3CCQI

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 8
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3ccqI00
3PIPF 1YJWI 2E36A 1VQ9I 1YJNI 1VQKI 3CD6I 2ZJPF 1ACIA 5JVGF 1VQLI 3G4SI 3CC2I 3J7YJ 1YJ9I 2QA4I 3CCEI 2JQ7A 2K3FA 1FOYA 3I55I 1YIJI 2E34A 1FOXA 1VQNI 2FOWA 1Y39A 3DLLF 3G71I 3CCJI 5GAEJ 4IOCF 1MMSA 1YI2I 5GAGJ 3CCQI 1HC8A 3J7ZI 5GAHJ 2OTJI 3G6EI 3CJTB 1FOWA 4V19K 3CCSI 1VQPI 3PIOF 3CCVI 3CC7I 1QA6A 4IOAF 3CMEI 1S72I 2E35A 2NXNB 5GADJ 5DM7F 3CCRI 3CC4I 1VQ5I 3I56I 1YITI 4IO9F 3CMAI 2ZJRF 3CF5F 2H8WA 2OTLI 1VQ8I 3CCLI 1YHQI 2QEXI 1VQ7I 5DM6F 3CCMI 1VQMI 1VQOI 4UY8I 3CCUI 1VQ6I 1VQ4I 2ZJQF
chains in the Genus database with same CATH superfamily
2KZGA 2IGOA 5LGUA 5F0HA 5LGTA 2ID6A 5D6EA 1ETKA 2M34A 1LFBA 1UHWA 2XRNA 5HNHA 3JCUC 5F0FA 3ABLH 4PJJA 2MLGA 5ILVA 1UFMA 5FFXA 1LQ1A 1FSEA 2IS2A 2VI6A 3CO7C 2EV0A 2MGQA 4DJAA 4ZDLA 2IJLA 1DU6A 2ZFUA 4CSWA 3DPUA 4LD5A 3V4GA 4HPQA 1LFPA 3ECOA 3TDUC 3IKTA 3TQNA 1W5SA 1W1WE 4ZTFA 3C2HA 1D0XA 1JKRC 3C1DA 3SDBA 4EM0B 2K3FA 2KDOA 3M1CA 3ZPLA 1U8RA 3GWZA 1MGTA 4ZYGA 1CF7A 2L7MP 2MC4A 3ZRGA 4CYCA 3L00A 2I8DA 2X85A 2BEOA 2W48A 1Y1WJ 4MNUA 4BE0A 3H9GA 2DMQA 4PGGA 4EGYA 3HOZJ 5J1RA 2A5WA 2F48A 3TDZC 2MD0A 2CW0F 4NC7A 2C6YA 4G7ZF 1X1BA 3LSKA 3JAMK 5L3GA 3CCQI 3K4BA 1GV2A 2R7RA 3K1NA 3GTMJ 4RM2A 4XKWA 4Y4RA 3FWEA 4RGUA 4RA2A 3WTTC 1WJ5A 2X6XA 1JT0A 2EZKA 3E97A 1YS6A 3HRSA 4BXUA 3K9TA 3PIOF 2KHMA 5JFRA 2W85A 5B1AH 1IN4A 1YW8A 3KP6A 3LSIA 1LB2A 3GLLA 2AS5F 2VOOA 3F3XA 3OOPA 3KP2A 2VC1A 1G59A 3P9KA 5A2QZ 2K5CA 2XAQA 1Y8RB 3GMEA 4XBFA 2L0KA 3ABTA 4WK8F 4N9HA 3M9AA 4P1WA 5DYMA 3BCAA 2XASA 1HSJA 2GLOA 3NAUA 2VN2A 2JPCA 2ZKZA 2H27A 2BW3A 2HVQA 3BLYA 2WAFA 4E7ZA 1YHQI 4ZYDA 3PFYA 4I02A 4CXFA 2F6CA 1D5YA 1FP1D 2DMNA 2QQ9A 1B72B 3A02A 5ICEA 3OY9A 3HOTA 3BTLA 1USSA 4I7HA 1H8AC 1V4RA 2JJ7A 2R4GA 3NARA 2IAIA 1FX7A 1ON2A 1XSDA 2DU9A 3DKWA 4XM3A 2VKHA 3S2WA 2YU9J 3GYHX 1FTZA 1WJEA 3PNVA 4E7IA 5HNFA 1U2WA 3X2QH 2R7WA 4YIFA 5TGTA 1KA8A 2BV6A 4HBLA 2CJJA 3J80Z 2RNGA 3FK6A 3A03A 3M4OJ 2CW7A 3BQZA 1IN6A 4BJ6C 4EM2A 4ZYEA 4Y13A 1RZ4A 3LSGA 1E0EA 3GTLJ 3QOEA 1VF9A 1WZ2A 3LNQA 2DQRA 3O2PE 2KRHA 4ZYHA 1JHFA 3HM5A 3QQAA 4RGXA 5FFZA 1JKQC 2IA2A 3GTOJ 4RAZA 5E3LA 3BCBA 1JUPA 2HYJA 2KZVA 4CYDA 2Z2SB 2IPQX 2GWRA 4JP0A 2NVQJ 2ELJA 1ZRCA 1WJAA 3P7NA 1XG1A 3GFLA 5HODA 2GZWA 2JA5J 2K85A 2CFOA 3ESWB 2P5KA 4EEFG 1ZGAA 1XGMA 2OBPA 2WY7Q 2BHZA 1NHAA 1I1GA 2GIVA 4M3EA 3BR0A 4CZZA 3WTXC 3MKLA 2R7XA 1AKHB 3BJ6A 2WV1A 4TV7A 1PP8F 2KLOA 4CCLA 2DAOA 2DW4A 2NNYA 2CMPA 4CCJA 3N05A 4A3EJ 2YSRA 3J81Z 2LH9A 3RKWA 3JSOA 2OJED 5HLGA 5FLXZ 3SFZA 2R5YA 3K70C 1N77A 5ED4A 2RQQA 2ME6A 1X1AA 2MABA 3I0TA 5HDGA 2QKLB 2M7BA 2ZXIA 2EINH 2F5CA 5DCMB 3N97A 2IVMA 3FISA 3S8PA 4CZCA 3WTZA 4XN0A 1W0UA 3CF5F 3BTJA 4GCVA 4PDKA 1EV7A 4H4KC 3HEFA 4D7MA 4E7SA 4AIKA 3QPLA 1B8IA 2KL4A 4BQOA 4P9UA 3CUQC 3OOUA 4HYEA 4KIGA 1A04A 4UHTA 2QQAA 4YRVA 4EMSA 3BT9A 4HSRA 3HBLA 2I10A 4IZZA 2E1MC 2HWVA 1KU7A 4B47A 1IG7A 1P6RA 3AG2H 4LK0F 3WTUC 2YS9A 2DMUA 2UV1A 2VBZA 2B63J 2X1CA 2CRGA 2HZTA 1EH6A 1G3WA 1KU3A 3E6MA 3W6VA 3OYGA 3K10A 2FD5A 1X2NA 2XGCA 1LVAA 1VFCA 1SD6A 4BQNA 2L3DA 1NH3A 2PJRB 5CLSA 2K4BA 4RB3C 1IW7F 2PMUA 1EF4A 1BI2A 2WADA 4IHYA 4X1EA 1MSEC 1FYMA 1Z6TA 3CLOA 4EJWA 3QPHA 1T2KA 4NUBA 5K7FA 3QRFF 4C2TA 2L9VA 5EGOA 3FM5A 3GBGA 2L54A 1DU0A 3SQNA 5BPIA 2P4WA 1R6RA 2TRTA 4QWQA 3K6GA 2BOLA 2BHYA 3ZXSA 2EFOA 2V9KA 1T56A 2E34A 2WWYA 1KYZA 1SD4A 3VWBA 4NNJA 1T33A 5CVUA 2EIMH 4U88A 4NQWB 2GXAA 2PQ8A 1HW5A 1YI2I 3EDPA 1GT0C 2K7LA 2IRFG 2XKPA 1U3EM 1F43A 3IAS2 5F1JA 4XSZF 4QLCU 3P9IA 2GBYA 5FKLA 2JTVA 3I5UA 1KGSA 2E60A 2DYRH 2O0YA 2MH9A 4OMZA 4MEXF 5LLQA 3IHUA 1T98A 3RJPA 4S05A 5FJ8J 2LVSA 4IOAF 2KJCA 2EPFA 1A31A 2CG4A 2FQ4A 2WV0A 3L2QA 3RDIA 2D5VA 1RIOH 4YFXF 1G3SA 1P92A 2VJ5A 1J7KA 3E0JB 3CC4I 3KX2A 4H0EA 1H0MA 3KZYA 3BZ6A 1J9IA 3CMMA 2CFXA 1FPQA 3C18A 5HLIA 1TW3A 1K4TA 4EVIA 2HXOA 4E70A 1QBJA 2AQEA 3OYBA 5J1YA 2XROA 3L09A 2B7EA 4ZZLA 2ECCA 2ZXWH 2LD5A 3LL7A 2LP0A 4M6YA 2CGPA 3OYMA 4UUTA 1RUNA 3CCMI 1XTAA 5EEAA 2HTSA 5FD5A 4KIFA 4XR6A 3SEZA 4ZZDA 3WTVC 1FBSA 3RPQA 5KNLA 1FTTA 4JX5A 1HQCA 3BJAA 2M0MA 3O6BB 3OMYA 4C2MJ 1ETXA 3OSGA 5IYCJ 4C30A 1IRFA 2XPUA 3CJRB 4Y17A 3EUAA 1RR8C 1IDZA 2NNNA 2ESNA 2GA2A 1JUMA 1JTXA 1RPWA 4JYKA 4M6VA 2IT0A 2V4JC 5F64A 5HDKA 2K9SA 1IF1A 1HCRA 3ZQLA 1G6NA 3OL3A 1JGSA 1BL0A 3MVPA 2Y0MA 3G1MA 3CTAA 1I3QJ 5E1ZB 2E7WA 1P4XA 5HS7A 2MC3A 3PSIA 1P7IA 4M3GA 3E6CC 3AFHA 2R93J 3K4CA 1TTYA 2O61A 5BOXA 4ZDOA 4UVAA 3OWTA 4BL0B 5IYBJ 4NBQA 5H20A 4F55A 4LG0B 5KHDA 3FMSA 3DBHB 2LBFB 3L7WA 4A3JJ 2HOAA 1K61A 1ZH5A 4J19A 3BG5A 1MW7A 2W24A 1LFUP 4O6JA 2MG4A 1XSXA 3U2RA 1ETYA 2HOEA 2CQXA 2JRTA 1ZYRF 5GAEJ 2AXTC 4LLLA 3K4LA 1QPMA 2DOAA 1GUUA 3H92A 4BH9A 1HKSA 2M4KA 1WJCA 2L7FP 2VBXA 4PSWA 4HF0A 3EUKL 1OR7A 3F8BA 3ABKH 3V7CA 1W5CC 3ZMDA 3OYAA 1IXCA 3GTKJ 4M9SA 1KU9A 4J01A 1VQPI 3L2UA 2OA4A 4Q5SF 1BI1A 1QA6A 2HDDA 2PBIA 5JLWA 3BROA 1K7AA 3ZQHA 4ENMA 1ERDA 1OYWA 4U0VA 1R1TA 2K02A 4G94A 4B3AA 4PSXA 3OIPA 4YEJA 1O3SA 2IP2A 3AG4H 3UR3C 1WGXA 1OCPA 4OWRB 2LNBA 2HOSA 1AKHA 4UV8A 4ZJZA 4BXXJ 2H94A 1U9OA 2CQ7A 5E17F 1QO0D 4MTDA 2O8XA 2R7OA 3HOWJ 4DBQA 2KP6A 2J5OA 4FASD 1IV6A 5E1WA 3OYLA 1RC9A 3SJMA 1VQ6I 3HOUJ 4OU0A 5DCMA 2YX7A 3JRCA 1JGGA 2Z33A 4HNVA 1IUFA 3HSRA 3U1DA 1W7PA 2E36A 1BN5A 3A01A 2IS1A 3CESA 3G3ZA 3BG3A 3QAHA 3CP8A 5C4XJ 5LEKA 2OQGA 2P81A 4KDPA 1DP3A 4G6DA 3ECHA 4HW0A 2DT6A 4AIJA 3S15J 1U78A 3AG1H 4BAYA 1KQ8A 4O3MA 3BTIA 1U5TA 3ROUA 1YLFA 3FXLA 3IP4B 3Q0WA 5DD8A 3SDGA 2XF5A 3F8NA 2HR3A 5M5YJ 1XX5A 2K9QA 1Q1HA 2M87A 2CV0A 2JVHA 4N4NB 1TT0A 4RAGA 1DGRM 4RB2C 1TZLA 2M2EA 3WGIA 3CZ6A 1MMDA 3QP6A 1JXSA 2QF7A 4BU2A 1S29A 2JPBA 5CJ9A 5HS8A 1IO2A 1FC3A 1LDJA 2QGUA 1P4WA 3I55I 3OIOA 3ML6A 3OR2C 4GO1A 3T1BA 4XLPF 3SZPA 1R71A 2DK8A 4KMFA 2JMWA 1JE8A 2VKEA 3DPLC 2YUSA 5L3EA 2A69F 3G71I 3PO2J 1XSVA 1OFCX 2P7VB 1DQUA 2FEZA 1EKEA 5EDNA 1N78A 1AHDP 1DUXC 1AU7A 4WX9A 2EIKH 3IH4A 3K4NA 3E3VA 2OCCH 3HSEA 5LEJA 1YG2A 3H3UA 2DOFA 1ZELA 4RS8A 3WTWC 2Z9OA 1WPKA 2NRAC 1MD0A 3SZGA 3OYNA 3KP5A 2QKMB 4XOTA 2KIQA 2NVXJ 1UHSA 2X6OA 3T8TA 1MBKA 4Q4ZF 3LWFA 2EZLA 1T0FC 2HQRA 2VKDA 4PJLA 1BR2A 2B0LA 5J8CA 5JR3A 2EQRA 2OAZA 4A0XA 4BBSJ 1GDTA 4NQWA 4HF1A 4GYIA 3OYJA 1BW6A 2FQ3A 2IS4A 2FSWA 3C2GA 1DGWY 1GXPA 2MD5A 3HHHA 3M8FA 3CQZJ 5TRDA 4BACA 1TC3C 1QHHD 1R4MB 2CQNA 3JTGA 4OIRF 2HS5A 2QBYB 1ON1A 3D5RC 3MAJA 4D0PA 2HXIA 2VOPA 3BR3A 2L5QA 5DM6F 2K40A 3VSKA 2VBYA 3HL2A 2JUGA 2EWNA 2JUCA 3GF2A 4KJZA 2Y9YA 2DDBA 3WHCA 4DYCA 3HJEA 2AO9A 2K3PA 3S1MJ 2MBFA 3QYEA 1ZAOA 4A3DJ 5DUIA 1YIOA 3Q0VA 5E3OA 3Q9SA 4AIHA 3ZQ7A 1ZR4A 3RQ4A 4UVCA 2LY2A 1YJWI 2DPDA 2KRCA 2STWA 2X4HA 3MEXA 3KZZA 3O3KA 3LSRA 4DOZA 3D0SA 5L3DA 3MZYA 4F91B 3DLAA 3JRHA 1GXQA 2W25A 3MD2A 2A5YB 3E5QA 3E1SA 4G6QA 3ZMUA 1J09A 2Y75A 2CUJA 2QVOA 2CUFA 4WWCA 1GVDA 2M8GX 3HRTA 2XVCA 1FBUA 4C3IJ 3GVAA 1ACIA 4G7HF 2XAUA 2KMUA 2LYCA 5EG0A 3S2DJ 1MNDA 1Q1VA 3IH2A 2EJRA 3A0BC 1XC5A 2E19A 4CCMA 3T8RA 3CC2I 1CQTA 1JTYA 2BY1A 2W00A 3NWTA 3ZMVA 1H89C 2K9MA 4N9IA 3SEQA 3CCEI 2DK5A 4CCNA 4MIMA 4Q47A 5D8LB 4XLHA 1Y8QB 3R4KA 3O8GA 2DA5A 3WG7H 1R22A 5GTHC 1UAAA 3LFUA 4UUVA 3FDYA 1HA8A 2VXDA 2HEOA 4IOCF 3KETA 4U7BA 3DQVC 4ENNA 2XSJC 2FXAA 4RLFA 4CGZA 2VT2A 2Z1DA 3TOBA 1D3YA 2LTPA 1HKQA 2WC2A 2FF4A 3P9CA 3EYIA 4I01A 5GAHJ 4UVBA 4II2A 3DF8A 2Z16A 3LA2A 1RKTA 5JHUA 5LD2C 1ZGWA 1BM9A 4DYRA 2RN7A 1TW2A 2YPRA 5D4RA 1TQMA 1UB9A 4M71A 3GZ5A 1ETOA 4BEHB 1YE9A 2LG4A 2ZC2A 1FWZA 2LKSA 1EJ9A 5IT9K 2DA7A 4OIPF 2DMPA 4LIVA 3ASOH 3FMQA 1S7AA 4GRIA 3B02A 3BR5A 3CMAI 3DKYA 2EV6A 3HOYJ 1DPUA 2DFIA 3EUHC 2AQFA 4XQFA 3OIQA 2RDPA 1IN5A 2Y31A 1O3QA 3O8HA 2XAHA 4BQQA 2DO7A 2HYGD 1EH7A 2DA6A 2WA0A 5DUKA 3SFIA 1ZN2A 4EJUA 3ZQCA 3P5JA 4V2GA 2O5RA 4HAMA 1OCCH 4XICA 3BPVA 3U21A 4C9YA 2ETHA 2DJIA 5CVJA 4DW6A 1ETVA 1FBQA 1OYYA 1NTCA 4II3A 4EQQA 3BDDA 4LK1F 4KIBA 4AUXA 1SFUA 4A3BJ 3H5AA 1NK2P 1XMXA 4AU7A 2HI3A 5J47A 5HVQC 2HPIA 2NS0A 2X6WA 3GFIA 1HW1A 4PJNA 2XF6A 4HLXA 4BYYA 4IQJA 2DT7B 2UXNA 5J40A 4FCYA 3NQOA 5EYRA 4N0BA 1MIJA 2M8EA 4XKVA 1ENHA 4D5FA 2M5WA 3CUQB 3I58A 3SHFA 3WHBA 1T38A 1B9NA 4BS9A 1J59A 1MH3A 3HOXJ 1ODDA 1OCRH 2EZIA 2KKOA 4AVZA 1Y0NA 1O4XA 1V55H 2E1MB 5D5UB 4DZJA 2DDAA 1R1UA 4P96A 4D5CA 3CD6I 1B4AA 1K6YA 2JZYA 2A68F 2V1XA 3BP8A 5JVGF 1E2XA 1X1DA 4IRHA 4XLCA 2MFZA 5K5OA 2DMTA 3M8JA 5AIPA 5L3BA 5CVRA 2A07F 1O3RA 1XCVA 2RAEA 2DXIA 4S0HB 4XIDA 4KMUX 4BHPA 3G2BA 1YJ9I 3PQKA 2W82A 4RDUA 1O3TA 4A6EA 1MMGA 2EFWA 2BY0A 1FOYA 3HPGA 1RRJA 3JRGA 1POGA 3GCMA 3ULQB 4I76A 2OV7A 2ZMEA 4J00A 3HTSB 2HYFA 1I50J 5B5EC 1MDMA 2V9PA 3S14J 3JW4A 1MMSA 3OYEA 4G9YA 5FKMA 2G9WA 3OSFA 4A3CJ 2WTEA 3LOCA 5FD6A 2ELKA 2O3FA 2KIUA 1Z77A 1ZLKA 1IRZA 4M6XA 2QENA 3RSNA 3ISPA 1QHGA 2DA2A 3CJTB 3VFZA 3ONQA 3LSMA 3CLQA 4A3FJ 2NYXA 2M7AA 1TT5B 5M5XJ 2DOEA 2BXZA 1LE8B 3JRDA 1VZ0A 1S5LC 1MBHA 1YO5C 4AIDA 1IN8A 5BMZA 2O8KA 4B43A 3BOQA 5GADJ 4XOPA 3MN2A 3CCRI 3GTPJ 5E3NA 3CO6C 3ZQFA 1JJ8C 1HOMA 3GLXA 1U9NA 5C44J 1MBGA 2R3SA 1QVTA 1XGSA 1ZR2A 3BWGA 2R5ZA 1IDYA 2JA2A 3DCFA 2ZBKA 1IRXA 3BPXA 1W4MA 3I59B 4R79A 3FIWA 4PK4A 1AWCA 1J2XA 5CQEA 1OQYA 3FZVA 1E3HA 2HZDA 2E1CA 1ZTRA 3BG6A 2ZXHA 3R61A 2JA8J 2R7SA 5CYVA 4ZDPA 1YS7A 3K4JA 3UKGA 1D0YA 5IY5H 3HOVJ 1D8KA 1WRJA 4OAYA 1DDNA 1Z3XA 2XC7A 1W36C 1ZK8A 3QWLA 2XPWA 2JSCA 2GA1A 4D7NA 1FYLA 1VQ9I 3K7AJ 3OYIA 2EA4A 2VE8A 2IGMA 2YX4A 3OYCA 2L9RA 2R7VA 3F6VA 2L4MA 4MFEA 4MQ9F 3R6SA 4I0AA 5GPCA 1TL8A 1F36A 3MQ0A 2K86A 3KE2A 5AIQA 1TP4A 3ABUA 2X0LA 2R7FA 2RKHA 5CVIA 3G4SI 1Z05A 3J7YJ 2VC0A 2F5VA 3Q0UA 1QU3A 2K4JA 3H3ZA 3SXYA 2W84A 3SYTA 3OR1C 2LKXA 1FZPB 3NWSA 2ZSHB 5F08A 4UB6C 3JSPA 4M73A 2FNPA 2EFQA 2LOOA 3JR9A 4IVNA 1RETA 3HSFA 3Q9VA 3I71A 5LHGA 5B66C 5HLHA 2MLKA 3CCJI 4CA0A 2EB7A 1MNEA 4ABZA 5AONA 2XAJA 3HRUA 1BC7C 1MNMC 2HVSA 4L9JA 1VNDA 1P9QC 4L18B 2JT1A 3WGHA 2A6EF 2IW5A 4XRSA 2H1LA 3CDLA 1JJ6C 1YOVB 3G6EI 4Y7NJ 3MCZA 1X4OA 1OPCA 2STTA 2V7FA 2QQBA 4I0BA 4I6ZA 1P2FA 3DBRB 2VL8A 2G7HA 3CJQB 4LFUA 1ZG5A 5J8FA 4CO8A 4CICA 2ZCWA 3LMMA 2CS3A 4A3MJ 1QZZA 1OCOH 3TBIA 5D5WB 3ERMA 1LEBA 1IXSB 2E2HJ 3HIFA 1K78B 3RZOJ 2XGDA 3FXKA 2Q2EB 3F23A 1IAWA 2M3AA 4IO9F 2M30A 1O7LA 3L2RA 1YTYA 2GXGA 5DDGA 5HOOA 3LA3A 3R60A 3MZHA 2WB1N 1Z3YA 4L5IA 2EFNA 5GTIC 4BNCA 1FNNA 1EA3A 2FRHA 4BEHA 3F6OA 3KLNA 4M3BA 1K6OA 1M1EB 1OCZH 3KCCA 4DIQA 3VB2A 2LR8A 2V6EA 4B4CA 3K4KA 4UY8I 1H9GA 2HOTA 2LKPA 2L9NA 3HGGA 2CU7A 2YU3A 3BR6A 4BHCA 2DA3A 3PSFA 1SC7A 1FT9A 2DTZA 3VDXA 1QPIA 3QU6A 2IS6A 1YX3A 2WB1A 2YR2A 4KN4X 1YRNB 3PM1A 3W2WA 4RB1A 4N4OB 3IWZA 4HX7A 3FHNA 3PNYA 2M4GA 5FKNA 3W2VA 1MKMA 1BIAA 2Y69H 4IXAA 3A4CA 2Y2ZA 4XN3A 3I4PA 5K1YA 2XGXA 1BBYA 4GFBA 2DI3A 2E71A 1T08B 3PFIA 4XKBA 3V42A 4A5MA 3GZNB 3GFMA 2GOXB 3NEUA 5CPRB 1PUFB 5FKOA 2UWMA 3JAMZ 3ABMH 3CUQA 4JK1X 2JQ7A 4HA8A 1USTA 2X9DA 1UELB 3E7LA 3CMYA 4L9TA 2W7NA 2M9HA 5M3FJ 1R5ID 1FOXA 2UUZA 2QUFA 2V79A 2XB0X 4HDVA 3RKYA 1B72A 2A61A 1GHCA 4B1RA 1B1BA 1ITYA 4ITVA 4LLNA 3IAM2 4L9NA 3QYBA 5ERIA 9ANTA 3SZTA 1F9NA 4XNFA 3EQLF 4IHWA 4HQMA 3WU0A 2VB6A 4LGWA 4MFDA 3IRRA 5IP6A 2IBDA 4W97A 3H1CA 4HV5A 4L0YB 3J7AO 5E20A 1QZYA 4L5JA 1ZREA 2EFPA 3LAJA 4C2UA 2OD5A 1SFXA 2BVMA 3ZCOA 4YFNF 5EF6A 4BJTA 3U1KA 4NHJA 4BE1A 4OIOF 1D5VA 4HRIA 4LIUA 5E79C 1FEXA 1LVKA 3DTKA 1Y1VJ 2PLYA 1R9TJ 2DFFA 1A35A 5ILSA 3S17J 3QODA 3MZ8A 2DCEA 2QLZA 4A12A 2XB5A 5EZHA 1GVJA 4BKXA 3Q5FA 1CF7B 2VQLA 1IC8A 4CYCB 4R1HA 1FJLA 5IP7J 3TGNA 3FXMA 1K4SA 4JX6A 3UNGC 1ORKA 3HDDA 1WFXA 3OYHA 1YQAA 3RYPA 5A2QK 4DBRA 4S04A 4XORA 2ZJQF 2DJNA 1AOYA 3W6KB 3C2BA 3L2VA 4B8XA 3PNTA 4HSTA 3H0GJ 3FMRA 3U9GA 5DCFA 3CCYA 1G2HA 2R0QC 1BA5A 1QRYA 2DYSH 4FE4A 1PP7U 2R7DA 3K70D 3F72A 3I54A 3JREA 4E7KA 1X3UA 1NG7A 5LHIA 2OF7A 1I6HJ 1BW5A 5BQTA 2VONA 3HKZA 5ILUA 4KNYA 4I99C 2EK5A 4PCQA 3KEQA 4P9FA 1MJAA 1L0OC 1FP2A 3GO5A 1KQ0A 2E2IJ 2E5NA 4BXFA 2ZB9A 1X3ZB 3TL4X 1W36D 1CGPA 1MJ9A 1Z7UA 2A3SA 2G0EA 1RI7A 4ENKA 5HLTA 4GYGA 2R7QA 4YIRX 1G8XA 4YIIA 3FXRA 4P55A 5E8GA 2RVCA 2QSGX 1IN7A 3J80K 3FM3A 4LB5A 2Q8KA 2E2JJ 4E4HA 2FOWA 2GAUA 4PJ0C 3DLLF 2HNHA 4U0WA 1RESA 3GFJA 1YYVA 1HKTA 3FX3A 2CQKA 4QIWN 4DGWB 2A6TA 1NK3P 2CSOA 2CO5A 4B3XA 2JK3A 3BR1A 3EYYA 3TO7A 1ZRFA 3FBNB 2ZNZA 4XONA 4LG3A 2XV4S 2H09A 3ZMSA 2ZO4A 1U8BA 2DPUA 2BZTA 5BS6A 3ZP5A 2LK2A 2PJRA 3T5XA 2VT3A 3REOA 2A05A 1XMKA 2E35A 2NS7A 4RGSA 1JUSA 2ICWG 4C3JJ 1WVRA 4IRIA 4IHVA 1YITI 1LPQA 1I5ZA 5H6QA 5KAIC 2Q0OA 2DTRA 2VLAA 2CYYA 3CF2A 2I5UA 1IGNA 4DYQA 4LITA 1GV5A 4LOCA 3E5UA 4CUGA 1KONA 3B6CA 1WH7A 2OPTA 2VPRA 2OTLI 1SVLA 1AA7A 3LSTA 5LRSA 1D1BA 1A6QA 1JKPC 4P5OA 3VEPA 3MKZA 2CW8A 3MKYB 3LSHA 1IRGA 1REPC 1FSHA 4C3HJ 3BR2A 1LKXA 3Q3SA 1K78A 2ISZA 5FGMA 1KU2A 3BZCA 3IKVA 4XLFA 5EEGA 4IHSA 5TISC 2HGCA 3K4MA 4CCKA 5GPAA 3T0YA 3DKXA 3ZMTA 4I09A 2ELHA 2L02A 1S9HA 1LDDA 2W4SA 4AM3A 3IRQA 5H6RA 1W5TA 3WE2A 2L01A 2HVRA 2O03A 1MSFC 4HX4A 2CV1A 2QYOA 5ICCA 3I4NJ 2R5YB 4PGHA 4A93J 1VQKI 1TNTA 2X1EA 5LGNA 1N75A 4E6KG 1APLC 3CDHA 2QZ8A 4FTHA 3I4MJ 2VQHA 3JRBA 4XSXF 2FX0A 4KT5C 2QA4I 1A6IA 3RIRA 2HDWA 4FISA 4V2FA 1WQ2A 3R0JA 3VYSB 2F5EA 3MKWB 1B8IB 5IPAA 1YRNA 4PJMA 4FT8A 2ISYA 1OLTA 3FF5A 5K5QA 2HTJA 4CCOA 3KYLA 1WI9A 1PJRA 2CQQA 3ZOBA 1Y39A 4KFCA 1G3YA 2GIZA 2LC2A 3KZIC 4BDYA 3GUDA 4HNUA 2FOKA 4IHTA 1XGNA 3CJNA 1X4PA 2X6YA 2LY1A 3GXOA 4W1UA 4E7HA 3I9V2 4JBAA 3BY6A 2JWTA 3KFWX 2LF7A 1ZG3A 3VPRA 2N8GA 2P7CB 2R7ZJ 3H5NA 4A3IJ 3ZN0A 3N4MA 2OTJI 1SFOJ 1R49A 2D1VA 4GDFA 3BTCA 3KYDB 3K1MA 1JKOC 4OIQF 1L3LA 4GGGA 4WXDA 5CKTA 3S93A 2VODA 2EA2A 4IL6C 5DD4A 4L9VA 3V8LA 2PI0A 4MTEA 2LLKA 3KEOA 3LQRA 3K0LA 1QVUA 3GTQJ 1T39A 3VYTB 2V6CA 2ZJRF 1RR7A 1V5GA 2XPVA 4YELA 4ANJA 2BVLA 5EGOB 3COAC 3PO3J 4XMYA 4LG0A 4BY7J 2LBFA 2OC6A 2Z3YA 3D5LA 1I39A 3B6AA 4ENJA 2LMDA 4KA4A 1Y6IA 2UZKA 2LFBA 1SD7A 3A1YA 2ESHA 5M3MJ 1VQ7I 4HDUA 2ZNYA 1VQMI 1VQOI 3H36A 1LJ9A 1P4AA 3C7JA 4WF2A 1WWXA 2BY3A 4BGDA 3WU1B 4WXHA 1YFHA 5M5WJ 3FXOA 2MYSA 4XK4A 1SMTA 5DEQA 3FXQA 4FHTA 4RAYA 1SFEA 1J5YA 4F93B 4FX4A 2P6SA 5BNGA 3A2KA 4G7OF 5EJCA 4A6DA 3DPTA 4ZH4F 1BR4A 4EGZA 3OS1A 1T0FA 2QCOA 2HQNA 1A36A 2Y9ZA 1HSTA 2M45A 3M07A 4Y52J 2DFEA 4KN7X 1DPRA 2FMLA 4UV9A 1S3JA 4KYWA 2D2WA 3W3CA 1R7JA 1Y0UA 4MLOA 3V8KA 2CV2A 1YJNI 3CUOA 2E1OA 1R58A 2LSOA 5LRRA 1YX5A 2WBMA 1R5HA 5KCMA 1VQLI 1TWAJ 2M1BA 1BOBA 1R1VA 4EM1A 5JI6A 2JA6J 1WH5A 2L4AA 3KP7A 1MZBA 1PVEA 2GQQA 3OS2A 1UG2A 2DLLA 3FKIJ 3M7GA 2BY2A 1A5JA 1D0ZA 4A2UA 4ESBA 2LREA 3WG9A 1SAXA 2FBHA 2L9SA 3TKYA 3H0DA 3F0CA 4NB5A 5D5XB 3ZQQA 1ZG1A 4A5NA 3H9JA 3M8EA 2CUEA 3HUGB 2F4IA 1UZCA 4RM3A 1T95A 1R5GA 1G4DA 1OJLA 4IPAA 1VTNC 3RYRA 4YG2F 1LUJB 2OU2A 5E3MA 4AYBN 1QQIA 2V9VA 1HC8A 1OYIA 2NVYJ 1MBFA 1ULYA 2K27A 2AHQA 4EATA 3IUOA 1VI0A 2HKXA 2Z99A 1X1CA 5FLVA 1X1PA 4BE2A 1BI0A 1KQ9A 3CDIA 3CMEI 4ZTJA 1C0WA 2BGCA 2IEKA 1KYWA 4XRMA 1MBEA 1ETWA 3DTIA 1TWGJ 4D1QA 3IV5A 3JRIA 4R8HA 4ASNA 3HZJA 3TO9A 2HKOA 1BR1A 4DZPA 4LLGF 3FK7A 5F6FA 4G6TB 3K69A 4AYBA 1TQPA 3GW2A 4X0GA 3JTHA 3V8JA 1U0JA 5FROA 4WCGA 1JHHA 2PEXA 1E17A 2EILH 1HDDC 1MJBA 4XLNF 2H8WA 1H9TA 3E5XA 2H6BA 5IOZA 1VQ8I 4JOMA 4OOIA 1QZEA 2RC4A 1FLIA 1SVOA 3QU3A 1RKWA 2JVGA 2QEXI 4MEYF 3JRFA 1BJZA 3RZDJ 1W0TA 1Z1DA 3KYCB 2HQAA 2RGVA 2QQ8A 4D9JA 2LF8A 2Y30A 1VQ4I 2L7KA 2VE9A 1QNTA 3VYRB 1ZGJA 3RTRA 1B9MA 4LMYA 3G1OA 2WY8Q 4RMNA 1RNLA 3S32A 4QTRA 1E3OC 5DV5A 2FE3A 3DEUA 3H9QA 2RNJA 2ZJ2A 1X19A 2W1OA 1MMAA 4HNTA 2W57A 3OS0A 5K7ZA 3CP2A 1HW2A 4M3FA 1OKRA 2RREA 2Y48A 3EUHA 4U7DA 2MA3A 1ZLJA 3W2AA 3OYDA 1SVMA 4PZJA 3AKZA 1IUYA 2FMYA 4HG2A 5FKKA 5KVRA 2KIFA 3K2AA 3QPSA 2V1UA 4OMYA 1X58A 3HHGA 3IH3A 4F92B 5C3EJ 2QBYA 4I2OA 2VASA 1XMAA 1YIJI 2VQCA 5EZGA 3M3YJ 3DFGA 3E6DA 2GOMA 1R00A 2H1KA 3GTGJ 2COBA 1S6LA 1UMQA 2OUMA 2Q1ZB 2IA1A 3V7RA 2AXLA 4KITB 3FKJA 2R7TA 3RCOA 3TW6A 2PMZN 2V1DA 2IXSA 3ZQIA 3FXUA 3L9FA 2FBIA 5F04A 3WE3A 4LB6B 2BXYA 3J7ZI 4LJZF 1W7PB 3GEZA 3A01B 3AAFA 2KIMA 4FE7A 3LSPA 1ZHFA 5E8IA 3KLOA 2Z5UA 2D45A 1Y56A 3QOPA 2BBYA 3BG9A 3CC7I 1NG6A 5FO5A 3DBLB 1I1SA 2VPLA 2P6TA 1U5TB 2ZXJA 5C4JJ 2EV5A 1S7OA 2OQRA 2LDUA 2HPMA 1KZHA 5J4VA 3ZGKA 5L3CA 3RPUA 2DQLA 2PMZA 1WHUA 4ESFA 3S1RJ 3S1NJ 3S3NA 5HDNA 3DEEA 4IEJA 5BPDA 2X48A 5E18F 1WJBA 4L0ZB 2JSPA 2PN6A 3TP0A 1MH4A 3PQJA 2P8TA 2QM3A 3H35A 2H8RA 2E5ZA 2KISA 3HYIA 3JRAA 2EH3A 3E6BA 3S3OA 4XLEA 2VIXA 1STZA 1Z67A 2F2EA 2VXZA 4Z2YA 3D1NI 3I64A 1PYVA 2GXBA 4HLYA 5E1XA 5LHHA 1ONVA 3MFKA 2EZHA 4L5EA 4BJ5C 3ERED 1XGOA 1B6AA 2FJ1A 1ZARA 2ACJA 3S16J 3ZMZA 1I3AA 2EBIA 2VJIA 3BG7A 3F9KA 5ICGA 3F21A 1OR7C 4WXCA 3S1QJ 2XIGA 1SEUA 1FOKA 2FBKA 4A3GJ 3VOEA 3ZR8X 1FMVA 1TLHB 4EJVA 4MGRA 4B44A 2LY9A 2WAEA 1TWFJ 3HC7A 3WU2C 4CDGA 4Z6YA 4E7LA 1DP7P 1E3PA 4A0YA 4ON0A 1O7FA 1XB4A 3AL0B 1XS9A 2FUG2 3F8CA 2HFHA 3LFKA 4UUSB 2XDVA 2O9LA 2CH0A 1FIAA 1XN7A 1UJ8A 2XGEA 5J4YA 1UG0A 2ADUA 3BQYA 2DT5A 4BQAA 4KISA 3BZKA 1B59A 3A0HC 2P5VA 3F8MA 3MWMA 5J6XA 1F5TA 1VQNI 1LEAA 1Z0XA 1H88C 5IYDJ 3ASNH 1R23A 4Y3OA 1GLNA 4AVPA 2FNAA 1FYKA 1V5EA 2XF7A 5IT9Z 2KPMA 1UCRA 2NAZA 5LBQA 4FETA 4BBRJ 4B09A 3VODA 3I3LA 1J75A 4EJTA 1RUOA 3HXLA 5ICFA 2VQGA 4JQFA 4M9ZA 2KT0A 1K83J 1BI3A 1T8IA 4V19K 3K2ZA 1S8NA 1V3FA 3CCSI 1HF0A 5F1RA 1WKMA 3IL2A 3GX4X 2KJBA 2MH2A 2Y0SN 3HUGA 2F4OB 3AG3H 3ZN1A 2KRFA 4KT6A 4YFKF 3OYFA 2DODA 2ZSIB 3TMOA 2D1HA 5EG0B 3I56I 1U5TC 3B73A 1I6XA 1LNWA 3LA7A 3RPUD 1XCBA 1F4KA 4HEA2 1WCMJ 1X3WB 2JRMA 1SMYF 4F3QA 2L2OA 2XRLA 4BDZA 4HX8A 4KUMA 5FRNA 1FMWA 3QYFA 4HZFA 2R92J 4PFPA 1JI8A 5H2FC 1Z7LA 3DXJF 2VUMJ 6PAXA 4Q48A 3VSLA 1MBJA 4QPOA 1XDUA 2O7OA 3DWLE 2XUBA 2X1DA 2Y0SA 3DTEA 3PUFA 3FHZA 1J0RA 1U6GA 2OCEA 3PL8A 3K1PA 4UNOA 4RB0A 3KP3A 1WI3A 5L3FA 3LSJA 3EPZA 2BYVE 1BIBA 3L2CA 2ZFWA 1IJWC 4PUSA 2HQ5A 3HB9A 5F0CA 4X6AJ 4EV0A 1BOAA 5JVTA 2IGNA 2IGKA 3KIOA 3G73A 1N25A 1LE8A 3DV8A 2QSHX 3HTUA 3HKZN 4AWXB 4QPQA 2R7UA 1YW7A 4E7JA 3ELKA 2ZJPF 1TWCJ 4HQEA 2CUZA 2GM4A 2H6CA 1XD7A 4UB8C 5K7HA 5CVVA 4ETSA 1Z91A 1ZKGA 1TNSA 4M72A 2K9LA 2PX9A 1P7JA 2FU4A 4IKFA 3AL0C 5D6FA 3PUBA 4XRFA 1D1AA 4FQGA 3M1EA 1SANA 4MHGA 5FLMJ 1LDKB 1TQIA 3GZ6A 1R36A 3LQQA 4I98B 1T6SA 2RV8A 4GXOA 5KK1A 5IOYA 5IP9J 5JHFA 3I59A 4ZC3A 2IA0A 3QP5A 2VJ4A 3TEDA 2A6HF 3C3WA 1ZRDA 4NC8A 4OINF 1X2MA 2PFBA 1UHMA 4G12A 4NC6A 2PMHA 2VKVA 2RQPA 2G7UA 3HOSA 2O6GE 5JLXA 4BY1J 2HDCA 5GAGJ 5HS9A 3TO6A 2MW8A 3LAPA 3J7AY 5IT3A 5F27A 1ETQA 4IJAA 5FRMA 1FOWA 3PJRA 2BE5F 1F1ZA 4M74A 4NDLA 2QWWA 3CCVI 2BW3B 1YW9A 4RAFA 4OAZA 4RBOA 4JX4A 2B9SA 1S72I 1WJFA 2XAGA 1QGPA 5DM7F 1D8JA 4EJOA 4F7ZA 3KEYA 1HBXG 1O57A 1SFKA 2COMA 1VQ5I 4CH7A 5KAFC 4AC0A 3S2HJ 1OCTC 5TJJA 3WODF 3FXJA 2NOJB 3IWFA 1D1CA 2QSFX 4KICA 4CHUA 2XAFA 4M3DA 3OYKA 1XPXA 1IZ1A 2E1NA 4M9XA 4B48A 2ZMEB 2V1NA 1G3TA 3H3VK 4A3LJ 3DEWA 1MDMB 1FY7A 3CCUI 3OL4A 4AD9A 2DFHA 1WSUA 3PIPF 4UXNA 2KQRA 4HF2A 1HXDA 3WGGA 2JN6A 4XRSG 2PG4A 3NRVA 3J81K 5D5VB 5J1UA 1BC8C 1XDSA 3HPHA 3GTJJ 5FLXK 4IHXA 3TOAA 2F5FA 2XSDC 2ME0A 5DS9A 4BUPA 4XL9A 4U87A 3F22A 4HOBA 5EEHA 2Q2EA 2V26A 4G8XA 3IC7A 2XHKA 2WAQN 3EETA 2R5ZB 2XKOA 3I53A 4MO7A 2F4MB 3RI4A 2NS8A 3V7SA 5K5RA 1IV8A 2F5DA 4K2EA 3S3MA 4IF4A 1FIPA 2OZ6A 4IQ4A 2E7XA 4RLQA 4A3KJ 4XLAA 1IXRC 3H5RA 4BHBA 2OZUA 4MQVA 3RKQA 1S7EA 4DQ2A 5GP9A 1I27A 3HRMA 3VYUB 5B3SH 5CQGA 5DTDA 4F52A 3R0AA 2LRDA 3DU6A 2DBBA 1Z9CA 5B1BH 2P5LC 1Z21A 5J3LA 2DA1A 2L7ZA 4A0ZA 5D8KB 1SD5A 4QSHA 1ZQ3P 2DN0A 4UUSA 3HG9A 2WAQA 1BJAA 2FA5A 2ECBA 4ESJA 2M0CA 3KPHA 5LFAA 1PUEE 4PFOA 3OV8A 3F8FA 2DA4A 1HLVA 3FBIB 3W6JB 3QPTA 3WTYC 2X51A 2ID3A 3G1LA 3DP7A 1R4NB 2P0WA 4IX7A 4FX0A 3L1PA 3TP3A 2NXNB 3WTSC 4IRGA 1MMNA 2KFDA 2K9NA 2TDXA 1TBXA 2TCTA 3BJOA 1V5FA 3DU5A 1TWHJ 3MMYB 4HV6A 4O5VA 3L2WA 2VJJA 1K79A 4Y15A 4Y33A 4ZYAA 1PUFA 3ZQGA 3HGYA 2HU9A 3D5SC 1WJDA 1W7PD 1OISA 5D4SA 1HDPA 1EH8A 2JA7J 4XKCA 1JT6A 3BC8A 1SAUA 3CCLI 2EIJH 1V54H 4U0YA 2PJPA 3KP4A 2VBWA 2CWEA 3RQIA 2UXXA 3TW7A 4RGRA 2KDZA 2NVTJ 2NVUB 2NOGA 4A69C 4DNCA 1PDNC 1OMIA 2J5PA 2ZMEC 5FB2A 2MSYA 1Z6RA 3RKXA
chains in the Genus database with same CATH topology
3PIPF 1YJWI 2E36A 1VQ9I 1YJNI 1VQKI 3CD6I 2ZJPF 1ACIA 5JVGF 1VQLI 3G4SI 3CC2I 3J7YJ 1YJ9I 2QA4I 3CCEI 2JQ7A 2K3FA 1FOYA 3I55I 1YIJI 2E34A 1FOXA 1VQNI 2FOWA 1Y39A 3DLLF 3G71I 3CCJI 5GAEJ 4IOCF 1MMSA 1YI2I 5GAGJ 3CCQI 1HC8A 3J7ZI 5GAHJ 2OTJI 3G6EI 3CJTB 1FOWA 4V19K 3CCSI 1VQPI 3PIOF 3CCVI 3CC7I 1QA6A 4IOAF 3CMEI 1S72I 2E35A 2NXNB 5GADJ 5DM7F 3CCRI 3CC4I 1VQ5I 3I56I 1YITI 4IO9F 3CMAI 2ZJRF 3CF5F 2H8WA 2OTLI 1VQ8I 3CCLI 1YHQI 2QEXI 1VQ7I 5DM6F 3CCMI 1VQMI 1VQOI 4UY8I 3CCUI 1VQ6I 1VQ4I 2ZJQF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PIP F;  1YJW I;  2E36 A;  1VQ9 I;  1YJN I;  1VQK I;  3CD6 I;  2ZJP F;  1ACI A;  5JVG F;  1VQL I;  3G4S I;  3CC2 I;  3J7Y J;  1YJ9 I;  2QA4 I;  3CCE I;  2JQ7 A;  2K3F A;  1FOY A;  3I55 I;  1YIJ I;  2E34 A;  1FOX A;  1VQN I;  2FOW A;  1Y39 A;  3DLL F;  3G71 I;  3CCJ I;  5GAE J;  4IOC F;  1MMS A;  1YI2 I;  5GAG J;  3CCQ I;  1HC8 A;  3J7Z I;  5GAH J;  2OTJ I;  3G6E I;  3CJT B;  1FOW A;  4V19 K;  3CCS I;  1VQP I;  3PIO F;  3CCV I;  3CC7 I;  1QA6 A;  4IOA F;  3CME I;  1S72 I;  2E35 A;  2NXN B;  5GAD J;  5DM7 F;  3CCR I;  3CC4 I;  1VQ5 I;  3I56 I;  1YIT I;  4IO9 F;  3CMA I;  2ZJR F;  3CF5 F;  2H8W A;  2OTL I;  1VQ8 I;  3CCL I;  1YHQ I;  2QEX I;  1VQ7 I;  5DM6 F;  3CCM I;  1VQM I;  1VQO I;  4UY8 I;  3CCU I;  1VQ6 I;  1VQ4 I;  2ZJQ F; 
#chains in the Genus database with same CATH topology
 2KZG A;  2IGO A;  5LGU A;  5F0H A;  5LGT A;  2ID6 A;  5D6E A;  1ETK A;  2M34 A;  1LFB A;  1UHW A;  2XRN A;  5HNH A;  3JCU C;  5F0F A;  3ABL H;  4PJJ A;  2MLG A;  5ILV A;  1UFM A;  5FFX A;  1LQ1 A;  1FSE A;  2IS2 A;  2VI6 A;  3CO7 C;  2EV0 A;  2MGQ A;  4DJA A;  4ZDL A;  2IJL A;  1DU6 A;  2ZFU A;  4CSW A;  3DPU A;  4LD5 A;  3V4G A;  4HPQ A;  1LFP A;  3ECO A;  3TDU C;  3IKT A;  3TQN A;  1W5S A;  1W1W E;  4ZTF A;  3C2H A;  1D0X A;  1JKR C;  3C1D A;  3SDB A;  4EM0 B;  2K3F A;  2KDO A;  3M1C A;  3ZPL A;  1U8R A;  3GWZ A;  1MGT A;  4ZYG A;  1CF7 A;  2L7M P;  2MC4 A;  3ZRG A;  4CYC A;  3L00 A;  2I8D A;  2X85 A;  2BEO A;  2W48 A;  1Y1W J;  4MNU A;  4BE0 A;  3H9G A;  2DMQ A;  4PGG A;  4EGY A;  3HOZ J;  5J1R A;  2A5W A;  2F48 A;  3TDZ C;  2MD0 A;  2CW0 F;  4NC7 A;  2C6Y A;  4G7Z F;  1X1B A;  3LSK A;  3JAM K;  5L3G A;  3CCQ I;  3K4B A;  1GV2 A;  2R7R A;  3K1N A;  3GTM J;  4RM2 A;  4XKW A;  4Y4R A;  3FWE A;  4RGU A;  4RA2 A;  3WTT C;  1WJ5 A;  2X6X A;  1JT0 A;  2EZK A;  3E97 A;  1YS6 A;  3HRS A;  4BXU A;  3K9T A;  3PIO F;  2KHM A;  5JFR A;  2W85 A;  5B1A H;  1IN4 A;  1YW8 A;  3KP6 A;  3LSI A;  1LB2 A;  3GLL A;  2AS5 F;  2VOO A;  3F3X A;  3OOP A;  3KP2 A;  2VC1 A;  1G59 A;  3P9K A;  5A2Q Z;  2K5C A;  2XAQ A;  1Y8R B;  3GME A;  4XBF A;  2L0K A;  3ABT A;  4WK8 F;  4N9H A;  3M9A A;  4P1W A;  5DYM A;  3BCA A;  2XAS A;  1HSJ A;  2GLO A;  3NAU A;  2VN2 A;  2JPC A;  2ZKZ A;  2H27 A;  2BW3 A;  2HVQ A;  3BLY A;  2WAF A;  4E7Z A;  1YHQ I;  4ZYD A;  3PFY A;  4I02 A;  4CXF A;  2F6C A;  1D5Y A;  1FP1 D;  2DMN A;  2QQ9 A;  1B72 B;  3A02 A;  5ICE A;  3OY9 A;  3HOT A;  3BTL A;  1USS A;  4I7H A;  1H8A C;  1V4R A;  2JJ7 A;  2R4G A;  3NAR A;  2IAI A;  1FX7 A;  1ON2 A;  1XSD A;  2DU9 A;  3DKW A;  4XM3 A;  2VKH A;  3S2W A;  2YU9 J;  3GYH X;  1FTZ A;  1WJE A;  3PNV A;  4E7I A;  5HNF A;  1U2W A;  3X2Q H;  2R7W A;  4YIF A;  5TGT A;  1KA8 A;  2BV6 A;  4HBL A;  2CJJ A;  3J80 Z;  2RNG A;  3FK6 A;  3A03 A;  3M4O J;  2CW7 A;  3BQZ A;  1IN6 A;  4BJ6 C;  4EM2 A;  4ZYE A;  4Y13 A;  1RZ4 A;  3LSG A;  1E0E A;  3GTL J;  3QOE A;  1VF9 A;  1WZ2 A;  3LNQ A;  2DQR A;  3O2P E;  2KRH A;  4ZYH A;  1JHF A;  3HM5 A;  3QQA A;  4RGX A;  5FFZ A;  1JKQ C;  2IA2 A;  3GTO J;  4RAZ A;  5E3L A;  3BCB A;  1JUP A;  2HYJ A;  2KZV A;  4CYD A;  2Z2S B;  2IPQ X;  2GWR A;  4JP0 A;  2NVQ J;  2ELJ A;  1ZRC A;  1WJA A;  3P7N A;  1XG1 A;  3GFL A;  5HOD A;  2GZW A;  2JA5 J;  2K85 A;  2CFO A;  3ESW B;  2P5K A;  4EEF G;  1ZGA A;  1XGM A;  2OBP A;  2WY7 Q;  2BHZ A;  1NHA A;  1I1G A;  2GIV A;  4M3E A;  3BR0 A;  4CZZ A;  3WTX C;  3MKL A;  2R7X A;  1AKH B;  3BJ6 A;  2WV1 A;  4TV7 A;  1PP8 F;  2KLO A;  4CCL A;  2DAO A;  2DW4 A;  2NNY A;  2CMP A;  4CCJ A;  3N05 A;  4A3E J;  2YSR A;  3J81 Z;  2LH9 A;  3RKW A;  3JSO A;  2OJE D;  5HLG A;  5FLX Z;  3SFZ A;  2R5Y A;  3K70 C;  1N77 A;  5ED4 A;  2RQQ A;  2ME6 A;  1X1A A;  2MAB A;  3I0T A;  5HDG A;  2QKL B;  2M7B A;  2ZXI A;  2EIN H;  2F5C A;  5DCM B;  3N97 A;  2IVM A;  3FIS A;  3S8P A;  4CZC A;  3WTZ A;  4XN0 A;  1W0U A;  3CF5 F;  3BTJ A;  4GCV A;  4PDK A;  1EV7 A;  4H4K C;  3HEF A;  4D7M A;  4E7S A;  4AIK A;  3QPL A;  1B8I A;  2KL4 A;  4BQO A;  4P9U A;  3CUQ C;  3OOU A;  4HYE A;  4KIG A;  1A04 A;  4UHT A;  2QQA A;  4YRV A;  4EMS A;  3BT9 A;  4HSR A;  3HBL A;  2I10 A;  4IZZ A;  2E1M C;  2HWV A;  1KU7 A;  4B47 A;  1IG7 A;  1P6R A;  3AG2 H;  4LK0 F;  3WTU C;  2YS9 A;  2DMU A;  2UV1 A;  2VBZ A;  2B63 J;  2X1C A;  2CRG A;  2HZT A;  1EH6 A;  1G3W A;  1KU3 A;  3E6M A;  3W6V A;  3OYG A;  3K10 A;  2FD5 A;  1X2N A;  2XGC A;  1LVA A;  1VFC A;  1SD6 A;  4BQN A;  2L3D A;  1NH3 A;  2PJR B;  5CLS A;  2K4B A;  4RB3 C;  1IW7 F;  2PMU A;  1EF4 A;  1BI2 A;  2WAD A;  4IHY A;  4X1E A;  1MSE C;  1FYM A;  1Z6T A;  3CLO A;  4EJW A;  3QPH A;  1T2K A;  4NUB A;  5K7F A;  3QRF F;  4C2T A;  2L9V A;  5EGO A;  3FM5 A;  3GBG A;  2L54 A;  1DU0 A;  3SQN A;  5BPI A;  2P4W A;  1R6R A;  2TRT A;  4QWQ A;  3K6G A;  2BOL A;  2BHY A;  3ZXS A;  2EFO A;  2V9K A;  1T56 A;  2E34 A;  2WWY A;  1KYZ A;  1SD4 A;  3VWB A;  4NNJ A;  1T33 A;  5CVU A;  2EIM H;  4U88 A;  4NQW B;  2GXA A;  2PQ8 A;  1HW5 A;  1YI2 I;  3EDP A;  1GT0 C;  2K7L A;  2IRF G;  2XKP A;  1U3E M;  1F43 A;  3IAS 2;  5F1J A;  4XSZ F;  4QLC U;  3P9I A;  2GBY A;  5FKL A;  2JTV A;  3I5U A;  1KGS A;  2E60 A;  2DYR H;  2O0Y A;  2MH9 A;  4OMZ A;  4MEX F;  5LLQ A;  3IHU A;  1T98 A;  3RJP A;  4S05 A;  5FJ8 J;  2LVS A;  4IOA F;  2KJC A;  2EPF A;  1A31 A;  2CG4 A;  2FQ4 A;  2WV0 A;  3L2Q A;  3RDI A;  2D5V A;  1RIO H;  4YFX F;  1G3S A;  1P92 A;  2VJ5 A;  1J7K A;  3E0J B;  3CC4 I;  3KX2 A;  4H0E A;  1H0M A;  3KZY A;  3BZ6 A;  1J9I A;  3CMM A;  2CFX A;  1FPQ A;  3C18 A;  5HLI A;  1TW3 A;  1K4T A;  4EVI A;  2HXO A;  4E70 A;  1QBJ A;  2AQE A;  3OYB A;  5J1Y A;  2XRO A;  3L09 A;  2B7E A;  4ZZL A;  2ECC A;  2ZXW H;  2LD5 A;  3LL7 A;  2LP0 A;  4M6Y A;  2CGP A;  3OYM A;  4UUT A;  1RUN A;  3CCM I;  1XTA A;  5EEA A;  2HTS A;  5FD5 A;  4KIF A;  4XR6 A;  3SEZ A;  4ZZD A;  3WTV C;  1FBS A;  3RPQ A;  5KNL A;  1FTT A;  4JX5 A;  1HQC A;  3BJA A;  2M0M A;  3O6B B;  3OMY A;  4C2M J;  1ETX A;  3OSG A;  5IYC J;  4C30 A;  1IRF A;  2XPU A;  3CJR B;  4Y17 A;  3EUA A;  1RR8 C;  1IDZ A;  2NNN A;  2ESN A;  2GA2 A;  1JUM A;  1JTX A;  1RPW A;  4JYK A;  4M6V A;  2IT0 A;  2V4J C;  5F64 A;  5HDK A;  2K9S A;  1IF1 A;  1HCR A;  3ZQL A;  1G6N A;  3OL3 A;  1JGS A;  1BL0 A;  3MVP A;  2Y0M A;  3G1M A;  3CTA A;  1I3Q J;  5E1Z B;  2E7W A;  1P4X A;  5HS7 A;  2MC3 A;  3PSI A;  1P7I A;  4M3G A;  3E6C C;  3AFH A;  2R93 J;  3K4C A;  1TTY A;  2O61 A;  5BOX A;  4ZDO A;  4UVA A;  3OWT A;  4BL0 B;  5IYB J;  4NBQ A;  5H20 A;  4F55 A;  4LG0 B;  5KHD A;  3FMS A;  3DBH B;  2LBF B;  3L7W A;  4A3J J;  2HOA A;  1K61 A;  1ZH5 A;  4J19 A;  3BG5 A;  1MW7 A;  2W24 A;  1LFU P;  4O6J A;  2MG4 A;  1XSX A;  3U2R A;  1ETY A;  2HOE A;  2CQX A;  2JRT A;  1ZYR F;  5GAE J;  2AXT C;  4LLL A;  3K4L A;  1QPM A;  2DOA A;  1GUU A;  3H92 A;  4BH9 A;  1HKS A;  2M4K A;  1WJC A;  2L7F P;  2VBX A;  4PSW A;  4HF0 A;  3EUK L;  1OR7 A;  3F8B A;  3ABK H;  3V7C A;  1W5C C;  3ZMD A;  3OYA A;  1IXC A;  3GTK J;  4M9S A;  1KU9 A;  4J01 A;  1VQP I;  3L2U A;  2OA4 A;  4Q5S F;  1BI1 A;  1QA6 A;  2HDD A;  2PBI A;  5JLW A;  3BRO A;  1K7A A;  3ZQH A;  4ENM A;  1ERD A;  1OYW A;  4U0V A;  1R1T A;  2K02 A;  4G94 A;  4B3A A;  4PSX A;  3OIP A;  4YEJ A;  1O3S A;  2IP2 A;  3AG4 H;  3UR3 C;  1WGX A;  1OCP A;  4OWR B;  2LNB A;  2HOS A;  1AKH A;  4UV8 A;  4ZJZ A;  4BXX J;  2H94 A;  1U9O A;  2CQ7 A;  5E17 F;  1QO0 D;  4MTD A;  2O8X A;  2R7O A;  3HOW J;  4DBQ A;  2KP6 A;  2J5O A;  4FAS D;  1IV6 A;  5E1W A;  3OYL A;  1RC9 A;  3SJM A;  1VQ6 I;  3HOU J;  4OU0 A;  5DCM A;  2YX7 A;  3JRC A;  1JGG A;  2Z33 A;  4HNV A;  1IUF A;  3HSR A;  3U1D A;  1W7P A;  2E36 A;  1BN5 A;  3A01 A;  2IS1 A;  3CES A;  3G3Z A;  3BG3 A;  3QAH A;  3CP8 A;  5C4X J;  5LEK A;  2OQG A;  2P81 A;  4KDP A;  1DP3 A;  4G6D A;  3ECH A;  4HW0 A;  2DT6 A;  4AIJ A;  3S15 J;  1U78 A;  3AG1 H;  4BAY A;  1KQ8 A;  4O3M A;  3BTI A;  1U5T A;  3ROU A;  1YLF A;  3FXL A;  3IP4 B;  3Q0W A;  5DD8 A;  3SDG A;  2XF5 A;  3F8N A;  2HR3 A;  5M5Y J;  1XX5 A;  2K9Q A;  1Q1H A;  2M87 A;  2CV0 A;  2JVH A;  4N4N B;  1TT0 A;  4RAG A;  1DGR M;  4RB2 C;  1TZL A;  2M2E A;  3WGI A;  3CZ6 A;  1MMD A;  3QP6 A;  1JXS A;  2QF7 A;  4BU2 A;  1S29 A;  2JPB A;  5CJ9 A;  5HS8 A;  1IO2 A;  1FC3 A;  1LDJ A;  2QGU A;  1P4W A;  3I55 I;  3OIO A;  3ML6 A;  3OR2 C;  4GO1 A;  3T1B A;  4XLP F;  3SZP A;  1R71 A;  2DK8 A;  4KMF A;  2JMW A;  1JE8 A;  2VKE A;  3DPL C;  2YUS A;  5L3E A;  2A69 F;  3G71 I;  3PO2 J;  1XSV A;  1OFC X;  2P7V B;  1DQU A;  2FEZ A;  1EKE A;  5EDN A;  1N78 A;  1AHD P;  1DUX C;  1AU7 A;  4WX9 A;  2EIK H;  3IH4 A;  3K4N A;  3E3V A;  2OCC H;  3HSE A;  5LEJ A;  1YG2 A;  3H3U A;  2DOF A;  1ZEL A;  4RS8 A;  3WTW C;  2Z9O A;  1WPK A;  2NRA C;  1MD0 A;  3SZG A;  3OYN A;  3KP5 A;  2QKM B;  4XOT A;  2KIQ A;  2NVX J;  1UHS A;  2X6O A;  3T8T A;  1MBK A;  4Q4Z F;  3LWF A;  2EZL A;  1T0F C;  2HQR A;  2VKD A;  4PJL A;  1BR2 A;  2B0L A;  5J8C A;  5JR3 A;  2EQR A;  2OAZ A;  4A0X A;  4BBS J;  1GDT A;  4NQW A;  4HF1 A;  4GYI A;  3OYJ A;  1BW6 A;  2FQ3 A;  2IS4 A;  2FSW A;  3C2G A;  1DGW Y;  1GXP A;  2MD5 A;  3HHH A;  3M8F A;  3CQZ J;  5TRD A;  4BAC A;  1TC3 C;  1QHH D;  1R4M B;  2CQN A;  3JTG A;  4OIR F;  2HS5 A;  2QBY B;  1ON1 A;  3D5R C;  3MAJ A;  4D0P A;  2HXI A;  2VOP A;  3BR3 A;  2L5Q A;  5DM6 F;  2K40 A;  3VSK A;  2VBY A;  3HL2 A;  2JUG A;  2EWN A;  2JUC A;  3GF2 A;  4KJZ A;  2Y9Y A;  2DDB A;  3WHC A;  4DYC A;  3HJE A;  2AO9 A;  2K3P A;  3S1M J;  2MBF A;  3QYE A;  1ZAO A;  4A3D J;  5DUI A;  1YIO A;  3Q0V A;  5E3O A;  3Q9S A;  4AIH A;  3ZQ7 A;  1ZR4 A;  3RQ4 A;  4UVC A;  2LY2 A;  1YJW I;  2DPD A;  2KRC A;  2STW A;  2X4H A;  3MEX A;  3KZZ A;  3O3K A;  3LSR A;  4DOZ A;  3D0S A;  5L3D A;  3MZY A;  4F91 B;  3DLA A;  3JRH A;  1GXQ A;  2W25 A;  3MD2 A;  2A5Y B;  3E5Q A;  3E1S A;  4G6Q A;  3ZMU A;  1J09 A;  2Y75 A;  2CUJ A;  2QVO A;  2CUF A;  4WWC A;  1GVD A;  2M8G X;  3HRT A;  2XVC A;  1FBU A;  4C3I J;  3GVA A;  1ACI A;  4G7H F;  2XAU A;  2KMU A;  2LYC A;  5EG0 A;  3S2D J;  1MND A;  1Q1V A;  3IH2 A;  2EJR A;  3A0B C;  1XC5 A;  2E19 A;  4CCM A;  3T8R A;  3CC2 I;  1CQT A;  1JTY A;  2BY1 A;  2W00 A;  3NWT A;  3ZMV A;  1H89 C;  2K9M A;  4N9I A;  3SEQ A;  3CCE I;  2DK5 A;  4CCN A;  4MIM A;  4Q47 A;  5D8L B;  4XLH A;  1Y8Q B;  3R4K A;  3O8G A;  2DA5 A;  3WG7 H;  1R22 A;  5GTH C;  1UAA A;  3LFU A;  4UUV A;  3FDY A;  1HA8 A;  2VXD A;  2HEO A;  4IOC F;  3KET A;  4U7B A;  3DQV C;  4ENN A;  2XSJ C;  2FXA A;  4RLF A;  4CGZ A;  2VT2 A;  2Z1D A;  3TOB A;  1D3Y A;  2LTP A;  1HKQ A;  2WC2 A;  2FF4 A;  3P9C A;  3EYI A;  4I01 A;  5GAH J;  4UVB A;  4II2 A;  3DF8 A;  2Z16 A;  3LA2 A;  1RKT A;  5JHU A;  5LD2 C;  1ZGW A;  1BM9 A;  4DYR A;  2RN7 A;  1TW2 A;  2YPR A;  5D4R A;  1TQM A;  1UB9 A;  4M71 A;  3GZ5 A;  1ETO A;  4BEH B;  1YE9 A;  2LG4 A;  2ZC2 A;  1FWZ A;  2LKS A;  1EJ9 A;  5IT9 K;  2DA7 A;  4OIP F;  2DMP A;  4LIV A;  3ASO H;  3FMQ A;  1S7A A;  4GRI A;  3B02 A;  3BR5 A;  3CMA I;  3DKY A;  2EV6 A;  3HOY J;  1DPU A;  2DFI A;  3EUH C;  2AQF A;  4XQF A;  3OIQ A;  2RDP A;  1IN5 A;  2Y31 A;  1O3Q A;  3O8H A;  2XAH A;  4BQQ A;  2DO7 A;  2HYG D;  1EH7 A;  2DA6 A;  2WA0 A;  5DUK A;  3SFI A;  1ZN2 A;  4EJU A;  3ZQC A;  3P5J A;  4V2G A;  2O5R A;  4HAM A;  1OCC H;  4XIC A;  3BPV A;  3U21 A;  4C9Y A;  2ETH A;  2DJI A;  5CVJ A;  4DW6 A;  1ETV A;  1FBQ A;  1OYY A;  1NTC A;  4II3 A;  4EQQ A;  3BDD A;  4LK1 F;  4KIB A;  4AUX A;  1SFU A;  4A3B J;  3H5A A;  1NK2 P;  1XMX A;  4AU7 A;  2HI3 A;  5J47 A;  5HVQ C;  2HPI A;  2NS0 A;  2X6W A;  3GFI A;  1HW1 A;  4PJN A;  2XF6 A;  4HLX A;  4BYY A;  4IQJ A;  2DT7 B;  2UXN A;  5J40 A;  4FCY A;  3NQO A;  5EYR A;  4N0B A;  1MIJ A;  2M8E A;  4XKV A;  1ENH A;  4D5F A;  2M5W A;  3CUQ B;  3I58 A;  3SHF A;  3WHB A;  1T38 A;  1B9N A;  4BS9 A;  1J59 A;  1MH3 A;  3HOX J;  1ODD A;  1OCR H;  2EZI A;  2KKO A;  4AVZ A;  1Y0N A;  1O4X A;  1V55 H;  2E1M B;  5D5U B;  4DZJ A;  2DDA A;  1R1U A;  4P96 A;  4D5C A;  3CD6 I;  1B4A A;  1K6Y A;  2JZY A;  2A68 F;  2V1X A;  3BP8 A;  5JVG F;  1E2X A;  1X1D A;  4IRH A;  4XLC A;  2MFZ A;  5K5O A;  2DMT A;  3M8J A;  5AIP A;  5L3B A;  5CVR A;  2A07 F;  1O3R A;  1XCV A;  2RAE A;  2DXI A;  4S0H B;  4XID A;  4KMU X;  4BHP A;  3G2B A;  1YJ9 I;  3PQK A;  2W82 A;  4RDU A;  1O3T A;  4A6E A;  1MMG A;  2EFW A;  2BY0 A;  1FOY A;  3HPG A;  1RRJ A;  3JRG A;  1POG A;  3GCM A;  3ULQ B;  4I76 A;  2OV7 A;  2ZME A;  4J00 A;  3HTS B;  2HYF A;  1I50 J;  5B5E C;  1MDM A;  2V9P A;  3S14 J;  3JW4 A;  1MMS A;  3OYE A;  4G9Y A;  5FKM A;  2G9W A;  3OSF A;  4A3C J;  2WTE A;  3LOC A;  5FD6 A;  2ELK A;  2O3F A;  2KIU A;  1Z77 A;  1ZLK A;  1IRZ A;  4M6X A;  2QEN A;  3RSN A;  3ISP A;  1QHG A;  2DA2 A;  3CJT B;  3VFZ A;  3ONQ A;  3LSM A;  3CLQ A;  4A3F J;  2NYX A;  2M7A A;  1TT5 B;  5M5X J;  2DOE A;  2BXZ A;  1LE8 B;  3JRD A;  1VZ0 A;  1S5L C;  1MBH A;  1YO5 C;  4AID A;  1IN8 A;  5BMZ A;  2O8K A;  4B43 A;  3BOQ A;  5GAD J;  4XOP A;  3MN2 A;  3CCR I;  3GTP J;  5E3N A;  3CO6 C;  3ZQF A;  1JJ8 C;  1HOM A;  3GLX A;  1U9N A;  5C44 J;  1MBG A;  2R3S A;  1QVT A;  1XGS A;  1ZR2 A;  3BWG A;  2R5Z A;  1IDY A;  2JA2 A;  3DCF A;  2ZBK A;  1IRX A;  3BPX A;  1W4M A;  3I59 B;  4R79 A;  3FIW A;  4PK4 A;  1AWC A;  1J2X A;  5CQE A;  1OQY A;  3FZV A;  1E3H A;  2HZD A;  2E1C A;  1ZTR A;  3BG6 A;  2ZXH A;  3R61 A;  2JA8 J;  2R7S A;  5CYV A;  4ZDP A;  1YS7 A;  3K4J A;  3UKG A;  1D0Y A;  5IY5 H;  3HOV J;  1D8K A;  1WRJ A;  4OAY A;  1DDN A;  1Z3X A;  2XC7 A;  1W36 C;  1ZK8 A;  3QWL A;  2XPW A;  2JSC A;  2GA1 A;  4D7N A;  1FYL A;  1VQ9 I;  3K7A J;  3OYI A;  2EA4 A;  2VE8 A;  2IGM A;  2YX4 A;  3OYC A;  2L9R A;  2R7V A;  3F6V A;  2L4M A;  4MFE A;  4MQ9 F;  3R6S A;  4I0A A;  5GPC A;  1TL8 A;  1F36 A;  3MQ0 A;  2K86 A;  3KE2 A;  5AIQ A;  1TP4 A;  3ABU A;  2X0L A;  2R7F A;  2RKH A;  5CVI A;  3G4S I;  1Z05 A;  3J7Y J;  2VC0 A;  2F5V A;  3Q0U A;  1QU3 A;  2K4J A;  3H3Z A;  3SXY A;  2W84 A;  3SYT A;  3OR1 C;  2LKX A;  1FZP B;  3NWS A;  2ZSH B;  5F08 A;  4UB6 C;  3JSP A;  4M73 A;  2FNP A;  2EFQ A;  2LOO A;  3JR9 A;  4IVN A;  1RET A;  3HSF A;  3Q9V A;  3I71 A;  5LHG A;  5B66 C;  5HLH A;  2MLK A;  3CCJ I;  4CA0 A;  2EB7 A;  1MNE A;  4ABZ A;  5AON A;  2XAJ A;  3HRU A;  1BC7 C;  1MNM C;  2HVS A;  4L9J A;  1VND A;  1P9Q C;  4L18 B;  2JT1 A;  3WGH A;  2A6E F;  2IW5 A;  4XRS A;  2H1L A;  3CDL A;  1JJ6 C;  1YOV B;  3G6E I;  4Y7N J;  3MCZ A;  1X4O A;  1OPC A;  2STT A;  2V7F A;  2QQB A;  4I0B A;  4I6Z A;  1P2F A;  3DBR B;  2VL8 A;  2G7H A;  3CJQ B;  4LFU A;  1ZG5 A;  5J8F A;  4CO8 A;  4CIC A;  2ZCW A;  3LMM A;  2CS3 A;  4A3M J;  1QZZ A;  1OCO H;  3TBI A;  5D5W B;  3ERM A;  1LEB A;  1IXS B;  2E2H J;  3HIF A;  1K78 B;  3RZO J;  2XGD A;  3FXK A;  2Q2E B;  3F23 A;  1IAW A;  2M3A A;  4IO9 F;  2M30 A;  1O7L A;  3L2R A;  1YTY A;  2GXG A;  5DDG A;  5HOO A;  3LA3 A;  3R60 A;  3MZH A;  2WB1 N;  1Z3Y A;  4L5I A;  2EFN A;  5GTI C;  4BNC A;  1FNN A;  1EA3 A;  2FRH A;  4BEH A;  3F6O A;  3KLN A;  4M3B A;  1K6O A;  1M1E B;  1OCZ H;  3KCC A;  4DIQ A;  3VB2 A;  2LR8 A;  2V6E A;  4B4C A;  3K4K A;  4UY8 I;  1H9G A;  2HOT A;  2LKP A;  2L9N A;  3HGG A;  2CU7 A;  2YU3 A;  3BR6 A;  4BHC A;  2DA3 A;  3PSF A;  1SC7 A;  1FT9 A;  2DTZ A;  3VDX A;  1QPI A;  3QU6 A;  2IS6 A;  1YX3 A;  2WB1 A;  2YR2 A;  4KN4 X;  1YRN B;  3PM1 A;  3W2W A;  4RB1 A;  4N4O B;  3IWZ A;  4HX7 A;  3FHN A;  3PNY A;  2M4G A;  5FKN A;  3W2V A;  1MKM A;  1BIA A;  2Y69 H;  4IXA A;  3A4C A;  2Y2Z A;  4XN3 A;  3I4P A;  5K1Y A;  2XGX A;  1BBY A;  4GFB A;  2DI3 A;  2E71 A;  1T08 B;  3PFI A;  4XKB A;  3V42 A;  4A5M A;  3GZN B;  3GFM A;  2GOX B;  3NEU A;  5CPR B;  1PUF B;  5FKO A;  2UWM A;  3JAM Z;  3ABM H;  3CUQ A;  4JK1 X;  2JQ7 A;  4HA8 A;  1UST A;  2X9D A;  1UEL B;  3E7L A;  3CMY A;  4L9T A;  2W7N A;  2M9H A;  5M3F J;  1R5I D;  1FOX A;  2UUZ A;  2QUF A;  2V79 A;  2XB0 X;  4HDV A;  3RKY A;  1B72 A;  2A61 A;  1GHC A;  4B1R A;  1B1B A;  1ITY A;  4ITV A;  4LLN A;  3IAM 2;  4L9N A;  3QYB A;  5ERI A;  9ANT A;  3SZT A;  1F9N A;  4XNF A;  3EQL F;  4IHW A;  4HQM A;  3WU0 A;  2VB6 A;  4LGW A;  4MFD A;  3IRR A;  5IP6 A;  2IBD A;  4W97 A;  3H1C A;  4HV5 A;  4L0Y B;  3J7A O;  5E20 A;  1QZY A;  4L5J A;  1ZRE A;  2EFP A;  3LAJ A;  4C2U A;  2OD5 A;  1SFX A;  2BVM A;  3ZCO A;  4YFN F;  5EF6 A;  4BJT A;  3U1K A;  4NHJ A;  4BE1 A;  4OIO F;  1D5V A;  4HRI A;  4LIU A;  5E79 C;  1FEX A;  1LVK A;  3DTK A;  1Y1V J;  2PLY A;  1R9T J;  2DFF A;  1A35 A;  5ILS A;  3S17 J;  3QOD A;  3MZ8 A;  2DCE A;  2QLZ A;  4A12 A;  2XB5 A;  5EZH A;  1GVJ A;  4BKX A;  3Q5F A;  1CF7 B;  2VQL A;  1IC8 A;  4CYC B;  4R1H A;  1FJL A;  5IP7 J;  3TGN A;  3FXM A;  1K4S A;  4JX6 A;  3UNG C;  1ORK A;  3HDD A;  1WFX A;  3OYH A;  1YQA A;  3RYP A;  5A2Q K;  4DBR A;  4S04 A;  4XOR A;  2ZJQ F;  2DJN A;  1AOY A;  3W6K B;  3C2B A;  3L2V A;  4B8X A;  3PNT A;  4HST A;  3H0G J;  3FMR A;  3U9G A;  5DCF A;  3CCY A;  1G2H A;  2R0Q C;  1BA5 A;  1QRY A;  2DYS H;  4FE4 A;  1PP7 U;  2R7D A;  3K70 D;  3F72 A;  3I54 A;  3JRE A;  4E7K A;  1X3U A;  1NG7 A;  5LHI A;  2OF7 A;  1I6H J;  1BW5 A;  5BQT A;  2VON A;  3HKZ A;  5ILU A;  4KNY A;  4I99 C;  2EK5 A;  4PCQ A;  3KEQ A;  4P9F A;  1MJA A;  1L0O C;  1FP2 A;  3GO5 A;  1KQ0 A;  2E2I J;  2E5N A;  4BXF A;  2ZB9 A;  1X3Z B;  3TL4 X;  1W36 D;  1CGP A;  1MJ9 A;  1Z7U A;  2A3S A;  2G0E A;  1RI7 A;  4ENK A;  5HLT A;  4GYG A;  2R7Q A;  4YIR X;  1G8X A;  4YII A;  3FXR A;  4P55 A;  5E8G A;  2RVC A;  2QSG X;  1IN7 A;  3J80 K;  3FM3 A;  4LB5 A;  2Q8K A;  2E2J J;  4E4H A;  2FOW A;  2GAU A;  4PJ0 C;  3DLL F;  2HNH A;  4U0W A;  1RES A;  3GFJ A;  1YYV A;  1HKT A;  3FX3 A;  2CQK A;  4QIW N;  4DGW B;  2A6T A;  1NK3 P;  2CSO A;  2CO5 A;  4B3X A;  2JK3 A;  3BR1 A;  3EYY A;  3TO7 A;  1ZRF A;  3FBN B;  2ZNZ A;  4XON A;  4LG3 A;  2XV4 S;  2H09 A;  3ZMS A;  2ZO4 A;  1U8B A;  2DPU A;  2BZT A;  5BS6 A;  3ZP5 A;  2LK2 A;  2PJR A;  3T5X A;  2VT3 A;  3REO A;  2A05 A;  1XMK A;  2E35 A;  2NS7 A;  4RGS A;  1JUS A;  2ICW G;  4C3J J;  1WVR A;  4IRI A;  4IHV A;  1YIT I;  1LPQ A;  1I5Z A;  5H6Q A;  5KAI C;  2Q0O A;  2DTR A;  2VLA A;  2CYY A;  3CF2 A;  2I5U A;  1IGN A;  4DYQ A;  4LIT A;  1GV5 A;  4LOC A;  3E5U A;  4CUG A;  1KON A;  3B6C A;  1WH7 A;  2OPT A;  2VPR A;  2OTL I;  1SVL A;  1AA7 A;  3LST A;  5LRS A;  1D1B A;  1A6Q A;  1JKP C;  4P5O A;  3VEP A;  3MKZ A;  2CW8 A;  3MKY B;  3LSH A;  1IRG A;  1REP C;  1FSH A;  4C3H J;  3BR2 A;  1LKX A;  3Q3S A;  1K78 A;  2ISZ A;  5FGM A;  1KU2 A;  3BZC A;  3IKV A;  4XLF A;  5EEG A;  4IHS A;  5TIS C;  2HGC A;  3K4M A;  4CCK A;  5GPA A;  3T0Y A;  3DKX A;  3ZMT A;  4I09 A;  2ELH A;  2L02 A;  1S9H A;  1LDD A;  2W4S A;  4AM3 A;  3IRQ A;  5H6R A;  1W5T A;  3WE2 A;  2L01 A;  2HVR A;  2O03 A;  1MSF C;  4HX4 A;  2CV1 A;  2QYO A;  5ICC A;  3I4N J;  2R5Y B;  4PGH A;  4A93 J;  1VQK I;  1TNT A;  2X1E A;  5LGN A;  1N75 A;  4E6K G;  1APL C;  3CDH A;  2QZ8 A;  4FTH A;  3I4M J;  2VQH A;  3JRB A;  4XSX F;  2FX0 A;  4KT5 C;  2QA4 I;  1A6I A;  3RIR A;  2HDW A;  4FIS A;  4V2F A;  1WQ2 A;  3R0J A;  3VYS B;  2F5E A;  3MKW B;  1B8I B;  5IPA A;  1YRN A;  4PJM A;  4FT8 A;  2ISY A;  1OLT A;  3FF5 A;  5K5Q A;  2HTJ A;  4CCO A;  3KYL A;  1WI9 A;  1PJR A;  2CQQ A;  3ZOB A;  1Y39 A;  4KFC A;  1G3Y A;  2GIZ A;  2LC2 A;  3KZI C;  4BDY A;  3GUD A;  4HNU A;  2FOK A;  4IHT A;  1XGN A;  3CJN A;  1X4P A;  2X6Y A;  2LY1 A;  3GXO A;  4W1U A;  4E7H A;  3I9V 2;  4JBA A;  3BY6 A;  2JWT A;  3KFW X;  2LF7 A;  1ZG3 A;  3VPR A;  2N8G A;  2P7C B;  2R7Z J;  3H5N A;  4A3I J;  3ZN0 A;  3N4M A;  2OTJ I;  1SFO J;  1R49 A;  2D1V A;  4GDF A;  3BTC A;  3KYD B;  3K1M A;  1JKO C;  4OIQ F;  1L3L A;  4GGG A;  4WXD A;  5CKT A;  3S93 A;  2VOD A;  2EA2 A;  4IL6 C;  5DD4 A;  4L9V A;  3V8L A;  2PI0 A;  4MTE A;  2LLK A;  3KEO A;  3LQR A;  3K0L A;  1QVU A;  3GTQ J;  1T39 A;  3VYT B;  2V6C A;  2ZJR F;  1RR7 A;  1V5G A;  2XPV A;  4YEL A;  4ANJ A;  2BVL A;  5EGO B;  3COA C;  3PO3 J;  4XMY A;  4LG0 A;  4BY7 J;  2LBF A;  2OC6 A;  2Z3Y A;  3D5L A;  1I39 A;  3B6A A;  4ENJ A;  2LMD A;  4KA4 A;  1Y6I A;  2UZK A;  2LFB A;  1SD7 A;  3A1Y A;  2ESH A;  5M3M J;  1VQ7 I;  4HDU A;  2ZNY A;  1VQM I;  1VQO I;  3H36 A;  1LJ9 A;  1P4A A;  3C7J A;  4WF2 A;  1WWX A;  2BY3 A;  4BGD A;  3WU1 B;  4WXH A;  1YFH A;  5M5W J;  3FXO A;  2MYS A;  4XK4 A;  1SMT A;  5DEQ A;  3FXQ A;  4FHT A;  4RAY A;  1SFE A;  1J5Y A;  4F93 B;  4FX4 A;  2P6S A;  5BNG A;  3A2K A;  4G7O F;  5EJC A;  4A6D A;  3DPT A;  4ZH4 F;  1BR4 A;  4EGZ A;  3OS1 A;  1T0F A;  2QCO A;  2HQN A;  1A36 A;  2Y9Z A;  1HST A;  2M45 A;  3M07 A;  4Y52 J;  2DFE A;  4KN7 X;  1DPR A;  2FML A;  4UV9 A;  1S3J A;  4KYW A;  2D2W A;  3W3C A;  1R7J A;  1Y0U A;  4MLO A;  3V8K A;  2CV2 A;  1YJN I;  3CUO A;  2E1O A;  1R58 A;  2LSO A;  5LRR A;  1YX5 A;  2WBM A;  1R5H A;  5KCM A;  1VQL I;  1TWA J;  2M1B A;  1BOB A;  1R1V A;  4EM1 A;  5JI6 A;  2JA6 J;  1WH5 A;  2L4A A;  3KP7 A;  1MZB A;  1PVE A;  2GQQ A;  3OS2 A;  1UG2 A;  2DLL A;  3FKI J;  3M7G A;  2BY2 A;  1A5J A;  1D0Z A;  4A2U A;  4ESB A;  2LRE A;  3WG9 A;  1SAX A;  2FBH A;  2L9S A;  3TKY A;  3H0D A;  3F0C A;  4NB5 A;  5D5X B;  3ZQQ A;  1ZG1 A;  4A5N A;  3H9J A;  3M8E A;  2CUE A;  3HUG B;  2F4I A;  1UZC A;  4RM3 A;  1T95 A;  1R5G A;  1G4D A;  1OJL A;  4IPA A;  1VTN C;  3RYR A;  4YG2 F;  1LUJ B;  2OU2 A;  5E3M A;  4AYB N;  1QQI A;  2V9V A;  1HC8 A;  1OYI A;  2NVY J;  1MBF A;  1ULY A;  2K27 A;  2AHQ A;  4EAT A;  3IUO A;  1VI0 A;  2HKX A;  2Z99 A;  1X1C A;  5FLV A;  1X1P A;  4BE2 A;  1BI0 A;  1KQ9 A;  3CDI A;  3CME I;  4ZTJ A;  1C0W A;  2BGC A;  2IEK A;  1KYW A;  4XRM A;  1MBE A;  1ETW A;  3DTI A;  1TWG J;  4D1Q A;  3IV5 A;  3JRI A;  4R8H A;  4ASN A;  3HZJ A;  3TO9 A;  2HKO A;  1BR1 A;  4DZP A;  4LLG F;  3FK7 A;  5F6F A;  4G6T B;  3K69 A;  4AYB A;  1TQP A;  3GW2 A;  4X0G A;  3JTH A;  3V8J A;  1U0J A;  5FRO A;  4WCG A;  1JHH A;  2PEX A;  1E17 A;  2EIL H;  1HDD C;  1MJB A;  4XLN F;  2H8W A;  1H9T A;  3E5X A;  2H6B A;  5IOZ A;  1VQ8 I;  4JOM A;  4OOI A;  1QZE A;  2RC4 A;  1FLI A;  1SVO A;  3QU3 A;  1RKW A;  2JVG A;  2QEX I;  4MEY F;  3JRF A;  1BJZ A;  3RZD J;  1W0T A;  1Z1D A;  3KYC B;  2HQA A;  2RGV A;  2QQ8 A;  4D9J A;  2LF8 A;  2Y30 A;  1VQ4 I;  2L7K A;  2VE9 A;  1QNT A;  3VYR B;  1ZGJ A;  3RTR A;  1B9M A;  4LMY A;  3G1O A;  2WY8 Q;  4RMN A;  1RNL A;  3S32 A;  4QTR A;  1E3O C;  5DV5 A;  2FE3 A;  3DEU A;  3H9Q A;  2RNJ A;  2ZJ2 A;  1X19 A;  2W1O A;  1MMA A;  4HNT A;  2W57 A;  3OS0 A;  5K7Z A;  3CP2 A;  1HW2 A;  4M3F A;  1OKR A;  2RRE A;  2Y48 A;  3EUH A;  4U7D A;  2MA3 A;  1ZLJ A;  3W2A A;  3OYD A;  1SVM A;  4PZJ A;  3AKZ A;  1IUY A;  2FMY A;  4HG2 A;  5FKK A;  5KVR A;  2KIF A;  3K2A A;  3QPS A;  2V1U A;  4OMY A;  1X58 A;  3HHG A;  3IH3 A;  4F92 B;  5C3E J;  2QBY A;  4I2O A;  2VAS A;  1XMA A;  1YIJ I;  2VQC A;  5EZG A;  3M3Y J;  3DFG A;  3E6D A;  2GOM A;  1R00 A;  2H1K A;  3GTG J;  2COB A;  1S6L A;  1UMQ A;  2OUM A;  2Q1Z B;  2IA1 A;  3V7R A;  2AXL A;  4KIT B;  3FKJ A;  2R7T A;  3RCO A;  3TW6 A;  2PMZ N;  2V1D A;  2IXS A;  3ZQI A;  3FXU A;  3L9F A;  2FBI A;  5F04 A;  3WE3 A;  4LB6 B;  2BXY A;  3J7Z I;  4LJZ F;  1W7P B;  3GEZ A;  3A01 B;  3AAF A;  2KIM A;  4FE7 A;  3LSP A;  1ZHF A;  5E8I A;  3KLO A;  2Z5U A;  2D45 A;  1Y56 A;  3QOP A;  2BBY A;  3BG9 A;  3CC7 I;  1NG6 A;  5FO5 A;  3DBL B;  1I1S A;  2VPL A;  2P6T A;  1U5T B;  2ZXJ A;  5C4J J;  2EV5 A;  1S7O A;  2OQR A;  2LDU A;  2HPM A;  1KZH A;  5J4V A;  3ZGK A;  5L3C A;  3RPU A;  2DQL A;  2PMZ A;  1WHU A;  4ESF A;  3S1R J;  3S1N J;  3S3N A;  5HDN A;  3DEE A;  4IEJ A;  5BPD A;  2X48 A;  5E18 F;  1WJB A;  4L0Z B;  2JSP A;  2PN6 A;  3TP0 A;  1MH4 A;  3PQJ A;  2P8T A;  2QM3 A;  3H35 A;  2H8R A;  2E5Z A;  2KIS A;  3HYI A;  3JRA A;  2EH3 A;  3E6B A;  3S3O A;  4XLE A;  2VIX A;  1STZ A;  1Z67 A;  2F2E A;  2VXZ A;  4Z2Y A;  3D1N I;  3I64 A;  1PYV A;  2GXB A;  4HLY A;  5E1X A;  5LHH A;  1ONV A;  3MFK A;  2EZH A;  4L5E A;  4BJ5 C;  3ERE D;  1XGO A;  1B6A A;  2FJ1 A;  1ZAR A;  2ACJ A;  3S16 J;  3ZMZ A;  1I3A A;  2EBI A;  2VJI A;  3BG7 A;  3F9K A;  5ICG A;  3F21 A;  1OR7 C;  4WXC A;  3S1Q J;  2XIG A;  1SEU A;  1FOK A;  2FBK A;  4A3G J;  3VOE A;  3ZR8 X;  1FMV A;  1TLH B;  4EJV A;  4MGR A;  4B44 A;  2LY9 A;  2WAE A;  1TWF J;  3HC7 A;  3WU2 C;  4CDG A;  4Z6Y A;  4E7L A;  1DP7 P;  1E3P A;  4A0Y A;  4ON0 A;  1O7F A;  1XB4 A;  3AL0 B;  1XS9 A;  2FUG 2;  3F8C A;  2HFH A;  3LFK A;  4UUS B;  2XDV A;  2O9L A;  2CH0 A;  1FIA A;  1XN7 A;  1UJ8 A;  2XGE A;  5J4Y A;  1UG0 A;  2ADU A;  3BQY A;  2DT5 A;  4BQA A;  4KIS A;  3BZK A;  1B59 A;  3A0H C;  2P5V A;  3F8M A;  3MWM A;  5J6X A;  1F5T A;  1VQN I;  1LEA A;  1Z0X A;  1H88 C;  5IYD J;  3ASN H;  1R23 A;  4Y3O A;  1GLN A;  4AVP A;  2FNA A;  1FYK A;  1V5E A;  2XF7 A;  5IT9 Z;  2KPM A;  1UCR A;  2NAZ A;  5LBQ A;  4FET A;  4BBR J;  4B09 A;  3VOD A;  3I3L A;  1J75 A;  4EJT A;  1RUO A;  3HXL A;  5ICF A;  2VQG A;  4JQF A;  4M9Z A;  2KT0 A;  1K83 J;  1BI3 A;  1T8I A;  4V19 K;  3K2Z A;  1S8N A;  1V3F A;  3CCS I;  1HF0 A;  5F1R A;  1WKM A;  3IL2 A;  3GX4 X;  2KJB A;  2MH2 A;  2Y0S N;  3HUG A;  2F4O B;  3AG3 H;  3ZN1 A;  2KRF A;  4KT6 A;  4YFK F;  3OYF A;  2DOD A;  2ZSI B;  3TMO A;  2D1H A;  5EG0 B;  3I56 I;  1U5T C;  3B73 A;  1I6X A;  1LNW A;  3LA7 A;  3RPU D;  1XCB A;  1F4K A;  4HEA 2;  1WCM J;  1X3W B;  2JRM A;  1SMY F;  4F3Q A;  2L2O A;  2XRL A;  4BDZ A;  4HX8 A;  4KUM A;  5FRN A;  1FMW A;  3QYF A;  4HZF A;  2R92 J;  4PFP A;  1JI8 A;  5H2F C;  1Z7L A;  3DXJ F;  2VUM J;  6PAX A;  4Q48 A;  3VSL A;  1MBJ A;  4QPO A;  1XDU A;  2O7O A;  3DWL E;  2XUB A;  2X1D A;  2Y0S A;  3DTE A;  3PUF A;  3FHZ A;  1J0R A;  1U6G A;  2OCE A;  3PL8 A;  3K1P A;  4UNO A;  4RB0 A;  3KP3 A;  1WI3 A;  5L3F A;  3LSJ A;  3EPZ A;  2BYV E;  1BIB A;  3L2C A;  2ZFW A;  1IJW C;  4PUS A;  2HQ5 A;  3HB9 A;  5F0C A;  4X6A J;  4EV0 A;  1BOA A;  5JVT A;  2IGN A;  2IGK A;  3KIO A;  3G73 A;  1N25 A;  1LE8 A;  3DV8 A;  2QSH X;  3HTU A;  3HKZ N;  4AWX B;  4QPQ A;  2R7U A;  1YW7 A;  4E7J A;  3ELK A;  2ZJP F;  1TWC J;  4HQE A;  2CUZ A;  2GM4 A;  2H6C A;  1XD7 A;  4UB8 C;  5K7H A;  5CVV A;  4ETS A;  1Z91 A;  1ZKG A;  1TNS A;  4M72 A;  2K9L A;  2PX9 A;  1P7J A;  2FU4 A;  4IKF A;  3AL0 C;  5D6F A;  3PUB A;  4XRF A;  1D1A A;  4FQG A;  3M1E A;  1SAN A;  4MHG A;  5FLM J;  1LDK B;  1TQI A;  3GZ6 A;  1R36 A;  3LQQ A;  4I98 B;  1T6S A;  2RV8 A;  4GXO A;  5KK1 A;  5IOY A;  5IP9 J;  5JHF A;  3I59 A;  4ZC3 A;  2IA0 A;  3QP5 A;  2VJ4 A;  3TED A;  2A6H F;  3C3W A;  1ZRD A;  4NC8 A;  4OIN F;  1X2M A;  2PFB A;  1UHM A;  4G12 A;  4NC6 A;  2PMH A;  2VKV A;  2RQP A;  2G7U A;  3HOS A;  2O6G E;  5JLX A;  4BY1 J;  2HDC A;  5GAG J;  5HS9 A;  3TO6 A;  2MW8 A;  3LAP A;  3J7A Y;  5IT3 A;  5F27 A;  1ETQ A;  4IJA A;  5FRM A;  1FOW A;  3PJR A;  2BE5 F;  1F1Z A;  4M74 A;  4NDL A;  2QWW A;  3CCV I;  2BW3 B;  1YW9 A;  4RAF A;  4OAZ A;  4RBO A;  4JX4 A;  2B9S A;  1S72 I;  1WJF A;  2XAG A;  1QGP A;  5DM7 F;  1D8J A;  4EJO A;  4F7Z A;  3KEY A;  1HBX G;  1O57 A;  1SFK A;  2COM A;  1VQ5 I;  4CH7 A;  5KAF C;  4AC0 A;  3S2H J;  1OCT C;  5TJJ A;  3WOD F;  3FXJ A;  2NOJ B;  3IWF A;  1D1C A;  2QSF X;  4KIC A;  4CHU A;  2XAF A;  4M3D A;  3OYK A;  1XPX A;  1IZ1 A;  2E1N A;  4M9X A;  4B48 A;  2ZME B;  2V1N A;  1G3T A;  3H3V K;  4A3L J;  3DEW A;  1MDM B;  1FY7 A;  3CCU I;  3OL4 A;  4AD9 A;  2DFH A;  1WSU A;  3PIP F;  4UXN A;  2KQR A;  4HF2 A;  1HXD A;  3WGG A;  2JN6 A;  4XRS G;  2PG4 A;  3NRV A;  3J81 K;  5D5V B;  5J1U A;  1BC8 C;  1XDS A;  3HPH A;  3GTJ J;  5FLX K;  4IHX A;  3TOA A;  2F5F A;  2XSD C;  2ME0 A;  5DS9 A;  4BUP A;  4XL9 A;  4U87 A;  3F22 A;  4HOB A;  5EEH A;  2Q2E A;  2V26 A;  4G8X A;  3IC7 A;  2XHK A;  2WAQ N;  3EET A;  2R5Z B;  2XKO A;  3I53 A;  4MO7 A;  2F4M B;  3RI4 A;  2NS8 A;  3V7S A;  5K5R A;  1IV8 A;  2F5D A;  4K2E A;  3S3M A;  4IF4 A;  1FIP A;  2OZ6 A;  4IQ4 A;  2E7X A;  4RLQ A;  4A3K J;  4XLA A;  1IXR C;  3H5R A;  4BHB A;  2OZU A;  4MQV A;  3RKQ A;  1S7E A;  4DQ2 A;  5GP9 A;  1I27 A;  3HRM A;  3VYU B;  5B3S H;  5CQG A;  5DTD A;  4F52 A;  3R0A A;  2LRD A;  3DU6 A;  2DBB A;  1Z9C A;  5B1B H;  2P5L C;  1Z21 A;  5J3L A;  2DA1 A;  2L7Z A;  4A0Z A;  5D8K B;  1SD5 A;  4QSH A;  1ZQ3 P;  2DN0 A;  4UUS A;  3HG9 A;  2WAQ A;  1BJA A;  2FA5 A;  2ECB A;  4ESJ A;  2M0C A;  3KPH A;  5LFA A;  1PUE E;  4PFO A;  3OV8 A;  3F8F A;  2DA4 A;  1HLV A;  3FBI B;  3W6J B;  3QPT A;  3WTY C;  2X51 A;  2ID3 A;  3G1L A;  3DP7 A;  1R4N B;  2P0W A;  4IX7 A;  4FX0 A;  3L1P A;  3TP3 A;  2NXN B;  3WTS C;  4IRG A;  1MMN A;  2KFD A;  2K9N A;  2TDX A;  1TBX A;  2TCT A;  3BJO A;  1V5F A;  3DU5 A;  1TWH J;  3MMY B;  4HV6 A;  4O5V A;  3L2W A;  2VJJ A;  1K79 A;  4Y15 A;  4Y33 A;  4ZYA A;  1PUF A;  3ZQG A;  3HGY A;  2HU9 A;  3D5S C;  1WJD A;  1W7P D;  1OIS A;  5D4S A;  1HDP A;  1EH8 A;  2JA7 J;  4XKC A;  1JT6 A;  3BC8 A;  1SAU A;  3CCL I;  2EIJ H;  1V54 H;  4U0Y A;  2PJP A;  3KP4 A;  2VBW A;  2CWE A;  3RQI A;  2UXX A;  3TW7 A;  4RGR A;  2KDZ A;  2NVT J;  2NVU B;  2NOG A;  4A69 C;  4DNC A;  1PDN C;  1OMI A;  2J5P A;  2ZME C;  5FB2 A;  2MSY A;  1Z6R A;  3RKX A; 
#chains in the Genus database with same CATH homology
 3PIP F;  1YJW I;  2E36 A;  1VQ9 I;  1YJN I;  1VQK I;  3CD6 I;  2ZJP F;  1ACI A;  5JVG F;  1VQL I;  3G4S I;  3CC2 I;  3J7Y J;  1YJ9 I;  2QA4 I;  3CCE I;  2JQ7 A;  2K3F A;  1FOY A;  3I55 I;  1YIJ I;  2E34 A;  1FOX A;  1VQN I;  2FOW A;  1Y39 A;  3DLL F;  3G71 I;  3CCJ I;  5GAE J;  4IOC F;  1MMS A;  1YI2 I;  5GAG J;  3CCQ I;  1HC8 A;  3J7Z I;  5GAH J;  2OTJ I;  3G6E I;  3CJT B;  1FOW A;  4V19 K;  3CCS I;  1VQP I;  3PIO F;  3CCV I;  3CC7 I;  1QA6 A;  4IOA F;  3CME I;  1S72 I;  2E35 A;  2NXN B;  5GAD J;  5DM7 F;  3CCR I;  3CC4 I;  1VQ5 I;  3I56 I;  1YIT I;  4IO9 F;  3CMA I;  2ZJR F;  3CF5 F;  2H8W A;  2OTL I;  1VQ8 I;  3CCL I;  1YHQ I;  2QEX I;  1VQ7 I;  5DM6 F;  3CCM I;  1VQM I;  1VQO I;  4UY8 I;  3CCU I;  1VQ6 I;  1VQ4 I;  2ZJQ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...