EIBC 2P6YA 3RYCA 3IMPA 1XHOA 5C8YB 3JARB 4IIJB 5LOVA 3P0ZA 1NJIH 3LFOA 1YJNF 5JVDA 4B62A 1VK3A 4ZI7B 2HP0A 3C9SA 3P4EA 5LP6C 3HKBA 3CXCF 5HY4A 4ZHVA 5HY0A 2QTPA 3J81M 3K0TA 4I4TA 3N4YA 2IAFA 3CYQA 3KIZA 2LBTA 3RYHA 4KWEA 3GHZA 3S0HA 5FNVB 3TD5A 1U40A 3ZP7A 4DRXB 2CWJA 3ON1A 3CCUF 3I7TA 5J2UB 4O4JB 4F6RB 1JY8A 2AMTA 4G4WA 4EB6A 3CCLF 4TV8A 1NMUB 3D00A 3C9UA 4O2BA 5EB1B 5EWRA 1VQLF 2HS4A 3RYFA 3CCJF 4O4LB 2OTLF 3J80M 3D01A 1RQ2A 1IV4A 4G4XA 3V7EA 4ZOLB 4B5CA 4BVRA 3NK7A 3VI6A 1KC8H 3HKDA 4O2AA 2UYPA 5EZYA 5HXZA 3WJQA 3IR9A 3F0GA 1VQPF 4TV9A 5JH7A 2VAPA 1U43A 3ZP4A 3JASB 5CA0A 3ZO8A 3VYSC 5MN5A 5CB4A 1X7OA 3ESJA 5B8FA 4ZHQA 2PMPA 3C9RA 2QEXF 1E7KA 3LYBA 2CHTA 2VAWA 2Z1EA 1W5EA 3S02A 4O4IB 4BT7A 1QD9A 3JARA 4IIJA 1VQ7F 2I6RA 1ODEA 4BT2A 2CZWA 4PWTA 3VCZA 3CMEF 3TD4A 1W3EX 5IJ0B 1VQNF 3HKEB 1PF5A 3WGJA 2GVIA 4FFBB 2ZF8A 3JALB 2H8CA 3CG6A 3KJJA 1K8AH 1RQ7A 2HQSC 1FSZA 2BTQB 3WPXA 4M8IA 3RE3A 2UYNA 5FNVA 4DRXA 5LXTB 5DCVA 1QVFF 2Z1TA 4G4YA 1OFUA 4LNUB 3I55F 5J2UA 4O4JA 4F6RA 3LWQC 3ERNA 3HJWC 1RLGA 3VO8A 5GAPK 1X25A 2G9IA 3WGNA 3CC2F 4X3LA 2UZHA 4O4LA 4B46A 2UYJA 3P10A 1TUBB 3HAXD 3WGMA 5CA1B 3VOBA 3T80A 3M1XA 4TZZA 5KX5B 3CCVF 3U0OA 3JASA 4C81A 5HXUA 1YI2F 1TVKB 2KTVA 3RYIB 2K1SA 3VOAA 1IV3A 4C8GA 5FLXM 3M4SA 5J2TB 4NWOB 3CCSF 1FFXB 3QHDA 2KTUA 4YJ2B 4BT4A 3NVIB 3RA5A 3JAWA 4O4IA 3KJKA 3OBYA 2ZVZA 1FNJA 3K14A 3WXMB 4C82A 5EAZA 4C4WC 2H8EA 3C8LA 2H6LA 4ERHA 1H48A 4BW0B 2Z1FA 5AVMA 3FBAA 5IJ0A 3HKEA 5GINC 2Q1XA 3HWUA 4BT5A 4FFBA 4G4ZA 4NUTA 3HKCB 5MN6A 5EYPB 1W5BA 2HX0A 5LXTA 1K73H 5GIOC 3O85A 3G4SF 4LNUA 3DC2A 3VMFB 4ZHYB 1VH8A 5HWEA 2QI2A 3FD5A 5IYZB 1QAHA 1DT9A 3QUWA 1YJ9F 3CC7F 5EIBD 3ELCA 5HP8A 4X3MA 3OONA 2LCAA 3IKFA 5KMGB 1VQ5F 1TUBA 4BY9D 2FGYA 3N2KB 1W5AA 2OZBA 3LDTA 5CA1A 3CC4F 3GYQA 1ZWZA 2KGWA 4X1IB 5KX5A 1SZQA 3F0FA 4U3JB 4O4HB 4ZK7A 3UT5B 5LA6A 3CPWF 1Z5WA 2HS3A 3B6NA 4X20B 4TUYB 2LBWA 3PLAC 1TVKA 2CHSA 3HTNA 3RYIA 5HY1A 5JQGB 2YXZA 1Z5VA 1XBIA 1M90H 3K2XA 5GANK 3JATB 2CSLA 5J2TA 5IJ9B 5C8YA 1FFXA 4YJ2A
chains in the Genus database with same CATH topology
2OTJF 1W2BF 1W42A 4BVQA 1RLGA 3HJWC 5GAPK 1GZ0A 1YIJF 3CC2F 4X3LA 1VQ4F 1X52A 3CD6F 2LBXA 3LWRC 2F9ZC 3CPQA 3HAXD 4EI8A 3E1YA 1NJIH 3OW2F 3SIUA 3LFOA 2ALEA 3MCAB 4TZZA 2KG4A 1YJNF 2I6DA 3CCVF 1QVGF 3SIVA 3CCQF 4EI7A 3CXCF 5HY4A 5HY0A 3J81M 5HXUA 1Q7YH 1YI2F 2KTVA 1S72F 1YHQF 3N4YA 2WALA 2BO1A 3CMAF 1Q81H 1VQKF 1T0KB 3CCRF 5FLXM 3PAFA 3ON1A 3CCEF 3CCSF 3CCUF 3NVIB 2KTUA 3RA5A 3CCLF 1YITF 1Q86H 3LWPC 5GIPC 3RA6A 1NMUB 1W40A 5EO3A 3OBYA 3D00A 3NMUC 5EWRA 2AIFA 3WXMB 3AGKA 1K9MH 1VQLF 5G4UC 5HY2A 3CCJF 2VGMA 2OTLF 4C4WC 1CK2A 5FJ4C 4BVTA 3J80M 3JCMM 3N4ZA 4BW0B 3V7EA 2FC3A 3CCMF 5GINC 2GLZA 4BVRA 3NK7A 2JNBA 3VI6A 1CN7A 1KC8H 4NUTA 1VQ9F 4BVSA 5HXZA 3V7QA 1VQ8F 3NVKE 3IR9A 1VQPF 2QA4F 1IPAA 1X7PA 1K73H 1GO0A 5GIOC 1X7OA 3O85A 3G4SF 3VMFB 3JAMM 5HWEA 2QI2A 1Q82H 1GO1A 1JJ2F 1DT9A 2QEXF 1N8RH 1E7KA 3G71F 1YJ9F 3E20B 3CC7F 1W41A 4X3MA 1KQSF 1RA4A 1VQ5F 2OHWA 1VQ7F 3LWVC 2HVYD 4BY9D 2FGYA 2VGNA 1YJWF 2OZBA 2CZWA 3CC4F 3GYQA 1ZWZA 3CMEF 1PXWA 1W3EX 4EI9A 1VQNF 5IT9M 3LWOC 5G4VC 3CPWF 4LCKA 2LBWA 3CG6A 3OBWA 1VQ6F 1SDSA 3NK6A 1K8AH 3PLAC 5HY1A 4XCQA 3J7AR 1XBIA 1M90H 3FFMA 1H7MA 5GANK 1KD1H 3G6EF 1M1KH 3V3TA 3I56F 1VQMF 1QVFF 5DCVA 5A2QM 4NQ3A 3I55F 3LWQC 1VQOF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTJ F;  1W2B F;  1W42 A;  3HJW C;  1RLG A;  5GAP K;  1GZ0 A;  1YIJ F;  3CC2 F;  4X3L A;  1VQ4 F;  1X52 A;  3CD6 F;  2LBX A;  3LWR C;  3CPQ A;  3HAX D;  3E1Y A;  1NJI H;  3OW2 F;  3SIU A;  3LFO A;  2ALE A;  3MCA B;  4TZZ A;  2KG4 A;  1YJN F;  2I6D A;  3CCV F;  1QVG F;  3SIV A;  3CCQ F;  3CXC F;  3J81 M;  1Q7Y H;  1YI2 F;  2KTV A;  1S72 F;  1YHQ F;  3N4Y A;  2WAL A;  2BO1 A;  3CMA F;  1Q81 H;  1VQK F;  1T0K B;  3CCR F;  5FLX M;  3PAF A;  3ON1 A;  3CCE F;  3CCS F;  3CCU F;  3NVI B;  2KTU A;  3RA5 A;  3CCL F;  1YIT F;  1Q86 H;  3LWP C;  5GIP C;  3RA6 A;  1NMU B;  1W40 A;  5EO3 A;  3OBY A;  3NMU C;  5EWR A;  2AIF A;  3WXM B;  3AGK A;  1K9M H;  1VQL F;  5G4U C;  3CCJ F;  2VGM A;  2OTL F;  4C4W C;  1CK2 A;  5FJ4 C;  3J80 M;  3JCM M;  3N4Z A;  4BW0 B;  3V7E A;  2FC3 A;  3CCM F;  5GIN C;  3NK7 A;  2JNB A;  3VI6 A;  1CN7 A;  1KC8 H;  4NUT A;  1VQ9 F;  3V7Q A;  1VQ8 F;  3NVK E;  3IR9 A;  1VQP F;  2QA4 F;  1IPA A;  1X7P A;  1K73 H;  1GO0 A;  5GIO C;  1X7O A;  3O85 A;  3G4S F;  3VMF B;  3JAM M;  2QI2 A;  1Q82 H;  1GO1 A;  1JJ2 F;  1DT9 A;  2QEX F;  1N8R H;  1E7K A;  3G71 F;  1YJ9 F;  3E20 B;  3CC7 F;  1W41 A;  4X3M A;  1KQS F;  1RA4 A;  1VQ5 F;  2OHW A;  1VQ7 F;  3LWV C;  2HVY D;  4BY9 D;  2VGN A;  1YJW F;  2OZB A;  2CZW A;  3CC4 F;  3GYQ A;  1ZWZ A;  3CME F;  1PXW A;  1W3E X;  1VQN F;  5IT9 M;  3LWO C;  5G4V C;  3CPW F;  4LCK A;  2LBW A;  3CG6 A;  3OBW A;  1VQ6 F;  1SDS A;  3NK6 A;  1K8A H;  3PLA C;  3J7A R;  1XBI A;  1M90 H;  3FFM A;  1H7M A;  5GAN K;  1KD1 H;  3G6E F;  1M1K H;  3I56 F;  1VQM F;  5DCV A;  1QVF F;  5A2Q M;  3I55 F;  3LWQ C;  1VQO F; 
#chains in the Genus database with same CATH topology
 3MDO A;  2OTJ F;  1W2B F;  1W42 A;  3S06 A;  2B33 A;  2RHH A;  3N2G B;  3V4D A;  1GZ0 A;  1XRG A;  1RLU A;  4DXD A;  3I3F A;  3CYP B;  3LWR C;  4ZI7 A;  4YJ3 B;  3JVH A;  1QU9 A;  3E1Y A;  4EI8 A;  2RB9 A;  3OW2 F;  1NQ3 A;  4G4V A;  2ALE A;  3MCQ A;  3HKC A;  1QVG F;  3SIV A;  5EYP A;  2CW4 A;  4EI7 A;  4I55 B;  4WBN B;  2YYE A;  3VYT C;  1W5F A;  1S72 F;  1IV1 A;  1YHQ F;  3CMA F;  1Q81 H;  3L7Q A;  1VQK F;  2ZOD A;  4R40 B;  5BMV B;  2IQQ A;  3PAF A;  1COM A;  4I4T B;  2AIZ P;  1YIT F;  5GIP C;  3RA6 A;  5ITZ B;  3RYH B;  5EO3 A;  3NMU C;  4ZOL A;  2AIF A;  1W59 A;  3AGK A;  2NMU A;  5KMG A;  3IEW A;  5G4U C;  5HY2 A;  3N2K A;  2VGM A;  4BVT A;  3JCM M;  3N4Z A;  2FC3 A;  4RQO A;  5EB0 A;  4X1I A;  2GLZ A;  2MQE A;  4U3J A;  4O4H A;  2VAM A;  1CLI A;  2Z1U A;  3UT5 A;  3CB2 A;  4BVS A;  4X20 A;  1KNK A;  2HP3 A;  4TUY A;  2UYK A;  5JQG A;  4IHJ B;  1W58 1;  1OAP A;  2EWC A;  3JAT A;  3MQW A;  5IJ9 A;  4X1K B;  1Q82 H;  1JJ2 F;  2RHJ A;  2N48 A;  4B45 A;  1JN1 A;  4X1Y B;  3G71 F;  3N2G A;  1SA0 B;  3E20 B;  2Q1Y A;  3R0P A;  3WPW A;  1KQS F;  1RA4 A;  5LYJ B;  1W55 A;  3LWV C;  4YJ3 A;  1XV2 A;  3IEQ A;  2VGN A;  3WGL A;  3JAL A;  3F6M A;  3LME A;  3MBM A;  1PXW A;  4EI9 A;  1W57 A;  3LWO C;  4I50 B;  4I55 A;  3WJR A;  4WBN A;  3OBW A;  4U39 A;  1SDS A;  3NK6 A;  3C9T A;  4XCQ A;  3TD3 A;  1H7M A;  3D54 A;  5BMV A;  3G6E F;  3V3T A;  1VQM F;  1UI9 A;  3E22 B;  3S03 A;  1DBF A;  5MN4 A;  1YQN A;  2UYN B;  5ITZ A;  1Q8R A;  3S0W A;  1T0A A;  2OTM A;  1YIJ F;  1VQ4 F;  4HNA B;  1X52 A;  3CD6 F;  2LBX A;  4E6E A;  2F9Z C;  2R6R 1;  3VTI C;  3K12 A;  3CPQ A;  3DDN A;  2BTO A;  3SIU A;  4BT6 A;  3MCA B;  2KG4 A;  2I6D A;  2Z01 A;  5GON B;  2ZOV A;  3CCQ F;  5LP6 B;  4C8E A;  2V9Y A;  4IHJ A;  1JFF B;  2L26 A;  2ZVY A;  3JAK B;  1Q7Y H;  2IG8 A;  1GX1 A;  2WAL A;  2BO1 A;  1R1M A;  1VHA A;  3FD6 A;  4RHA A;  4BT3 A;  3CCR F;  1T0K B;  4X1K A;  3WJP A;  3BYQ A;  3CCE F;  2VXY A;  4X1Y A;  1SA0 A;  1Q86 H;  3LWP C;  1VQV A;  5HP7 A;  3QTY A;  1W40 A;  3EOR A;  1IV2 A;  3RYC B;  2R75 1;  5LYJ A;  3KHN A;  1K9M H;  2BTU A;  2HRU A;  1J7H A;  1CK2 A;  5FJ4 C;  3JAW B;  4C8I A;  5LOV B;  3CCM F;  3ZOP A;  2CVL A;  3VIU A;  1YGY A;  2JNB A;  4I50 A;  1CN7 A;  1VQ9 F;  5JVD B;  1UFY A;  3V7Q A;  1VQ8 F;  3NVK E;  2HP0 B;  3HKB B;  2QA4 F;  5IYZ A;  1ONI A;  1IPA A;  1X7P A;  2GZL A;  2RHL A;  3WGK A;  1GO0 A;  3S0Y A;  3E22 A;  3GTZ A;  3JAM M;  1U3L A;  1JD1 A;  1GO1 A;  5JCO A;  1U3P A;  1N8R H;  1KNJ A;  3VYU C;  2W8B C;  3F0E A;  4EB6 B;  1W41 A;  4TV8 B;  1VQO F;  4HNA A;  3M84 A;  2RHO A;  4O2B B;  2OHW A;  2DT4 A;  2ZAU A;  2HVY D;  2DYY A;  3RYF B;  4ZHW A;  3Q8H A;  1YJW F;  1FNK A;  4G88 A;  3KE1 A;  2HS0 A;  5GON A;  5IT9 M;  2HRY A;  5LP6 A;  3HKD B;  5G4V C;  4O2A B;  5EZY B;  4LCK A;  1JFF A;  1VQ6 F;  3JAK A;  4TV9 B;  2PHN A;  5JH7 B;  3J7A R;  3FFM A;  5CA0 B;  1KD1 H;  3F0D A;  5LA6 B;  1M1K H;  3I56 F;  5CB4 B;  5A2Q M;  4NQ3 A;  3IKE A;  5JCO C;  3FPI A;  4ZHQ B;  1H47 A;  4BVQ A;  5EIB C;  2P6Y A;  3RYC A;  3IMP A;  1XHO A;  5C8Y B;  3JAR B;  4IIJ B;  5LOV A;  3P0Z A;  1NJI H;  3LFO A;  1YJN F;  5JVD A;  4B62 A;  1VK3 A;  4ZI7 B;  2HP0 A;  3C9S A;  3P4E A;  5LP6 C;  3HKB A;  3CXC F;  5HY4 A;  4ZHV A;  5HY0 A;  2QTP A;  3J81 M;  3K0T A;  4I4T A;  3N4Y A;  2IAF A;  3CYQ A;  3KIZ A;  2LBT A;  3RYH A;  4KWE A;  3GHZ A;  3S0H A;  5FNV B;  3TD5 A;  1U40 A;  3ZP7 A;  4DRX B;  2CWJ A;  3ON1 A;  3CCU F;  3I7T A;  5J2U B;  4O4J B;  4F6R B;  1JY8 A;  2AMT A;  4G4W A;  4EB6 A;  3CCL F;  4TV8 A;  1NMU B;  3D00 A;  3C9U A;  4O2B A;  5EB1 B;  5EWR A;  1VQL F;  2HS4 A;  3RYF A;  3CCJ F;  4O4L B;  2OTL F;  3J80 M;  3D01 A;  1RQ2 A;  1IV4 A;  4G4X A;  3V7E A;  4ZOL B;  4B5C A;  4BVR A;  3NK7 A;  3VI6 A;  1KC8 H;  3HKD A;  4O2A A;  2UYP A;  5EZY A;  5HXZ A;  3WJQ A;  3IR9 A;  3F0G A;  1VQP F;  4TV9 A;  5JH7 A;  2VAP A;  1U43 A;  3ZP4 A;  3JAS B;  5CA0 A;  3ZO8 A;  3VYS C;  5MN5 A;  5CB4 A;  1X7O A;  3ESJ A;  5B8F A;  4ZHQ A;  2PMP A;  3C9R A;  2QEX F;  1E7K A;  3LYB A;  2CHT A;  2VAW A;  2Z1E A;  1W5E A;  3S02 A;  4O4I B;  4BT7 A;  1QD9 A;  3JAR A;  4IIJ A;  1VQ7 F;  2I6R A;  1ODE A;  4BT2 A;  2CZW A;  4PWT A;  3VCZ A;  3CME F;  3TD4 A;  1W3E X;  5IJ0 B;  1VQN F;  3HKE B;  1PF5 A;  3WGJ A;  2GVI A;  4FFB B;  2ZF8 A;  3JAL B;  2H8C A;  3CG6 A;  3KJJ A;  1K8A H;  1RQ7 A;  2HQS C;  1FSZ A;  2BTQ B;  3WPX A;  4M8I A;  3RE3 A;  2UYN A;  5FNV A;  4DRX A;  5LXT B;  5DCV A;  1QVF F;  2Z1T A;  4G4Y A;  1OFU A;  4LNU B;  3I55 F;  5J2U A;  4O4J A;  4F6R A;  3LWQ C;  3ERN A;  3HJW C;  1RLG A;  3VO8 A;  5GAP K;  1X25 A;  2G9I A;  3WGN A;  3CC2 F;  4X3L A;  2UZH A;  4O4L A;  4B46 A;  2UYJ A;  3P10 A;  1TUB B;  3HAX D;  3WGM A;  5CA1 B;  3VOB A;  3T80 A;  3M1X A;  4TZZ A;  5KX5 B;  3CCV F;  3U0O A;  3JAS A;  4C81 A;  5HXU A;  1YI2 F;  1TVK B;  2KTV A;  3RYI B;  2K1S A;  3VOA A;  1IV3 A;  4C8G A;  5FLX M;  3M4S A;  5J2T B;  4NWO B;  3CCS F;  1FFX B;  3QHD A;  2KTU A;  4YJ2 B;  4BT4 A;  3NVI B;  3RA5 A;  3JAW A;  4O4I A;  3KJK A;  3OBY A;  2ZVZ A;  1FNJ A;  3K14 A;  3WXM B;  4C82 A;  5EAZ A;  4C4W C;  2H8E A;  3C8L A;  2H6L A;  4ERH A;  1H48 A;  4BW0 B;  2Z1F A;  5AVM A;  3FBA A;  5IJ0 A;  3HKE A;  5GIN C;  2Q1X A;  3HWU A;  4BT5 A;  4FFB A;  4G4Z A;  4NUT A;  3HKC B;  5MN6 A;  5EYP B;  1W5B A;  2HX0 A;  5LXT A;  1K73 H;  5GIO C;  3O85 A;  3G4S F;  4LNU A;  3DC2 A;  3VMF B;  4ZHY B;  1VH8 A;  5HWE A;  2QI2 A;  3FD5 A;  5IYZ B;  1QAH A;  1DT9 A;  3QUW A;  1YJ9 F;  3CC7 F;  5EIB D;  3ELC A;  5HP8 A;  4X3M A;  3OON A;  2LCA A;  3IKF A;  5KMG B;  1VQ5 F;  1TUB A;  4BY9 D;  2FGY A;  3N2K B;  1W5A A;  2OZB A;  3LDT A;  5CA1 A;  3CC4 F;  3GYQ A;  1ZWZ A;  2KGW A;  4X1I B;  5KX5 A;  1SZQ A;  3F0F A;  4U3J B;  4O4H B;  4ZK7 A;  3UT5 B;  5LA6 A;  3CPW F;  1Z5W A;  2HS3 A;  3B6N A;  4X20 B;  4TUY B;  2LBW A;  3PLA C;  1TVK A;  2CHS A;  3HTN A;  3RYI A;  5HY1 A;  5JQG B;  2YXZ A;  1Z5V A;  1XBI A;  1M90 H;  3K2X A;  5GAN K;  3JAT B;  2CSL A;  5J2T A;  5IJ9 B;  5C8Y A;  1FFX A;  4YJ2 A; 
#chains in the Genus database with same CATH homology
 2OTJ F;  1W2B F;  1W42 A;  4BVQ A;  1RLG A;  3HJW C;  5GAP K;  1GZ0 A;  1YIJ F;  3CC2 F;  4X3L A;  1VQ4 F;  1X52 A;  3CD6 F;  2LBX A;  3LWR C;  2F9Z C;  3CPQ A;  3HAX D;  4EI8 A;  3E1Y A;  1NJI H;  3OW2 F;  3SIU A;  3LFO A;  2ALE A;  3MCA B;  4TZZ A;  2KG4 A;  1YJN F;  2I6D A;  3CCV F;  1QVG F;  3SIV A;  3CCQ F;  4EI7 A;  3CXC F;  5HY4 A;  5HY0 A;  3J81 M;  5HXU A;  1Q7Y H;  1YI2 F;  2KTV A;  1S72 F;  1YHQ F;  3N4Y A;  2WAL A;  2BO1 A;  3CMA F;  1Q81 H;  1VQK F;  1T0K B;  3CCR F;  5FLX M;  3PAF A;  3ON1 A;  3CCE F;  3CCS F;  3CCU F;  3NVI B;  2KTU A;  3RA5 A;  3CCL F;  1YIT F;  1Q86 H;  3LWP C;  5GIP C;  3RA6 A;  1NMU B;  1W40 A;  5EO3 A;  3OBY A;  3D00 A;  3NMU C;  5EWR A;  2AIF A;  3WXM B;  3AGK A;  1K9M H;  1VQL F;  5G4U C;  5HY2 A;  3CCJ F;  2VGM A;  2OTL F;  4C4W C;  1CK2 A;  5FJ4 C;  4BVT A;  3J80 M;  3JCM M;  3N4Z A;  4BW0 B;  3V7E A;  2FC3 A;  3CCM F;  5GIN C;  2GLZ A;  4BVR A;  3NK7 A;  2JNB A;  3VI6 A;  1CN7 A;  1KC8 H;  4NUT A;  1VQ9 F;  4BVS A;  5HXZ A;  3V7Q A;  1VQ8 F;  3NVK E;  3IR9 A;  1VQP F;  2QA4 F;  1IPA A;  1X7P A;  1K73 H;  1GO0 A;  5GIO C;  1X7O A;  3O85 A;  3G4S F;  3VMF B;  3JAM M;  5HWE A;  2QI2 A;  1Q82 H;  1GO1 A;  1JJ2 F;  1DT9 A;  2QEX F;  1N8R H;  1E7K A;  3G71 F;  1YJ9 F;  3E20 B;  3CC7 F;  1W41 A;  4X3M A;  1KQS F;  1RA4 A;  1VQ5 F;  2OHW A;  1VQ7 F;  3LWV C;  2HVY D;  4BY9 D;  2FGY A;  2VGN A;  1YJW F;  2OZB A;  2CZW A;  3CC4 F;  3GYQ A;  1ZWZ A;  3CME F;  1PXW A;  1W3E X;  4EI9 A;  1VQN F;  5IT9 M;  3LWO C;  5G4V C;  3CPW F;  4LCK A;  2LBW A;  3CG6 A;  3OBW A;  1VQ6 F;  1SDS A;  3NK6 A;  1K8A H;  3PLA C;  5HY1 A;  4XCQ A;  3J7A R;  1XBI A;  1M90 H;  3FFM A;  1H7M A;  5GAN K;  1KD1 H;  3G6E F;  1M1K H;  3V3T A;  3I56 F;  1VQM F;  1QVF F;  5DCV A;  5A2Q M;  4NQ3 A;  3I55 F;  3LWQ C;  1VQO F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...