3CCQI

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 8
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3ccqI00
3G4SI 3I56I 1YIJI 3CC7I 2NXNB 3PIOF 5GADJ 2E34A 1VQ7I 3CCRI 4IOCF 4IOAF 3CCQI 3CCUI 3CCLI 1ACIA 1YJNI 4V19K 5DM7F 1FOYA 3J7ZI 1FOWA 3CD6I 1HC8A 2OTJI 1VQLI 2E35A 3G6EI 5GAGJ 3CCMI 4UY8I 1S72I 1VQNI 3G71I 2ZJPF 3CJTB 1VQ4I 5GAHJ 5GAEJ 3CCEI 2JQ7A 3DLLF 3CC2I 1VQOI 2OTLI 3I55I 1QA6A 1VQ6I 1Y39A 1MMSA 2K3FA 1VQMI 1YHQI 1VQ5I 2E36A 2ZJRF 3CMAI 3J7YJ 3CMEI 3CCJI 3CCSI 4IO9F 1VQPI 3CF5F 1YI2I 3CCVI 5JVGF 1YJ9I 1VQKI 1YJWI 3CC4I 1FOXA 1YITI 2QEXI 2H8WA 2ZJQF 2QA4I 1VQ9I 3PIPF 5DM6F 2FOWA 1VQ8I
chains in the Genus database with same CATH superfamily
1I1GA 5H2FC 3QODA 1YW7A 2NVUB 5ILSA 4EEFG 1NTCA 1IRGA 3FIWA 2XGXA 4EJOA 2F2EA 2EZKA 3HOXJ 1ZQ3P 2Y48A 4GYGA 2B9SA 3H3VK 1FEXA 1D0XA 1I50J 3HRTA 3AFHA 3F21A 1Y6IA 3BZKA 4Y33A 1YHQI 2STWA 3O8HA 1V5FA 2R4GA 1FOXA 1TZLA 1P6RA 4A0XA 4BYYA 2W25A 3BR6A 4KMUX 4ESBA 2R5ZA 2KJCA 4BS9A 1IN8A 2K27A 3LSKA 2L5QA 1ZLJA 4G8XA 1PP7U 2BY3A 2CO5A 3P5JA 4A0YA 5FFXA 3TBIA 2WB1N 3KETA 3M3YJ 1FP2A 1D1BA 1KU3A 1YS6A 1ZAOA 1VQ4I 4O6JA 3R61A 3OS0A 2Y2ZA 2K3FA 2A3SA 1SD4A 2VE9A 1YI2I 3OSGA 3HTSB 2CYYA 5GP9A 4ENJA 2O9LA 3J80Z 1DU6A 2ZJQF 1ZG1A 5E20A 3I56I 4HLYA 5F04A 3MD2A 3AAFA 2CW8A 1JUSA 4PZJA 2DA5A 5TISC 4XRMA 4NQWB 3OYJA 2VI6A 1UB9A 4UNOA 1DP3A 1JUPA 3L00A 3WE3A 2BY2A 2LF7A 2EB7A 1KGSA 4FE7A 1VQ5I 2CUJA 2Y75A 1HW2A 3IV5A 3CMAI 4F52A 3U2RA 1WJ5A 2FRHA 2Y69H 1MJAA 2Q8KA 2QLZA 3OMYA 4BACA 2BVMA 4AWXB 2TDXA 2X6XA 5AIQA 4B44A 4EJWA 2E34A 1IDYA 1BL0A 4XSZF 2XROA 1GUUA 3OL3A 5EGOA 4OIOF 3IP4B 2XGEA 3GCMA 1MDMB 3QPHA 2DYSH 2H94A 2VBXA 4XN3A 4D5CA 2GIZA 4EJUA 2E7XA 1MH3A 3DLLF 2JVHA 5JHFA 2KDZA 3T1BA 4XLNF 2DOFA 3NRVA 2R3SA 5BS6A 1HBXG 2E2IJ 5FRMA 2ACJA 3MZ8A 1NH3A 3ULQB 3KP5A 3V8LA 5K5OA 4NC6A 2ZSHB 2GA1A 3HOZJ 1R1UA 1D1AA 1ETXA 1Y1WJ 4BE2A 5HS8A 1VQOI 2M1BA 5HVQC 2Q2EA 1P4WA 3TOAA 2BYVE 1KU9A 1HKQA 3I0TA 4YFNF 3CCVI 1BN5A 2DTRA 1YE9A 3BQZA 2X48A 5ICEA 3JRFA 1W36D 4ZYDA 2WADA 4II2A 5LBQA 1SD6A 3FKJA 1ZYRF 4W1UA 3OYCA 2DODA 5DM7F 4BQAA 2A6HF 2OAZA 5KK1A 4GCVA 2XF6A 1J59A 3CMMA 1VF9A 3LSJA 2AXTC 9ANTA 4RA2A 4HDVA 5FLXZ 1B72A 1L3LA 4LFUA 3RQ4A 3HEFA 4KIGA 4FETA 3SDGA 4UUVA 4M6XA 1K83J 3DP7A 1ZG5A 1BW5A 2R7UA 2ZMEB 2IGKA 2Q1ZB 3WE2A 3W2VA 1M1EB 3G4SI 2LREA 1K6OA 4HNTA 1J7KA 2LKSA 1FNNA 3CESA 5CVIA 3AL0C 3CCUI 1JT0A 2F5EA 3GUDA 1FC3A 2WWYA 2W85A 2K86A 5LFAA 3KP2A 4PGHA 3BZ6A 5J1RA 4HSTA 3ZR8X 3V8JA 1YTYA 3BR1A 5M5YJ 1WJDA 2CQNA 1KQ0A 2L9NA 1DPUA 3TP3A 3RPUA 2R5ZB 1O3SA 2CJJA 2A07F 4PJMA 5IPAA 2IRFG 2K9QA 2A6EF 2WAFA 4DIQA 3OIQA 5J1YA 3IC7A 4JOMA 2RNGA 2DCEA 1FBSA 2VJIA 1OQYA 2LY1A 2EILH 1VZ0A 2D45A 5J40A 1BJAA 4HX4A 4IHXA 2IA2A 2PX9A 5J8CA 4IHVA 1PJRA 3MKZA 2F48A 5LD2C 4LG3A 2RKHA 2QCOA 2EPFA 3HDDA 3CJRB 2LY9A 1X58A 3E7LA 3HOSA 5CQGA 1XN7A 3RPQA 4B4CA 2BGCA 1NK3P 1W7PA 1IUYA 1YW8A 3C2BA 1WJFA 4QWQA 3ZMDA 5L3BA 5F0CA 2CG4A 5D5UB 1TQPA 2EV6A 5EG0B 1LPQA 1UJ8A 1HLVA 2EFNA 2L54A 4WF2A 2CWEA 4ESFA 3E97A 5ERIA 4FQGA 4A5MA 5EG0A 4XORA 2DBBA 1J09A 4G6DA 3FX3A 3K4BA 4MEYF 4DW6A 3ISPA 3I64A 2CFXA 2XIGA 5FO5A 1XS9A 3WG7H 3V42A 4BE0A 4MFDA 1I1SA 4AYBA 3FMQA 1XCBA 1HA8A 3DBLB 4AU7A 1HDDC 3REOA 4BQOA 4DJAA 5EGOB 1BBYA 1XX5A 1XDUA 5F0FA 3JAMZ 1SANA 3KFWX 4CA0A 1EH8A 1OCRH 4S04A 1MMNA 4CZZA 2LD5A 1P4XA 3CDLA 1USTA 4CCLA 1J75A 1FMWA 2A61A 3HZJA 4OOIA 1JUMA 2P4WA 2V79A 2QGUA 3D1NI 5GAEJ 4MFEA 3SDBA 2DOEA 4IXAA 4IPAA 3J7YJ 1U5TC 5HLTA 1IV6A 4TV7A 1U5TA 2GAUA 4WXCA 3IRQA 4AIDA 1LDJA 1QGPA 3I71A 3DXJF 3HRMA 3ZN0A 2FOWA 1PYVA 4BEHB 3ZMSA 1U5TB 2DTZA 2HNHA 1H89C 1FZPB 1I3QJ 4MQVA 5DTDA 1MH4A 4XKCA 2EV0A 4H4KC 2IGMA 1S7AA 3GF2A 2XGCA 5TGTA 5BQTA 1MIJA 2CH0A 2ZSIB 4A3KJ 2ELKA 1XSDA 3IRRA 4DZPA 4M73A 1U0JA 3L09A 2EFPA 3S14J 3WHBA 1QHGA 3S8PA 3KLOA 2HOEA 3BG9A 3MEXA 2GM4A 3JW4A 3BY6A 2VODA 2NVYJ 3COAC 1LEAA 2BV6A 1I6HJ 4EGYA 3HBLA 1XB4A 2IXSA 2VQGA 4I02A 3IKVA 3LSRA 4GXOA 3SJMA 1DU0A 1NHAA 2M4GA 2MSYA 3CUQA 1J9IA 2DA6A 4XM3A 3LSPA 4YFKF 2LOOA 1IAWA 1F9NA 1JTXA 2Z1DA 1Y56A 5IYBJ 5KCMA 1YO5C 5FLXK 4XRSA 3CUQB 4IQJA 2EV5A 5DYMA 2L9RA 3BDDA 2JVGA 1GVDA 4XQFA 1R58A 3M8JA 2FBKA 4BJ6C 1FX7A 3M1CA 3QRFF 3LNQA 4R8HA 1YJNI 3BR0A 3JCUC 5H6QA 1MBKA 2STTA 4G94A 4JX6A 1K79A 2CV1A 1X1CA 2L7MP 2HKOA 1NK2P 3TMOA 3KZIC 2JSCA 1IN5A 2VOPA 2JA5J 4DNCA 1KQ8A 2HDDA 4HLXA 2DA1A 2V6EA 3NEUA 1Z3XA 3JRCA 2H8WA 2Q2EB 1VQ9I 3X2QH 2GXBA 1J5YA 3ZQHA 3Q5FA 5AIPA 1TL8A 2FMLA 4K2EA 2BE5F 1X3WB 3I3LA 3K70C 5F27A 2KJBA 5D8LB 1IUFA 3CO7C 1HKSA 5BPDA 5BNGA 3K4CA 5M3FJ 1E3PA 1OCCH 5HLHA 3HTUA 4XLHA 1T0FC 1WVRA 1MDMA 2I8DA 1SAXA 1PDNC 2IS6A 4IHSA 2HOSA 1R23A 3JRDA 3W6KB 2WBMA 3BR3A 4LLLA 2HVRA 1IC8A 1UG0A 1O3TA 1EV7A 3S17J 5D5WB 2VKHA 2K9NA 4IHTA 3DLAA 2XRLA 3LAPA 3SEQA 1ZTRA 5ICGA 1B59A 4LMYA 1FOYA 4I76A 2ZJ2A 5EEHA 4E7KA 1PUEE 4RB3C 1LFPA 4FTHA 1TWHJ 1EA3A 1BOBA 4EM1A 1Z67A 4IZZA 2HXOA 2HGCA 5D6EA 2L7ZA 3JREA 1X2NA 2XPUA 1B9NA 4C9YA 4BDZA 2K9MA 5E17F 2VJ5A 1AU7A 2CGPA 3HOVJ 1H9TA 2BW3B 4LJZF 1TQMA 4OIRF 2CMPA 5E1WA 4A3CJ 5HLIA 3H3UA 3RZDJ 3FXRA 2FNAA 3PQKA 2Y0SN 2RVCA 2QWWA 2RC4A 2K40A 2IT0A 3S1NJ 4IEJA 1XDSA 2B0LA 2Y0SA 3HG9A 1ZREA 1G8XA 3MAJA 3DKWA 4C3IJ 1WGXA 3CLOA 3Q9VA 5IY5H 3Q3SA 1HW5A 4MTEA 1UELB 2VONA 3I58A 3LA2A 2QYOA 4BY1J 4A6EA 2DN0A 1VQPI 3RTRA 1LE8B 3SFZA 3GZ5A 2B63J 4Z2YA 2ZFUA 3CZ6A 4S0HB 2IGOA 2FX0A 2FUG2 4QLCU 2F4MB 4DBQA 1G3TA 1RC9A 2O61A 4B1RA 2XPVA 1ZGJA 1A04A 2LMDA 2GA2A 2RDPA 3GFLA 5KHDA 1MNEA 1X1BA 2LSOA 1RIOH 1S3JA 3F72A 2VXDA 2A5YB 3K0LA 2P7CB 1W1WE 3S1RJ 2X1DA 4JX5A 4KUMA 3TW7A 1WRJA 4LOCA 1ETWA 2LVSA 1ETKA 1WCMJ 4X1EA 4M9ZA 2BXZA 3H5RA 5E3OA 2JSPA 4HBLA 5LRSA 3DQVC 1RKTA 3V7CA 1T56A 1UCRA 2IW5A 3GEZA 4JYKA 4J01A 5J1UA 3EDPA 1WJBA 4JQFA 3EUKL 1GV2A 1A31A 2K5CA 3TGNA 1VFCA 3K1MA 1O57A 3BTJA 5EYRA 5BPIA 3E5UA 1IXSB 1JGSA 1P4AA 2GIVA 1SFOJ 2M7BA 3WGHA 4GFBA 4PDKA 2HQAA 1RRJA 3RKWA 1A5JA 1EH7A 5DCMB 5J47A 1C0WA 1QZZA 2P5KA 4QPQA 3JRBA 3ZQGA 1W5SA 3JTHA 3Q9SA 4E7SA 4DYCA 4AVPA 4NQWA 2P5LC 3NWTA 1ODDA 3OSFA 3O2PE 1VQ8I 2LC2A 1LVAA 1X4PA 3KYLA 1SFEA 2EZIA 2HFHA 3PUBA 3FKIJ 1Z7UA 2MC4A 3VB2A 1D3YA 1HF0A 4A6DA 2HOAA 5GAGJ 2JRMA 3DEEA 4BXUA 1KYZA 5LEKA 4CGZA 1RNLA 4JBAA 5BMZA 2AXLA 5KAIC 1WI9A 1OISA 3I54A 4IRIA 1SFXA 2VQHA 3VEPA 4BU2A 4Z6YA 3K4NA 3G1MA 3K7AJ 5DUKA 4IKFA 1J0RA 1BW6A 2CUEA 4L9TA 2KZGA 4OIQF 3WTSC 2V26A 3IH2A 5E3NA 3K4JA 1QVUA 3J7ZI 1G4DA 1R4NB 3OYIA 1LNWA 4U0WA 5FRNA 2DK5A 4AIJA 1B1BA 4KN4X 2D5VA 2LKXA 1WKMA 5EEAA 5FKLA 3H35A 2KHMA 3S93A 2VE8A 4F55A 5H6RA 3ZQ7A 2X0LA 4X6AJ 5FFZA 3MFKA 2KL4A 1FTTA 5E8IA 3G6EI 4M9SA 2JA8J 3GVAA 2D1HA 1AOYA 2HKXA 2KIFA 2X1CA 3CDIA 5JLWA 4EATA 1O4XA 1JXSA 4XK4A 2EINH 1XSXA 5IT3A 1DPRA 2M9HA 2FD5A 1E17A 3LOCA 2ME0A 4G12A 3C1DA 2JA2A 2VASA 3H0GJ 4MNUA 3CO6C 1T8IA 5DM6F 3V7SA 1QZEA 1P92A 2E1MC 4HV6A 2VUMJ 1OR7A 2VOOA 3H1CA 2YS9A 3EUHA 5DD4A 5L3CA 3EUHC 1GT0C 2EZHA 1B72B 2PI0A 3BZCA 2R7DA 2OQGA 3AG1H 1KA8A 5HOOA 2R92J 2FSWA 2DA4A 4A93J 4LG0B 3ZQCA 2UWMA 1HSJA 4N0BA 4OAZA 5F64A 3J81K 4C3HJ 4HF2A 1XG1A 4ZDLA 4G6QA 4XR6A 3PNVA 1AKHB 3G73A 2JZYA 2NXNB 1U78A 2KT0A 2VC1A 4DQ2A 4A3FJ 2DPDA 2H1KA 3SHFA 4ASNA 4S05A 3DV8A 5D8KB 2X9DA 2RQPA 4M3EA 4UXNA 4HF0A 4Y7NJ 4C2MJ 2ZXHA 1R1TA 2JUCA 3EUAA 3HL2A 3F6VA 2M8GX 1TWCJ 3ZQIA 1I39A 3CF5F 3BG7A 2NOGA 4HA8A 1YITI 3M7GA 1FIAA 1SVOA 1XGSA 2QSFX 4YRVA 1NG7A 5FJ8J 2XAQA 2WV0A 2JPCA 2OZ6A 2QSHX 4XNFA 4Y13A 4A0ZA 4L18B 3FBNB 4RB1A 3DPTA 3CCLI 2OA4A 2F5DA 3PUFA 4LB5A 4OU0A 3E6CC 1WSUA 1BI2A 3M9AA 3ZP5A 2E2JJ 2TCTA 2ZXWH 4I2OA 1WHUA 1W7PB 2V1NA 4CSWA 4PGGA 2E36A 2CV0A 3OYNA 1YFHA 1KYWA 3PO3J 3DTIA 1FTZA 3HB9A 5K7ZA 3BOQA 2K3PA 4XICA 5C44J 2ZB9A 2R7TA 3ZCOA 2ZMEA 1BR1A 2QM3A 3FBIB 4RB0A 1FSHA 5B3SH 4P9UA 3ERMA 2QVOA 4BJTA 1T2KA 2CV2A 3SQNA 2WA0A 2M45A 3IWZA 3QU3A 2A68F 1JHHA 4CUGA 2COMA 2XB5A 3HRUA 4AYBN 2PJRB 5HNHA 2H27A 2MC3A 4U0VA 3DFGA 5GTHC 1QA6A 1I3AA 3HUGA 2LBFA 3DEWA 5F6FA 1A36A 4E7ZA 5J4YA 2RNJA 2NOJB 1BI1A 1FP1D 1QPMA 2G7HA 3HUGB 3LSTA 4HQMA 1QZYA 3WGIA 5A2QK 3K70D 3N4MA 3A2KA 2H6BA 4RGUA 3UR3C 3NARA 5CKTA 5F1RA 3GLXA 2DA2A 1Z6TA 5ICCA 3E1SA 2JRTA 3FXLA 4IX7A 1FMVA 1SD5A 2L01A 4L0ZB 2ZCWA 2H1LA 1HW1A 5HLGA 2E5NA 2ZJRF 2MBFA 1MBEA 2CQKA 4BEHA 2CS3A 2PMZN 3D5RC 5HS7A 2O5RA 1EF4A 1HKTA 3IAM2 3KP3A 3GBGA 2OF7A 3CC7I 3EPZA 2AHQA 4MIMA 2LKPA 2Z33A 4FHTA 4Y4RA 4I0AA 1OCPA 4CCMA 2EWNA 2W82A 5GPAA 5ILVA 2X51A 5DEQA 3U1KA 4HF1A 1MBJA 4M74A 3G2BA 3GX4X 5CVUA 2WB1A 3TO7A 2ZNYA 4MQ9F 2VL8A 2HR3A 5E1XA 1VQ7I 3P9IA 3CCQI 1Y8QB 3LMMA 4YG2F 3PSIA 5IT9Z 4IJAA 1GLNA 1ON1A 4B09A 1JKRC 3WTVC 4IHWA 4Q5SF 3C7JA 2GBYA 4AIHA 3BJ6A 3BJAA 2OC6A 3L2RA 1H9GA 4F3QA 1G3SA 3C2GA 3TP0A 2I5UA 4RGSA 3BP8A 3HM5A 3FXMA 1WI3A 4KITB 4FX0A 3BR2A 2P5VA 3N05A 4RAZA 2HQRA 4L5EA 4UVAA 3GTJJ 2QEXI 1W36C 1AKHA 3KZYA 1S6LA 2K02A 4BQQA 1S8NA 1S5LC 1YLFA 3SEZA 4V2FA 5L3FA 2OZUA 3F8CA 3MQ0A 2KPMA 1TNTA 4ZZDA 1BI3A 2YX7A 1SVLA 3AG2H 3WTUC 1WH5A 2XUBA 4R79A 2V6CA 5D5VB 1HSTA 1O3RA 2BY1A 2JK3A 4RM2A 3OIPA 2M2EA 2DMPA 4XLAA 1FT9A 4GDFA 3H5NA 1VQMI 3NAUA 3CMEI 2NNNA 5E3MA 1VQKI 4D1QA 3FHNA 1QHHD 2VT3A 2CSOA 5J8FA 3LAJA 2DPUA 4BBRJ 5EZHA 2MD0A 4BNCA 5H20A 3BLYA 3IHUA 3OR2C 4XLEA 2CU7A 2BEOA 2R7FA 2L7FP 5A2QZ 2NAZA 1GDTA 3BPXA 3U1DA 1XD7A 3L2QA 4PFPA 2OCEA 2B7EA 4NB5A 3DTKA 5CVVA 4D9JA 2HYJA 2F5FA 1IDZA 4YIIA 2VQCA 1K6YA 2W4SA 2VPRA 4UHTA 4XKWA 5CYVA 2Z16A 1T98A 2EFQA 1Q1VA 1LEBA 3RPUD 4HEA2 2FE3A 4KT6A 4V2GA 2GZWA 5TJJA 1BR4A 2QZ8A 3VYTB 4ENNA 2KRCA 3L7WA 4B3XA 4M3BA 4P5OA 3F6OA 3RJPA 4FT8A 3B02A 3L2UA 2NYXA 3KLNA 3OS1A 4ESJA 5E79C 3OYFA 3VSKA 5B1BH 3K4KA 3IH3A 3K1PA 3W6JB 3VWBA 2YUSA 2UZKA 3TO9A 5IP7J 2EZLA 4P9FA 5ICFA 4A2UA 1R4MB 2CQXA 5C4XJ 4ZTJA 2R5YB 3FZVA 1U9NA 5FLVA 4KISA 1G2HA 2Z9OA 4CO8A 1S9HA 1X2MA 3IKTA 3ZQLA 1QU3A 2HWVA 3SXYA 1ERDA 1ONVA 2AS5F 4A3GJ 2K4BA 1WJAA 1BIBA 3GTQJ 5EEGA 2X1EA 4I0BA 2OV7A 5LHIA 2EH3A 1APLC 2ZXJA 1UAAA 1LQ1A 2M3AA 3KP6A 2E1OA 4CH7A 2I10A 2JA6J 1ETVA 2Y31A 1BJZA 3NQOA 4E6KG 4E7HA 1FOWA 1NG6A 3RKXA 2NNYA 2CUFA 4BL0B 2P0WA 5LLQA 1K78A 5IP6A 3BG5A 1IZ1A 3T5XA 1X3UA 2LF8A 4ANJA 1CQTA 1MMSA 2E19A 3P9CA 2QBYA 1MW7A 1OKRA 2LLKA 2X6YA 1IO2A 5F1JA 4PJNA 4ZDPA 3DU5A 4BXXJ 1MJBA 2DOAA 3WGGA 1EJ9A 4BBSJ 3K10A 4LITA 3DPLC 2YR2A 5FB2A 2DO7A 3QU6A 4EM2A 4GO1A 3EYYA 1GHCA 2V9VA 2FBIA 1IG7A 1OYWA 2DDAA 2QENA 1TBXA 3KIOA 3VYUB 2C6YA 1FIPA 3KZZA 2A69F 4CHUA 3RKYA 4BGDA 3OS2A 1D8JA 3AL0B 1XCVA 3H9GA 3QP5A 2DMQA 4AIKA 1YRNA 3ML6A 3GW2A 2F4IA 3BTLA 4L9VA 2K4JA 3TDUC 3TDZC 5LGNA 2BVLA 2DK8A 4G7OF 5D5XB 1V55H 5K5QA 3WU2C 3VPRA 1I6XA 2K9SA 3ABMH 1ZG3A 2O8XA 5JVTA 1ZGWA 2FOKA 1L0OC 1OCTC 3FF5A 4M3GA 3OYLA 5FROA 3SZTA 1FBQA 1KZHA 5E1ZB 3M8FA 4IL6C 2W48A 3U9GA 1WJCA 1JE8A 5FD5A 4U7BA 4C2UA 3QYBA 4QTRA 4A3IJ 3A03A 1LDDA 5K7FA 1JGGA 2MH2A 1O7FA 2HDWA 4M3DA 2EBIA 1ETYA 3FMRA 3GMEA 4B3AA 3ASOH 4KN7X 3R0JA 4EVIA 5LEJA 3OOUA 1U6GA 3CCSI 3HPHA 3K4LA 1YJ9I 5B5EC 4G7ZF 5F0HA 2WV1A 2Z3YA 3FXKA 2W7NA 2XKOA 3C3WA 4U0YA 2R7SA 4BDYA 2DJNA 3PIOF 4XOTA 4Y17A 3S2WA 2V7FA 2EIMH 4E4HA 3HIFA 3CJNA 2WAQA 4IVNA 2DFFA 3BWGA 2Y9YA 4D7MA 5CQEA 3ZRGA 4CYCA 2UXXA 2HYGD 1OLTA 4UB8C 1SAUA 2EA2A 3J81Z 3A4CA 1A6IA 1Y1VJ 3VYSB 4A69C 3WTTC 1RETA 2VB6A 4CYDA 2DXIA 3HKZN 4ZDOA 2LFBA 2HZTA 2PJPA 1OMIA 2FJ1A 2H6CA 2IS1A 4BXFA 2K9LA 2CQ7A 2VKEA 2GXGA 1YIJI 3S16J 1TLHB 4HW0A 5FD6A 3R0AA 3VODA 2E1CA 2IS2A 2LTPA 2OU2A 2R7RA 1T39A 4CXFA 1AA7A 3CD6I 3LSGA 3PFYA 4PSWA 4OMZA 5HDKA 3GTPJ 2LK2A 2MLKA 3AG3H 4BKXA 1RR7A 1Z7LA 3OYKA 2HTJA 3UKGA 5LHGA 3HSFA 4B8XA 3IAS2 3BT9A 4Q47A 1RPWA 3CC4I 2OD5A 1RI7A 2E71A 3JR9A 3MKWB 3KYDB 3ZQFA 1FPQA 3KPHA 4HPQA 1T95A 3RDIA 5LRRA 1POGA 3MKLA 1P7JA 4AVZA 1N75A 1IF1A 4L9NA 1MKMA 4Q4ZF 3E0JB 3RYRA 3A0BC 2EA4A 5C4JJ 3W2WA 1LUJB 4ZYAA 3G71I 4EQQA 2RGVA 1H8AC 1QPIA 1Q1HA 2O0YA 3GFJA 1UHMA 2W00A 4MEXF 1Y8RB 3GZ6A 4G9YA 4II3A 1UG2A 4IHYA 2L0KA 3JRAA 2FU4A 3HC7A 1R9TJ 3BC8A 1B4AA 1O3QA 2H09A 3OL4A 3CJQB 4CDGA 3BG3A 4CCKA 4XRSG 2ISYA 2RAEA 1ZKGA 2VBYA 4B47A 4L5JA 5JHUA 1P7IA 3GTMJ 2Y30A 1P2FA 3HSEA 2PBIA 2WAEA 4UV9A 3TW6A 1S7EA 2V9PA 5DV5A 1LKXA 2ZBKA 4ZJZA 2LDUA 3HYIA 4PK4A 5L3GA 1PUFA 3GWZA 3A02A 4ZYEA 4L5IA 4HOBA 2BHYA 1OCZH 4OINF 3V7RA 2EJRA 4EJTA 1PP8F 2YX4A 1U8RA 1PVEA 1BM9A 2V1UA 2RREA 1Z21A 3M8EA 3IH4A 2Y9ZA 4A3EJ 1TWGJ 3IUOA 5J3LA 3G1LA 5DS9A 4AUXA 2E2HJ 3FHZA 4DGWB 3BTIA 1YX5A 2BW3A 2ESHA 2KP6A 2P8TA 1EKEA 3CDHA 3GXOA 3F3XA 4M3FA 3DBHB 4E7JA 2DFIA 3ZQQA 4G7HF 4GYIA 4A3DJ 2L9VA 1OYIA 1HDPA 3TOBA 1S29A 5JLXA 2Q0OA 1SFKA 2VPLA 4B43A 3DF8A 4D7NA 1Z05A 1QQIA 1B9MA 2HYFA 2JN6A 2P6TA 1XMAA 3MVPA 1BIAA 2Z5UA 3D0SA 1Y0NA 3FXUA 3QWLA 3E3VA 1R5HA 2W1OA 4IOAF 3CP2A 3FWEA 1YYVA 4PJJA 2ESNA 4IF4A 4E70A 2OTJI 3DWLE 2MG4A 1IV8A 4HNVA 2A6TA 2ELHA 3CQZJ 5L3DA 2XGDA 3DBRB 1MJ9A 3I55I 3OWTA 3BCAA 1T08B 4RB2C 5L3EA 3OYDA 2JUGA 4O5VA 4M6VA 2O7OA 3JTGA 3T8RA 4R1HA 1D1CA 4I01A 4RS8A 4WWCA 3VYRB 2WY7Q 1N77A 2L7KA 3GTKJ 1GXPA 1D5YA 2KRHA 5TRDA 4JP0A 1V4RA 1UHSA 4LGWA 2M7AA 1FLIA 2VN2A 4RBOA 1UFMA 1FOKA 1VQLI 1OPCA 1QVTA 1D0YA 3KYCB 4RAFA 5EJCA 3J7AY 3KEQA 1ZR2A 1FJLA 1F4KA 4N4OB 1RUNA 4D0PA 1SD7A 3PSFA 4XONA 4XBFA 2KIUA 4F91B 3BJOA 3KEYA 4DBRA 3Q0WA 4YELA 5IP9J 2FQ3A 2IP2A 4BHBA 1SVMA 1TW3A 2JTVA 2AO9A 3S3OA 1TP4A 2VT2A 4BHCA 2GWRA 2D1VA 3E6DA 1MBFA 3VDXA 1QO0D 5CLSA 2ZO4A 3RIRA 3UNGC 2OJED 1K78B 1E2XA 4ZZLA 1YIOA 2O8KA 2L4AA 4RGRA 3ZN1A 1RKWA 5HDGA 1W5CC 4BJ5C 3PQJA 5M5WJ 1ZLKA 3ESWB 5M5XJ 2HS5A 2WC2A 2Y0MA 4Y15A 2DI3A 1W5TA 4RLQA 4ZYGA 1WJEA 2X4HA 1MGTA 2EK5A 2L02A 5F08A 3D5LA 4I98B 4AD9A 3HSRA 2E7WA 3V4GA 5FLMJ 3K1NA 4BQNA 1IRZA 1LFUP 2G9WA 2XB0X 3FISA 4NBQA 2XAJA 3CCEI 2EFOA 2AQFA 2BOLA 3FMSA 1MSEC 2E1NA 4NDLA 1H88C 4XRFA 2KRFA 1FBUA 2E60A 2IAIA 2KDOA 4CZCA 3DTEA 3VSLA 1R22A 1YG2A 3OV8A 2IA0A 2VKDA 4EM0B 2HVQA 5K1YA 3F23A 2DDBA 1YOVB 3ZMUA 4YEJA 1MNMC 1USSA 1G59A 4HX7A 3QOEA 3ZPLA 2A05A 5C3EJ 1R00A 3DU6A 3QQAA 2HEOA 2VC0A 2DAOA 3FXJA 2JJ7A 2M5WA 3W2AA 4F7ZA 3K2AA 4N9IA 5J6XA 4XOPA 1MZBA 2W57A 2LRDA 4FASD 1Y0UA 4KJZA 3E5XA 3DKXA 1KONA 3Q0UA 3JSOA 2EFWA 3I59B 4U7DA 5FKMA 2XAHA 1RESA 4EV0A 4JK1X 1BOAA 1TNSA 2XSJC 4NC7A 4E7IA 4M72A 4HNUA 4IRHA 2FF4A 3S15J 1F43A 2XAFA 3GZNB 2GOXB 2IVMA 2KKOA 3ABUA 3C18A 2ISZA 3PNYA 2R7XA 1LB2A 4PUSA 2BHZA 2KIMA 3F8FA 3A0HC 1IRFA 3E6MA 4CYCB 1EH6A 3SFIA 3K6GA 2XKPA 3H9QA 1XSVA 1YW9A 4YIFA 2E5ZA 4HZFA 1ZRFA 1MNDA 2ZNZA 5IT9K 1X4OA 3NWSA 4L0YB 5K5RA 5JFRA 1OCOH 1E0EA 3HJEA 3DPUA 1VTNC 3LSMA 3T0YA 2HPMA 3Q0VA 1YQAA 2PQ8A 2CQQA 5IOYA 5D4RA 1YX3A 2HQNA 2M4KA 2VBZA 1CGPA 2PLYA 3KEOA 3FM3A 2MYSA 1XMKA 5LGUA 2IBDA 2XVCA 1QBJA 3OIOA 2CW7A 1JKPC 4M71A 3OR1C 5J4VA 3GYHX 3W6VA 3OYMA 4A3LJ 5IOZA 1G6NA 1ZH5A 2R7OA 3RZOJ 3QPTA 2F5VA 3LA7A 3S1QJ 1F5TA 4CCNA 1R49A 3E5QA 3LFUA 2GOMA 4CCJA 3E6BA 1KQ9A 1J2XA 4A12A 1X19A 3WTZA 2VBWA 5D4SA 3CCMI 1A35A 2V1XA 4HDUA 4ENMA 2LNBA 1RUOA 2NVTJ 1VQ6I 3FM5A 2UV1A 4XN0A 2ZXIA 1JKQC 2BBYA 2R7VA 5DDGA 4OIPF 5FGMA 5E18F 2DMNA 4WK8F 3BQYA 3QP6A 4KA4A 3PIPF 1F36A 1B8IB 2ICWG 2DA3A 3PO2J 3ZMTA 1UMQA 4MO7A 1OR7C 2FXAA 2E1MB 2QBYB 1B8IA 1ZARA 1IRXA 3ABLH 1RZ4A 1ETQA 3JRGA 4BH9A 3RKQA 1DDNA 3K9TA 3TKYA 4ZYHA 2VJ4A 3OY9A 4HV5A 2XF5A 4IO9F 5HODA 2XAGA 1DP7P 3I4MJ 4YFXF 3QPSA 3ABTA 2JPBA 3OYGA 2IS4A 3CF2A 5JR3A 1W7PD 4XKBA 2KIQA 3ZGKA 2LYCA 3L2CA 5EDNA 3CTAA 4OMYA 1MSFC 3FK7A 4MGRA 2ETHA 4ENKA 1TQIA 3V8KA 2DYRH 3B6AA 2XHKA 3CCYA 2EQRA 3BG6A 3K69A 2J5OA 4RLFA 4KMFA 1MMDA 2MD5A 2QQAA 4XLCA 3EQLF 3HOTA 2WTEA 2R7ZJ 3FK6A 5EF6A 4B48A 5IYCJ 2RQQA 1FYLA 1V5GA 2DLLA 2ECBA 3LSHA 3I9V2 1VNDA 1BC8C 3FXOA 2MABA 2UUZA 4N9HA 1LE8A 3HOWJ 1DQUA 1R71A 4LK1F 2LG4A 4A5NA 2XC7A 2O3FA 5CJ9A 1X3ZB 3S2HJ 2M0CA 2V4JC 1FWZA 4P1WA 4WX9A 1XC5A 3R60A 1Z91A 3TL4X 2ZC2A 4A3JJ 3H9JA 1HQCA 1ZR4A 2MA3A 3M07A 1JTYA 5LGTA 4BHPA 5HS9A 4ABZA 3HOUJ 3WODF 4I99C 4U87A 6PAXA 1AHDP 2TRTA 4KIBA 1WH7A 4GRIA 5BOXA 2VQLA 4UV8A 1ON2A 2FBHA 4I6ZA 4U88A 4HG2A 3QPLA 2DA7A 2ZMEC 1Z3YA 4KYWA 3OYHA 1D5VA 2F5CA 2QQ9A 1JI8A 2NS8A 2HU9A 4I7HA 4Y52J 2MFZA 2R7QA 3WTYC 2EIKH 3W3CA 2VJJA 2H8RA 1LJ9A 1ZGAA 3LWFA 4RDUA 3A01B 4DZJA 3LQRA 4P55A 5GAHJ 3H5AA 3M1EA 2R93J 3I4NJ 2X85A 3MCZA 5DD8A 1QNTA 1X1PA 4RGXA 3MN2A 3N97A 5DCMA 3F22A 1N78A 3KX2A 4XL9A 2NVXJ 2M8EA 3H36A 3H0DA 2IJLA 4AC0A 4PFOA 3HHHA 3AKZA 4KICA 5ILUA 2OCCH 3MKYB 3K4MA 1TWAJ 1GV5A 2Z99A 3CUQC 4C30A 4PJLA 2XV4S 1MMAA 4C2TA 4MHGA 3KCCA 2YPRA 1TWFJ 4BUPA 3CCJI 3O3KA 1R1VA 2UXNA 2ZKZA 3SYTA 1OJLA 1R7JA 3WTXC 1AWCA 3CMYA 5M3MJ 4OAYA 3ECOA 2DU9A 5CPRB 5FKNA 2KMUA 4XLFA 2HI3A 1U9OA 3MMYB 1TW2A 2X6WA 1HC8A 1XTAA 3T8TA 3JSPA 3OYEA 2HQ5A 2QQ8A 3IWFA 4ITVA 4XMYA 2QQBA 4HRIA 4BE1A 3GTGJ 1E3HA 3BCBA 1B6AA 2OTLI 1KU2A 1V3FA 1K4SA 1IGNA 2O03A 3GLLA 1W0UA 1R6RA 4DYQA 1YJWI 3DKYA 3TQNA 5KVRA 4UVCA 4P96A 4D5FA 2A5WA 2XASA 3RYPA 2XSDC 2QKLB 1T33A 2IA1A 4NUBA 3U21A 3JAMK 2M30A 4HYEA 3CCRI 2GLOA 2VKVA 4WXDA 1IN6A 2V1DA 1XGMA 3BROA 3CUOA 3MZYA 3QYEA 1OYYA 2PG4A 3C2HA 2DMTA 1WPKA 2PJRA 1I27A 1T0FA 4RAGA 4ZTFA 3F8BA 2HZDA 3CJTB 3CC2I 4Y3OA 2IEKA 2F4OB 3I4PA 4DOZA 4C3JJ 3A1YA 4HX8A 4UUSB 2DT5A 2PEXA 4AM3A 1ZELA 2F6CA 4RM3A 1MD0A 3I53A 2HXIA 4PCQA 4LIVA 3O8GA 4RAYA 3S32A 1ORKA 2W84A 3WTWC 2FEZA 2G7UA 2LY2A 3FXQA 2CRGA 4I09A 4ZC3A 2QSGX 2KISA 3PM1A 1CF7A 3P9KA 4ZH4F 2KLOA 2R5YA 3HKZA 3H3ZA 3GO5A 3DEUA 3BTCA 5JI6A 1IW7F 1LVKA 4LLGF 1A6QA 3J80K 3JRHA 1WZ2A 2FNPA 4QPOA 3WU1B 1LDKB 2CFOA 1CF7B 2LP0A 2GQQA 2MGQA 2X6OA 2K7LA 2WAQN 2DQLA 2DFHA 3MWMA 2QF7A 5AONA 1ZK8A 1IN7A 2P7VB 5E8GA 1K61A 2JT1A 1G3WA 1SMTA 1UHWA 3H92A 4PJ0C 1E3OC 1F1ZA 2DJIA 4L9JA 3VFZA 1JT6A 2J5PA 1ETOA 3OOPA 3G3ZA 2KFDA 3FDYA 4XLPF 2M34A 1HXDA 1TTYA 1U3EM 2IPQX 3I5UA 3J7AO 4WCGA 1MMGA 4RMNA 3HHGA 1LFBA 3AG4H 1IJWC 5E3LA 2P81A 3WU0A 1U2WA 3HGYA 2ECCA 2YSRA 1FY7A 3HGGA 5B66C 2N8GA 5GADJ 4BY7J 4IOCF 2ELJA 1XGNA 3PL8A 3F8NA 4LIUA 1SEUA 1WWXA 4UVBA 4XIDA 5CVRA 4QSHA 3JRIA 1D0ZA 4E7LA 1K7AA 3A01A 2L2OA 1K4TA 3OYBA 2COBA 1R36A 1IN4A 5DUIA 2ID6A 1P9QC 4HQEA 2OPTA 4ON0A 1Y39A 3ROUA 2OUMA 1ZN2A 4KIFA 4HSRA 2HVSA 2O6GE 2G0EA 4X0GA 1Z0XA 3ERED 1DGRM 1TT0A 3KE2A 3ONQA 3RQIA 2XF7A 2PMUA 3QAHA 4IRGA 3SZPA 5FKKA 1N25A 5DCFA 3QYFA 2HPIA 3L1PA 4UY8I 3ABKH 4FE4A 1S72I 3R4KA 4J00A 3S2DJ 2KZVA 3RI4A 2MLGA 1HOMA 2AQEA 1I5ZA 4M6YA 2ADUA 2VIXA 3PFIA 4QIWN 1WFXA 3KP7A 2GXAA 2NVQJ 2LBFB 2DW4A 2VLAA 1KU7A 1UZCA 5HDNA 5ED4A 1O7LA 1Z6RA 4BAYA 3S3MA 1GVJA 3HXLA 1G3YA 1HCRA 1V5EA 5HNFA 1MBGA 3LA3A 4UB6C 4LLNA 4A3BJ 1WQ2A 5FKOA 5K7HA 1TC3C 3B73A 4GGGA 3CP8A 3LFKA 4CICA 1H0MA 3S1MJ 1DGWY 1T6SA 2PMHA 3ZMVA 4M9XA 4F92B 2QKMB 2V9KA 2DQRA 2W24A 3S3NA 3HPGA 3HRSA 2BY0A 2R7WA 2CW0F 3LQQA 2JWTA 5LHHA 1Z9CA 1W4MA 1SFUA 3KP4A 1ZRDA 3HOYJ 4A3MJ 3F0CA 2ME6A 4YIRX 1ACIA 1IXRC 4OWRB 3TEDA 3L2VA 1SMYF 2M0MA 2R0QC 4IQ4A 4MLOA 3IL2A 1S7OA 2RV8A 2MW8A 3LL7A 2BXYA 3EYIA 3K2ZA 1FYMA 3O6BB 3BPVA 4LD5A 1JJ8C 4CCOA 4UUSA 2RN7A 3ZXSA 2BZTA 1FYKA 5JVGF 4JX4A 5KAFC 4MTDA 3MZHA 1BA5A 4J19A 2MH9A 2L4MA 1OFCX 1DUXC 4XSXF 1ZRCA 4KNYA 2XRNA 2QUFA 2CUZA 2EIJH 4NNJA 4UUTA 2IGNA 3TO6A 5CVJA 2VXZA 1IXCA 5GTIC 1Z1DA 2ID3A 3L2WA 1YS7A 2E35A 3BR5A 3GFMA 2FMYA 1D8KA 1FSEA 2HTSA 5D6FA 4LG0A 3RSNA 1VQNI 1Z77A 1XPXA 4V19K 2JQ7A 1XGOA 3GTOJ 2DMUA 2ZFWA 3GFIA 1REPC 3DCFA 1JHFA 1V54H 4HAMA 3QOPA 3ELKA 3ZOBA 4NC8A 4XKVA 2JA7J 1TT5B 4LB6B 1BI0A 2YU3A 2OBPA 4KT5C 3EETA 4H0EA 3G1OA 1MBHA 1QRYA 2L3DA 4F93B 3F9KA 2OQRA 3OYAA 4KDPA 1JKOC 2PN6A 3F8MA 3D5SC 3R6SA 2ZJPF 1X1DA 2KQRA 1BC7C 4FISA 2Z2SB 2XDVA 3WG9A 4EMSA 3M4OJ 4O3MA 3P7NA 4KFCA 3GTLJ 4Q48A 3SZGA 4ETSA 1W0TA 2PFBA 1VI0A 1GXQA 2FA5A 2NRAC 1RR8C 2LR8A 3RCOA 4G6TB 1PUFB 2PMZA 2HOTA 2XAUA 2L9SA 3I59A 2P6SA 1X1AA 1ITYA 4DYRA 4EGZA 1U8BA 4NHJA 4LK0F 4W97A 4FCYA 3PNTA 4N4NB 3ASNH 1ZHFA 1SC7A 1R5GA 2M87A 3ZMZA 1BR2A 4FX4A 1YRNB 5IYDJ 3CLQA 1XMXA 3LSIA 3WHCA 5KNLA 1ULYA 2LH9A 2NS0A 2FQ4A 5B1AH 4EJVA 2YU9J 3B6CA 1R5ID 1T38A 1STZA 4PSXA 2DT6A 3PJRA 2HDCA 5GPCA 4WXHA 2K85A 1ENHA 2DFEA 3L9FA 2D2WA 2WY8Q 2DT7B 5EZGA 2JMWA 3VOEA 2QA4I 2NS7A 2XPWA 1JJ6C 3ECHA
chains in the Genus database with same CATH topology
3G4SI 3I56I 1YIJI 3CC7I 2NXNB 3PIOF 5GADJ 2E34A 1VQ7I 3CCRI 4IOCF 4IOAF 3CCQI 3CCUI 3CCLI 1ACIA 1YJNI 4V19K 5DM7F 1FOYA 3J7ZI 1FOWA 3CD6I 1HC8A 2OTJI 1VQLI 2E35A 3G6EI 5GAGJ 3CCMI 4UY8I 1S72I 1VQNI 3G71I 2ZJPF 3CJTB 1VQ4I 5GAHJ 5GAEJ 3CCEI 2JQ7A 3DLLF 3CC2I 1VQOI 2OTLI 3I55I 1QA6A 1VQ6I 1Y39A 1MMSA 2K3FA 1VQMI 1YHQI 1VQ5I 2E36A 2ZJRF 3CMAI 3J7YJ 3CMEI 3CCJI 3CCSI 4IO9F 1VQPI 3CF5F 1YI2I 3CCVI 5JVGF 1YJ9I 1VQKI 1YJWI 3CC4I 1FOXA 1YITI 2QEXI 2H8WA 2ZJQF 2QA4I 1VQ9I 3PIPF 5DM6F 2FOWA 1VQ8I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S I;  3I56 I;  1YIJ I;  3CC7 I;  2NXN B;  3PIO F;  5GAD J;  2E34 A;  1VQ7 I;  3CCR I;  4IOC F;  4IOA F;  3CCQ I;  3CCU I;  3CCL I;  1ACI A;  1YJN I;  4V19 K;  5DM7 F;  1FOY A;  3J7Z I;  1FOW A;  3CD6 I;  1HC8 A;  2OTJ I;  1VQL I;  2E35 A;  3G6E I;  5GAG J;  3CCM I;  4UY8 I;  1S72 I;  1VQN I;  3G71 I;  2ZJP F;  3CJT B;  1VQ4 I;  5GAH J;  5GAE J;  3CCE I;  2JQ7 A;  3DLL F;  3CC2 I;  1VQO I;  2OTL I;  3I55 I;  1QA6 A;  1VQ6 I;  1Y39 A;  1MMS A;  2K3F A;  1VQM I;  1YHQ I;  1VQ5 I;  2E36 A;  2ZJR F;  3CMA I;  3J7Y J;  3CME I;  3CCJ I;  3CCS I;  4IO9 F;  1VQP I;  3CF5 F;  1YI2 I;  3CCV I;  5JVG F;  1YJ9 I;  1VQK I;  1YJW I;  3CC4 I;  1FOX A;  1YIT I;  2QEX I;  2H8W A;  2ZJQ F;  2QA4 I;  1VQ9 I;  3PIP F;  5DM6 F;  2FOW A;  1VQ8 I; 
#chains in the Genus database with same CATH topology
 1I1G A;  5H2F C;  3QOD A;  1YW7 A;  2NVU B;  5ILS A;  4EEF G;  1NTC A;  1IRG A;  3FIW A;  2XGX A;  4EJO A;  2F2E A;  2EZK A;  3HOX J;  1ZQ3 P;  2Y48 A;  4GYG A;  2B9S A;  3H3V K;  1FEX A;  1D0X A;  1I50 J;  3HRT A;  3AFH A;  3F21 A;  1Y6I A;  3BZK A;  4Y33 A;  1YHQ I;  2STW A;  3O8H A;  1V5F A;  2R4G A;  1FOX A;  1TZL A;  1P6R A;  4A0X A;  4BYY A;  2W25 A;  3BR6 A;  4KMU X;  4ESB A;  2R5Z A;  2KJC A;  4BS9 A;  1IN8 A;  2K27 A;  3LSK A;  2L5Q A;  1ZLJ A;  4G8X A;  1PP7 U;  2BY3 A;  2CO5 A;  3P5J A;  4A0Y A;  5FFX A;  3TBI A;  2WB1 N;  3KET A;  3M3Y J;  1FP2 A;  1D1B A;  1KU3 A;  1YS6 A;  1ZAO A;  1VQ4 I;  4O6J A;  3R61 A;  3OS0 A;  2Y2Z A;  2K3F A;  2A3S A;  1SD4 A;  2VE9 A;  1YI2 I;  3OSG A;  3HTS B;  2CYY A;  5GP9 A;  4ENJ A;  2O9L A;  3J80 Z;  1DU6 A;  2ZJQ F;  1ZG1 A;  5E20 A;  3I56 I;  4HLY A;  5F04 A;  3MD2 A;  3AAF A;  2CW8 A;  1JUS A;  4PZJ A;  2DA5 A;  5TIS C;  4XRM A;  4NQW B;  3OYJ A;  2VI6 A;  1UB9 A;  4UNO A;  1DP3 A;  1JUP A;  3L00 A;  3WE3 A;  2BY2 A;  2LF7 A;  2EB7 A;  1KGS A;  4FE7 A;  1VQ5 I;  2CUJ A;  2Y75 A;  1HW2 A;  3IV5 A;  3CMA I;  4F52 A;  3U2R A;  1WJ5 A;  2FRH A;  2Y69 H;  1MJA A;  2Q8K A;  2QLZ A;  3OMY A;  4BAC A;  2BVM A;  4AWX B;  2TDX A;  2X6X A;  5AIQ A;  4B44 A;  4EJW A;  2E34 A;  1IDY A;  1BL0 A;  4XSZ F;  2XRO A;  1GUU A;  3OL3 A;  5EGO A;  4OIO F;  3IP4 B;  2XGE A;  3GCM A;  1MDM B;  3QPH A;  2DYS H;  2H94 A;  2VBX A;  4XN3 A;  4D5C A;  2GIZ A;  4EJU A;  2E7X A;  1MH3 A;  3DLL F;  2JVH A;  5JHF A;  2KDZ A;  3T1B A;  4XLN F;  2DOF A;  3NRV A;  2R3S A;  5BS6 A;  1HBX G;  2E2I J;  5FRM A;  2ACJ A;  3MZ8 A;  1NH3 A;  3ULQ B;  3KP5 A;  3V8L A;  5K5O A;  4NC6 A;  2ZSH B;  2GA1 A;  3HOZ J;  1R1U A;  1D1A A;  1ETX A;  1Y1W J;  4BE2 A;  5HS8 A;  1VQO I;  2M1B A;  5HVQ C;  2Q2E A;  1P4W A;  3TOA A;  2BYV E;  1KU9 A;  1HKQ A;  3I0T A;  4YFN F;  3CCV I;  1BN5 A;  2DTR A;  1YE9 A;  3BQZ A;  2X48 A;  5ICE A;  3JRF A;  1W36 D;  4ZYD A;  2WAD A;  4II2 A;  5LBQ A;  1SD6 A;  3FKJ A;  1ZYR F;  4W1U A;  3OYC A;  2DOD A;  5DM7 F;  4BQA A;  2A6H F;  2OAZ A;  5KK1 A;  4GCV A;  2XF6 A;  1J59 A;  3CMM A;  1VF9 A;  3LSJ A;  2AXT C;  9ANT A;  4RA2 A;  4HDV A;  5FLX Z;  1B72 A;  1L3L A;  4LFU A;  3RQ4 A;  3HEF A;  4KIG A;  4FET A;  3SDG A;  4UUV A;  4M6X A;  1K83 J;  3DP7 A;  1ZG5 A;  1BW5 A;  2R7U A;  2ZME B;  2IGK A;  2Q1Z B;  3WE2 A;  3W2V A;  1M1E B;  3G4S I;  2LRE A;  1K6O A;  4HNT A;  1J7K A;  2LKS A;  1FNN A;  3CES A;  5CVI A;  3AL0 C;  3CCU I;  1JT0 A;  2F5E A;  3GUD A;  1FC3 A;  2WWY A;  2W85 A;  2K86 A;  5LFA A;  3KP2 A;  4PGH A;  3BZ6 A;  5J1R A;  4HST A;  3ZR8 X;  3V8J A;  1YTY A;  3BR1 A;  5M5Y J;  1WJD A;  2CQN A;  1KQ0 A;  2L9N A;  1DPU A;  3TP3 A;  3RPU A;  2R5Z B;  1O3S A;  2CJJ A;  2A07 F;  4PJM A;  5IPA A;  2IRF G;  2K9Q A;  2A6E F;  2WAF A;  4DIQ A;  3OIQ A;  5J1Y A;  3IC7 A;  4JOM A;  2RNG A;  2DCE A;  1FBS A;  2VJI A;  1OQY A;  2LY1 A;  2EIL H;  1VZ0 A;  2D45 A;  5J40 A;  1BJA A;  4HX4 A;  4IHX A;  2IA2 A;  2PX9 A;  5J8C A;  4IHV A;  1PJR A;  3MKZ A;  2F48 A;  5LD2 C;  4LG3 A;  2RKH A;  2QCO A;  2EPF A;  3HDD A;  3CJR B;  2LY9 A;  1X58 A;  3E7L A;  3HOS A;  5CQG A;  1XN7 A;  3RPQ A;  4B4C A;  2BGC A;  1NK3 P;  1W7P A;  1IUY A;  1YW8 A;  3C2B A;  1WJF A;  4QWQ A;  3ZMD A;  5L3B A;  5F0C A;  2CG4 A;  5D5U B;  1TQP A;  2EV6 A;  5EG0 B;  1LPQ A;  1UJ8 A;  1HLV A;  2EFN A;  2L54 A;  4WF2 A;  2CWE A;  4ESF A;  3E97 A;  5ERI A;  4FQG A;  4A5M A;  5EG0 A;  4XOR A;  2DBB A;  1J09 A;  4G6D A;  3FX3 A;  3K4B A;  4MEY F;  4DW6 A;  3ISP A;  3I64 A;  2CFX A;  2XIG A;  5FO5 A;  1XS9 A;  3WG7 H;  3V42 A;  4BE0 A;  4MFD A;  1I1S A;  4AYB A;  3FMQ A;  1XCB A;  1HA8 A;  3DBL B;  4AU7 A;  1HDD C;  3REO A;  4BQO A;  4DJA A;  5EGO B;  1BBY A;  1XX5 A;  1XDU A;  5F0F A;  3JAM Z;  1SAN A;  3KFW X;  4CA0 A;  1EH8 A;  1OCR H;  4S04 A;  1MMN A;  4CZZ A;  2LD5 A;  1P4X A;  3CDL A;  1UST A;  4CCL A;  1J75 A;  1FMW A;  2A61 A;  3HZJ A;  4OOI A;  1JUM A;  2P4W A;  2V79 A;  2QGU A;  3D1N I;  5GAE J;  4MFE A;  3SDB A;  2DOE A;  4IXA A;  4IPA A;  3J7Y J;  1U5T C;  5HLT A;  1IV6 A;  4TV7 A;  1U5T A;  2GAU A;  4WXC A;  3IRQ A;  4AID A;  1LDJ A;  1QGP A;  3I71 A;  3DXJ F;  3HRM A;  3ZN0 A;  2FOW A;  1PYV A;  4BEH B;  3ZMS A;  1U5T B;  2DTZ A;  2HNH A;  1H89 C;  1FZP B;  1I3Q J;  4MQV A;  5DTD A;  1MH4 A;  4XKC A;  2EV0 A;  4H4K C;  2IGM A;  1S7A A;  3GF2 A;  2XGC A;  5TGT A;  5BQT A;  1MIJ A;  2CH0 A;  2ZSI B;  4A3K J;  2ELK A;  1XSD A;  3IRR A;  4DZP A;  4M73 A;  1U0J A;  3L09 A;  2EFP A;  3S14 J;  3WHB A;  1QHG A;  3S8P A;  3KLO A;  2HOE A;  3BG9 A;  3MEX A;  2GM4 A;  3JW4 A;  3BY6 A;  2VOD A;  2NVY J;  3COA C;  1LEA A;  2BV6 A;  1I6H J;  4EGY A;  3HBL A;  1XB4 A;  2IXS A;  2VQG A;  4I02 A;  3IKV A;  3LSR A;  4GXO A;  3SJM A;  1DU0 A;  1NHA A;  2M4G A;  2MSY A;  3CUQ A;  1J9I A;  2DA6 A;  4XM3 A;  3LSP A;  4YFK F;  2LOO A;  1IAW A;  1F9N A;  1JTX A;  2Z1D A;  1Y56 A;  5IYB J;  5KCM A;  1YO5 C;  5FLX K;  4XRS A;  3CUQ B;  4IQJ A;  2EV5 A;  5DYM A;  2L9R A;  3BDD A;  2JVG A;  1GVD A;  4XQF A;  1R58 A;  3M8J A;  2FBK A;  4BJ6 C;  1FX7 A;  3M1C A;  3QRF F;  3LNQ A;  4R8H A;  1YJN I;  3BR0 A;  3JCU C;  5H6Q A;  1MBK A;  2STT A;  4G94 A;  4JX6 A;  1K79 A;  2CV1 A;  1X1C A;  2L7M P;  2HKO A;  1NK2 P;  3TMO A;  3KZI C;  2JSC A;  1IN5 A;  2VOP A;  2JA5 J;  4DNC A;  1KQ8 A;  2HDD A;  4HLX A;  2DA1 A;  2V6E A;  3NEU A;  1Z3X A;  3JRC A;  2H8W A;  2Q2E B;  1VQ9 I;  3X2Q H;  2GXB A;  1J5Y A;  3ZQH A;  3Q5F A;  5AIP A;  1TL8 A;  2FML A;  4K2E A;  2BE5 F;  1X3W B;  3I3L A;  3K70 C;  5F27 A;  2KJB A;  5D8L B;  1IUF A;  3CO7 C;  1HKS A;  5BPD A;  5BNG A;  3K4C A;  5M3F J;  1E3P A;  1OCC H;  5HLH A;  3HTU A;  4XLH A;  1T0F C;  1WVR A;  1MDM A;  2I8D A;  1SAX A;  1PDN C;  2IS6 A;  4IHS A;  2HOS A;  1R23 A;  3JRD A;  3W6K B;  2WBM A;  3BR3 A;  4LLL A;  2HVR A;  1IC8 A;  1UG0 A;  1O3T A;  1EV7 A;  3S17 J;  5D5W B;  2VKH A;  2K9N A;  4IHT A;  3DLA A;  2XRL A;  3LAP A;  3SEQ A;  1ZTR A;  5ICG A;  1B59 A;  4LMY A;  1FOY A;  4I76 A;  2ZJ2 A;  5EEH A;  4E7K A;  1PUE E;  4RB3 C;  1LFP A;  4FTH A;  1TWH J;  1EA3 A;  1BOB A;  4EM1 A;  1Z67 A;  4IZZ A;  2HXO A;  2HGC A;  5D6E A;  2L7Z A;  3JRE A;  1X2N A;  2XPU A;  1B9N A;  4C9Y A;  4BDZ A;  2K9M A;  5E17 F;  2VJ5 A;  1AU7 A;  2CGP A;  3HOV J;  1H9T A;  2BW3 B;  4LJZ F;  1TQM A;  4OIR F;  2CMP A;  5E1W A;  4A3C J;  5HLI A;  3H3U A;  3RZD J;  3FXR A;  2FNA A;  3PQK A;  2Y0S N;  2RVC A;  2QWW A;  2RC4 A;  2K40 A;  2IT0 A;  3S1N J;  4IEJ A;  1XDS A;  2B0L A;  2Y0S A;  3HG9 A;  1ZRE A;  1G8X A;  3MAJ A;  3DKW A;  4C3I J;  1WGX A;  3CLO A;  3Q9V A;  5IY5 H;  3Q3S A;  1HW5 A;  4MTE A;  1UEL B;  2VON A;  3I58 A;  3LA2 A;  2QYO A;  4BY1 J;  4A6E A;  2DN0 A;  1VQP I;  3RTR A;  1LE8 B;  3SFZ A;  3GZ5 A;  2B63 J;  4Z2Y A;  2ZFU A;  3CZ6 A;  4S0H B;  2IGO A;  2FX0 A;  2FUG 2;  4QLC U;  2F4M B;  4DBQ A;  1G3T A;  1RC9 A;  2O61 A;  4B1R A;  2XPV A;  1ZGJ A;  1A04 A;  2LMD A;  2GA2 A;  2RDP A;  3GFL A;  5KHD A;  1MNE A;  1X1B A;  2LSO A;  1RIO H;  1S3J A;  3F72 A;  2VXD A;  2A5Y B;  3K0L A;  2P7C B;  1W1W E;  3S1R J;  2X1D A;  4JX5 A;  4KUM A;  3TW7 A;  1WRJ A;  4LOC A;  1ETW A;  2LVS A;  1ETK A;  1WCM J;  4X1E A;  4M9Z A;  2BXZ A;  3H5R A;  5E3O A;  2JSP A;  4HBL A;  5LRS A;  3DQV C;  1RKT A;  3V7C A;  1T56 A;  1UCR A;  2IW5 A;  3GEZ A;  4JYK A;  4J01 A;  5J1U A;  3EDP A;  1WJB A;  4JQF A;  3EUK L;  1GV2 A;  1A31 A;  2K5C A;  3TGN A;  1VFC A;  3K1M A;  1O57 A;  3BTJ A;  5EYR A;  5BPI A;  3E5U A;  1IXS B;  1JGS A;  1P4A A;  2GIV A;  1SFO J;  2M7B A;  3WGH A;  4GFB A;  4PDK A;  2HQA A;  1RRJ A;  3RKW A;  1A5J A;  1EH7 A;  5DCM B;  5J47 A;  1C0W A;  1QZZ A;  2P5K A;  4QPQ A;  3JRB A;  3ZQG A;  1W5S A;  3JTH A;  3Q9S A;  4E7S A;  4DYC A;  4AVP A;  4NQW A;  2P5L C;  3NWT A;  1ODD A;  3OSF A;  3O2P E;  1VQ8 I;  2LC2 A;  1LVA A;  1X4P A;  3KYL A;  1SFE A;  2EZI A;  2HFH A;  3PUB A;  3FKI J;  1Z7U A;  2MC4 A;  3VB2 A;  1D3Y A;  1HF0 A;  4A6D A;  2HOA A;  5GAG J;  2JRM A;  3DEE A;  4BXU A;  1KYZ A;  5LEK A;  4CGZ A;  1RNL A;  4JBA A;  5BMZ A;  2AXL A;  5KAI C;  1WI9 A;  1OIS A;  3I54 A;  4IRI A;  1SFX A;  2VQH A;  3VEP A;  4BU2 A;  4Z6Y A;  3K4N A;  3G1M A;  3K7A J;  5DUK A;  4IKF A;  1J0R A;  1BW6 A;  2CUE A;  4L9T A;  2KZG A;  4OIQ F;  3WTS C;  2V26 A;  3IH2 A;  5E3N A;  3K4J A;  1QVU A;  3J7Z I;  1G4D A;  1R4N B;  3OYI A;  1LNW A;  4U0W A;  5FRN A;  2DK5 A;  4AIJ A;  1B1B A;  4KN4 X;  2D5V A;  2LKX A;  1WKM A;  5EEA A;  5FKL A;  3H35 A;  2KHM A;  3S93 A;  2VE8 A;  4F55 A;  5H6R A;  3ZQ7 A;  2X0L A;  4X6A J;  5FFZ A;  3MFK A;  2KL4 A;  1FTT A;  5E8I A;  3G6E I;  4M9S A;  2JA8 J;  3GVA A;  2D1H A;  1AOY A;  2HKX A;  2KIF A;  2X1C A;  3CDI A;  5JLW A;  4EAT A;  1O4X A;  1JXS A;  4XK4 A;  2EIN H;  1XSX A;  5IT3 A;  1DPR A;  2M9H A;  2FD5 A;  1E17 A;  3LOC A;  2ME0 A;  4G12 A;  3C1D A;  2JA2 A;  2VAS A;  3H0G J;  4MNU A;  3CO6 C;  1T8I A;  5DM6 F;  3V7S A;  1QZE A;  1P92 A;  2E1M C;  4HV6 A;  2VUM J;  1OR7 A;  2VOO A;  3H1C A;  2YS9 A;  3EUH A;  5DD4 A;  5L3C A;  3EUH C;  1GT0 C;  2EZH A;  1B72 B;  2PI0 A;  3BZC A;  2R7D A;  2OQG A;  3AG1 H;  1KA8 A;  5HOO A;  2R92 J;  2FSW A;  2DA4 A;  4A93 J;  4LG0 B;  3ZQC A;  2UWM A;  1HSJ A;  4N0B A;  4OAZ A;  5F64 A;  3J81 K;  4C3H J;  4HF2 A;  1XG1 A;  4ZDL A;  4G6Q A;  4XR6 A;  3PNV A;  1AKH B;  3G73 A;  2JZY A;  2NXN B;  1U78 A;  2KT0 A;  2VC1 A;  4DQ2 A;  4A3F J;  2DPD A;  2H1K A;  3SHF A;  4ASN A;  4S05 A;  3DV8 A;  5D8K B;  2X9D A;  2RQP A;  4M3E A;  4UXN A;  4HF0 A;  4Y7N J;  4C2M J;  2ZXH A;  1R1T A;  2JUC A;  3EUA A;  3HL2 A;  3F6V A;  2M8G X;  1TWC J;  3ZQI A;  1I39 A;  3CF5 F;  3BG7 A;  2NOG A;  4HA8 A;  1YIT I;  3M7G A;  1FIA A;  1SVO A;  1XGS A;  2QSF X;  4YRV A;  1NG7 A;  5FJ8 J;  2XAQ A;  2WV0 A;  2JPC A;  2OZ6 A;  2QSH X;  4XNF A;  4Y13 A;  4A0Z A;  4L18 B;  3FBN B;  4RB1 A;  3DPT A;  3CCL I;  2OA4 A;  2F5D A;  3PUF A;  4LB5 A;  4OU0 A;  3E6C C;  1WSU A;  1BI2 A;  3M9A A;  3ZP5 A;  2E2J J;  2TCT A;  2ZXW H;  4I2O A;  1WHU A;  1W7P B;  2V1N A;  4CSW A;  4PGG A;  2E36 A;  2CV0 A;  3OYN A;  1YFH A;  1KYW A;  3PO3 J;  3DTI A;  1FTZ A;  3HB9 A;  5K7Z A;  3BOQ A;  2K3P A;  4XIC A;  5C44 J;  2ZB9 A;  2R7T A;  3ZCO A;  2ZME A;  1BR1 A;  2QM3 A;  3FBI B;  4RB0 A;  1FSH A;  5B3S H;  4P9U A;  3ERM A;  2QVO A;  4BJT A;  1T2K A;  2CV2 A;  3SQN A;  2WA0 A;  2M45 A;  3IWZ A;  3QU3 A;  2A68 F;  1JHH A;  4CUG A;  2COM A;  2XB5 A;  3HRU A;  4AYB N;  2PJR B;  5HNH A;  2H27 A;  2MC3 A;  4U0V A;  3DFG A;  5GTH C;  1QA6 A;  1I3A A;  3HUG A;  2LBF A;  3DEW A;  5F6F A;  1A36 A;  4E7Z A;  5J4Y A;  2RNJ A;  2NOJ B;  1BI1 A;  1FP1 D;  1QPM A;  2G7H A;  3HUG B;  3LST A;  4HQM A;  1QZY A;  3WGI A;  5A2Q K;  3K70 D;  3N4M A;  3A2K A;  2H6B A;  4RGU A;  3UR3 C;  3NAR A;  5CKT A;  5F1R A;  3GLX A;  2DA2 A;  1Z6T A;  5ICC A;  3E1S A;  2JRT A;  3FXL A;  4IX7 A;  1FMV A;  1SD5 A;  2L01 A;  4L0Z B;  2ZCW A;  2H1L A;  1HW1 A;  5HLG A;  2E5N A;  2ZJR F;  2MBF A;  1MBE A;  2CQK A;  4BEH A;  2CS3 A;  2PMZ N;  3D5R C;  5HS7 A;  2O5R A;  1EF4 A;  1HKT A;  3IAM 2;  3KP3 A;  3GBG A;  2OF7 A;  3CC7 I;  3EPZ A;  2AHQ A;  4MIM A;  2LKP A;  2Z33 A;  4FHT A;  4Y4R A;  4I0A A;  1OCP A;  4CCM A;  2EWN A;  2W82 A;  5GPA A;  5ILV A;  2X51 A;  5DEQ A;  3U1K A;  4HF1 A;  1MBJ A;  4M74 A;  3G2B A;  3GX4 X;  5CVU A;  2WB1 A;  3TO7 A;  2ZNY A;  4MQ9 F;  2VL8 A;  2HR3 A;  5E1X A;  1VQ7 I;  3P9I A;  3CCQ I;  1Y8Q B;  3LMM A;  4YG2 F;  3PSI A;  5IT9 Z;  4IJA A;  1GLN A;  1ON1 A;  4B09 A;  1JKR C;  3WTV C;  4IHW A;  4Q5S F;  3C7J A;  2GBY A;  4AIH A;  3BJ6 A;  3BJA A;  2OC6 A;  3L2R A;  1H9G A;  4F3Q A;  1G3S A;  3C2G A;  3TP0 A;  2I5U A;  4RGS A;  3BP8 A;  3HM5 A;  3FXM A;  1WI3 A;  4KIT B;  4FX0 A;  3BR2 A;  2P5V A;  3N05 A;  4RAZ A;  2HQR A;  4L5E A;  4UVA A;  3GTJ J;  2QEX I;  1W36 C;  1AKH A;  3KZY A;  1S6L A;  2K02 A;  4BQQ A;  1S8N A;  1S5L C;  1YLF A;  3SEZ A;  4V2F A;  5L3F A;  2OZU A;  3F8C A;  3MQ0 A;  2KPM A;  1TNT A;  4ZZD A;  1BI3 A;  2YX7 A;  1SVL A;  3AG2 H;  3WTU C;  1WH5 A;  2XUB A;  4R79 A;  2V6C A;  5D5V B;  1HST A;  1O3R A;  2BY1 A;  2JK3 A;  4RM2 A;  3OIP A;  2M2E A;  2DMP A;  4XLA A;  1FT9 A;  4GDF A;  3H5N A;  1VQM I;  3NAU A;  3CME I;  2NNN A;  5E3M A;  1VQK I;  4D1Q A;  3FHN A;  1QHH D;  2VT3 A;  2CSO A;  5J8F A;  3LAJ A;  2DPU A;  4BBR J;  5EZH A;  2MD0 A;  4BNC A;  5H20 A;  3BLY A;  3IHU A;  3OR2 C;  4XLE A;  2CU7 A;  2BEO A;  2R7F A;  2L7F P;  5A2Q Z;  2NAZ A;  1GDT A;  3BPX A;  3U1D A;  1XD7 A;  3L2Q A;  4PFP A;  2OCE A;  2B7E A;  4NB5 A;  3DTK A;  5CVV A;  4D9J A;  2HYJ A;  2F5F A;  1IDZ A;  4YII A;  2VQC A;  1K6Y A;  2W4S A;  2VPR A;  4UHT A;  4XKW A;  5CYV A;  2Z16 A;  1T98 A;  2EFQ A;  1Q1V A;  1LEB A;  3RPU D;  4HEA 2;  2FE3 A;  4KT6 A;  4V2G A;  2GZW A;  5TJJ A;  1BR4 A;  2QZ8 A;  3VYT B;  4ENN A;  2KRC A;  3L7W A;  4B3X A;  4M3B A;  4P5O A;  3F6O A;  3RJP A;  4FT8 A;  3B02 A;  3L2U A;  2NYX A;  3KLN A;  3OS1 A;  4ESJ A;  5E79 C;  3OYF A;  3VSK A;  5B1B H;  3K4K A;  3IH3 A;  3K1P A;  3W6J B;  3VWB A;  2YUS A;  2UZK A;  3TO9 A;  5IP7 J;  2EZL A;  4P9F A;  5ICF A;  4A2U A;  1R4M B;  2CQX A;  5C4X J;  4ZTJ A;  2R5Y B;  3FZV A;  1U9N A;  5FLV A;  4KIS A;  1G2H A;  2Z9O A;  4CO8 A;  1S9H A;  1X2M A;  3IKT A;  3ZQL A;  1QU3 A;  2HWV A;  3SXY A;  1ERD A;  1ONV A;  2AS5 F;  4A3G J;  2K4B A;  1WJA A;  1BIB A;  3GTQ J;  5EEG A;  2X1E A;  4I0B A;  2OV7 A;  5LHI A;  2EH3 A;  1APL C;  2ZXJ A;  1UAA A;  1LQ1 A;  2M3A A;  3KP6 A;  2E1O A;  4CH7 A;  2I10 A;  2JA6 J;  1ETV A;  2Y31 A;  1BJZ A;  3NQO A;  4E6K G;  4E7H A;  1FOW A;  1NG6 A;  3RKX A;  2NNY A;  2CUF A;  4BL0 B;  2P0W A;  5LLQ A;  1K78 A;  5IP6 A;  3BG5 A;  1IZ1 A;  3T5X A;  1X3U A;  2LF8 A;  4ANJ A;  1CQT A;  1MMS A;  2E19 A;  3P9C A;  2QBY A;  1MW7 A;  1OKR A;  2LLK A;  2X6Y A;  1IO2 A;  5F1J A;  4PJN A;  4ZDP A;  3DU5 A;  4BXX J;  1MJB A;  2DOA A;  3WGG A;  1EJ9 A;  4BBS J;  3K10 A;  4LIT A;  3DPL C;  2YR2 A;  5FB2 A;  2DO7 A;  3QU6 A;  4EM2 A;  4GO1 A;  3EYY A;  1GHC A;  2V9V A;  2FBI A;  1IG7 A;  1OYW A;  2DDA A;  2QEN A;  1TBX A;  3KIO A;  3VYU B;  2C6Y A;  1FIP A;  3KZZ A;  2A69 F;  4CHU A;  3RKY A;  4BGD A;  3OS2 A;  1D8J A;  3AL0 B;  1XCV A;  3H9G A;  3QP5 A;  2DMQ A;  4AIK A;  1YRN A;  3ML6 A;  3GW2 A;  2F4I A;  3BTL A;  4L9V A;  2K4J A;  3TDU C;  3TDZ C;  5LGN A;  2BVL A;  2DK8 A;  4G7O F;  5D5X B;  1V55 H;  5K5Q A;  3WU2 C;  3VPR A;  1I6X A;  2K9S A;  3ABM H;  1ZG3 A;  2O8X A;  5JVT A;  1ZGW A;  2FOK A;  1L0O C;  1OCT C;  3FF5 A;  4M3G A;  3OYL A;  5FRO A;  3SZT A;  1FBQ A;  1KZH A;  5E1Z B;  3M8F A;  4IL6 C;  2W48 A;  3U9G A;  1WJC A;  1JE8 A;  5FD5 A;  4U7B A;  4C2U A;  3QYB A;  4QTR A;  4A3I J;  3A03 A;  1LDD A;  5K7F A;  1JGG A;  2MH2 A;  1O7F A;  2HDW A;  4M3D A;  2EBI A;  1ETY A;  3FMR A;  3GME A;  4B3A A;  3ASO H;  4KN7 X;  3R0J A;  4EVI A;  5LEJ A;  3OOU A;  1U6G A;  3CCS I;  3HPH A;  3K4L A;  1YJ9 I;  5B5E C;  4G7Z F;  5F0H A;  2WV1 A;  2Z3Y A;  3FXK A;  2W7N A;  2XKO A;  3C3W A;  4U0Y A;  2R7S A;  4BDY A;  2DJN A;  3PIO F;  4XOT A;  4Y17 A;  3S2W A;  2V7F A;  2EIM H;  4E4H A;  3HIF A;  3CJN A;  2WAQ A;  4IVN A;  2DFF A;  3BWG A;  2Y9Y A;  4D7M A;  5CQE A;  3ZRG A;  4CYC A;  2UXX A;  2HYG D;  1OLT A;  4UB8 C;  1SAU A;  2EA2 A;  3J81 Z;  3A4C A;  1A6I A;  1Y1V J;  3VYS B;  4A69 C;  3WTT C;  1RET A;  2VB6 A;  4CYD A;  2DXI A;  3HKZ N;  4ZDO A;  2LFB A;  2HZT A;  2PJP A;  1OMI A;  2FJ1 A;  2H6C A;  2IS1 A;  4BXF A;  2K9L A;  2CQ7 A;  2VKE A;  2GXG A;  1YIJ I;  3S16 J;  1TLH B;  4HW0 A;  5FD6 A;  3R0A A;  3VOD A;  2E1C A;  2IS2 A;  2LTP A;  2OU2 A;  2R7R A;  1T39 A;  4CXF A;  1AA7 A;  3CD6 I;  3LSG A;  3PFY A;  4PSW A;  4OMZ A;  5HDK A;  3GTP J;  2LK2 A;  2MLK A;  3AG3 H;  4BKX A;  1RR7 A;  1Z7L A;  3OYK A;  2HTJ A;  3UKG A;  5LHG A;  3HSF A;  4B8X A;  3IAS 2;  3BT9 A;  4Q47 A;  1RPW A;  3CC4 I;  2OD5 A;  1RI7 A;  2E71 A;  3JR9 A;  3MKW B;  3KYD B;  3ZQF A;  1FPQ A;  3KPH A;  4HPQ A;  1T95 A;  3RDI A;  5LRR A;  1POG A;  3MKL A;  1P7J A;  4AVZ A;  1N75 A;  1IF1 A;  4L9N A;  1MKM A;  4Q4Z F;  3E0J B;  3RYR A;  3A0B C;  2EA4 A;  5C4J J;  3W2W A;  1LUJ B;  4ZYA A;  3G71 I;  4EQQ A;  2RGV A;  1H8A C;  1QPI A;  1Q1H A;  2O0Y A;  3GFJ A;  1UHM A;  2W00 A;  4MEX F;  1Y8R B;  3GZ6 A;  4G9Y A;  4II3 A;  1UG2 A;  4IHY A;  2L0K A;  3JRA A;  2FU4 A;  3HC7 A;  1R9T J;  3BC8 A;  1B4A A;  1O3Q A;  2H09 A;  3OL4 A;  3CJQ B;  4CDG A;  3BG3 A;  4CCK A;  4XRS G;  2ISY A;  2RAE A;  1ZKG A;  2VBY A;  4B47 A;  4L5J A;  5JHU A;  1P7I A;  3GTM J;  2Y30 A;  1P2F A;  3HSE A;  2PBI A;  2WAE A;  4UV9 A;  3TW6 A;  1S7E A;  2V9P A;  5DV5 A;  1LKX A;  2ZBK A;  4ZJZ A;  2LDU A;  3HYI A;  4PK4 A;  5L3G A;  1PUF A;  3GWZ A;  3A02 A;  4ZYE A;  4L5I A;  4HOB A;  2BHY A;  1OCZ H;  4OIN F;  3V7R A;  2EJR A;  4EJT A;  1PP8 F;  2YX4 A;  1U8R A;  1PVE A;  1BM9 A;  2V1U A;  2RRE A;  1Z21 A;  3M8E A;  3IH4 A;  2Y9Z A;  4A3E J;  1TWG J;  3IUO A;  5J3L A;  3G1L A;  5DS9 A;  4AUX A;  2E2H J;  3FHZ A;  4DGW B;  3BTI A;  1YX5 A;  2BW3 A;  2ESH A;  2KP6 A;  2P8T A;  1EKE A;  3CDH A;  3GXO A;  3F3X A;  4M3F A;  3DBH B;  4E7J A;  2DFI A;  3ZQQ A;  4G7H F;  4GYI A;  4A3D J;  2L9V A;  1OYI A;  1HDP A;  3TOB A;  1S29 A;  5JLX A;  2Q0O A;  1SFK A;  2VPL A;  4B43 A;  3DF8 A;  4D7N A;  1Z05 A;  1QQI A;  1B9M A;  2HYF A;  2JN6 A;  2P6T A;  1XMA A;  3MVP A;  1BIA A;  2Z5U A;  3D0S A;  1Y0N A;  3FXU A;  3QWL A;  3E3V A;  1R5H A;  2W1O A;  4IOA F;  3CP2 A;  3FWE A;  1YYV A;  4PJJ A;  2ESN A;  4IF4 A;  4E70 A;  2OTJ I;  3DWL E;  2MG4 A;  1IV8 A;  4HNV A;  2A6T A;  2ELH A;  3CQZ J;  5L3D A;  2XGD A;  3DBR B;  1MJ9 A;  3I55 I;  3OWT A;  3BCA A;  1T08 B;  4RB2 C;  5L3E A;  3OYD A;  2JUG A;  4O5V A;  4M6V A;  2O7O A;  3JTG A;  3T8R A;  4R1H A;  1D1C A;  4I01 A;  4RS8 A;  4WWC A;  3VYR B;  2WY7 Q;  1N77 A;  2L7K A;  3GTK J;  1GXP A;  1D5Y A;  2KRH A;  5TRD A;  4JP0 A;  1V4R A;  1UHS A;  4LGW A;  2M7A A;  1FLI A;  2VN2 A;  4RBO A;  1UFM A;  1FOK A;  1VQL I;  1OPC A;  1QVT A;  1D0Y A;  3KYC B;  4RAF A;  5EJC A;  3J7A Y;  3KEQ A;  1ZR2 A;  1FJL A;  1F4K A;  4N4O B;  1RUN A;  4D0P A;  1SD7 A;  3PSF A;  4XON A;  4XBF A;  2KIU A;  4F91 B;  3BJO A;  3KEY A;  4DBR A;  3Q0W A;  4YEL A;  5IP9 J;  2FQ3 A;  2IP2 A;  4BHB A;  1SVM A;  1TW3 A;  2JTV A;  2AO9 A;  3S3O A;  1TP4 A;  2VT2 A;  4BHC A;  2GWR A;  2D1V A;  3E6D A;  1MBF A;  3VDX A;  1QO0 D;  5CLS A;  2ZO4 A;  3RIR A;  3UNG C;  2OJE D;  1K78 B;  1E2X A;  4ZZL A;  1YIO A;  2O8K A;  2L4A A;  4RGR A;  3ZN1 A;  1RKW A;  5HDG A;  1W5C C;  4BJ5 C;  3PQJ A;  5M5W J;  1ZLK A;  3ESW B;  5M5X J;  2HS5 A;  2WC2 A;  2Y0M A;  4Y15 A;  2DI3 A;  1W5T A;  4RLQ A;  4ZYG A;  1WJE A;  2X4H A;  1MGT A;  2EK5 A;  2L02 A;  5F08 A;  3D5L A;  4I98 B;  4AD9 A;  3HSR A;  2E7W A;  3V4G A;  5FLM J;  3K1N A;  4BQN A;  1IRZ A;  1LFU P;  2G9W A;  2XB0 X;  3FIS A;  4NBQ A;  2XAJ A;  3CCE I;  2EFO A;  2AQF A;  2BOL A;  3FMS A;  1MSE C;  2E1N A;  4NDL A;  1H88 C;  4XRF A;  2KRF A;  1FBU A;  2E60 A;  2IAI A;  2KDO A;  4CZC A;  3DTE A;  3VSL A;  1R22 A;  1YG2 A;  3OV8 A;  2IA0 A;  2VKD A;  4EM0 B;  2HVQ A;  5K1Y A;  3F23 A;  2DDB A;  1YOV B;  3ZMU A;  4YEJ A;  1MNM C;  1USS A;  1G59 A;  4HX7 A;  3QOE A;  3ZPL A;  2A05 A;  5C3E J;  1R00 A;  3DU6 A;  3QQA A;  2HEO A;  2VC0 A;  2DAO A;  3FXJ A;  2JJ7 A;  2M5W A;  3W2A A;  4F7Z A;  3K2A A;  4N9I A;  5J6X A;  4XOP A;  1MZB A;  2W57 A;  2LRD A;  4FAS D;  1Y0U A;  4KJZ A;  3E5X A;  3DKX A;  1KON A;  3Q0U A;  3JSO A;  2EFW A;  3I59 B;  4U7D A;  5FKM A;  2XAH A;  1RES A;  4EV0 A;  4JK1 X;  1BOA A;  1TNS A;  2XSJ C;  4NC7 A;  4E7I A;  4M72 A;  4HNU A;  4IRH A;  2FF4 A;  3S15 J;  1F43 A;  2XAF A;  3GZN B;  2GOX B;  2IVM A;  2KKO A;  3ABU A;  3C18 A;  2ISZ A;  3PNY A;  2R7X A;  1LB2 A;  4PUS A;  2BHZ A;  2KIM A;  3F8F A;  3A0H C;  1IRF A;  3E6M A;  4CYC B;  1EH6 A;  3SFI A;  3K6G A;  2XKP A;  3H9Q A;  1XSV A;  1YW9 A;  4YIF A;  2E5Z A;  4HZF A;  1ZRF A;  1MND A;  2ZNZ A;  5IT9 K;  1X4O A;  3NWS A;  4L0Y B;  5K5R A;  5JFR A;  1OCO H;  1E0E A;  3HJE A;  3DPU A;  1VTN C;  3LSM A;  3T0Y A;  2HPM A;  3Q0V A;  1YQA A;  2PQ8 A;  2CQQ A;  5IOY A;  5D4R A;  1YX3 A;  2HQN A;  2M4K A;  2VBZ A;  1CGP A;  2PLY A;  3KEO A;  3FM3 A;  2MYS A;  1XMK A;  5LGU A;  2IBD A;  2XVC A;  1QBJ A;  3OIO A;  2CW7 A;  1JKP C;  4M71 A;  3OR1 C;  5J4V A;  3GYH X;  3W6V A;  3OYM A;  4A3L J;  5IOZ A;  1G6N A;  1ZH5 A;  2R7O A;  3RZO J;  3QPT A;  2F5V A;  3LA7 A;  3S1Q J;  1F5T A;  4CCN A;  1R49 A;  3E5Q A;  3LFU A;  2GOM A;  4CCJ A;  3E6B A;  1KQ9 A;  1J2X A;  4A12 A;  1X19 A;  3WTZ A;  2VBW A;  5D4S A;  3CCM I;  1A35 A;  2V1X A;  4HDU A;  4ENM A;  2LNB A;  1RUO A;  2NVT J;  1VQ6 I;  3FM5 A;  2UV1 A;  4XN0 A;  2ZXI A;  1JKQ C;  2BBY A;  2R7V A;  5DDG A;  4OIP F;  5FGM A;  5E18 F;  2DMN A;  4WK8 F;  3BQY A;  3QP6 A;  4KA4 A;  3PIP F;  1F36 A;  1B8I B;  2ICW G;  2DA3 A;  3PO2 J;  3ZMT A;  1UMQ A;  4MO7 A;  1OR7 C;  2FXA A;  2E1M B;  2QBY B;  1B8I A;  1ZAR A;  1IRX A;  3ABL H;  1RZ4 A;  1ETQ A;  3JRG A;  4BH9 A;  3RKQ A;  1DDN A;  3K9T A;  3TKY A;  4ZYH A;  2VJ4 A;  3OY9 A;  4HV5 A;  2XF5 A;  4IO9 F;  5HOD A;  2XAG A;  1DP7 P;  3I4M J;  4YFX F;  3QPS A;  3ABT A;  2JPB A;  3OYG A;  2IS4 A;  3CF2 A;  5JR3 A;  1W7P D;  4XKB A;  2KIQ A;  3ZGK A;  2LYC A;  3L2C A;  5EDN A;  3CTA A;  4OMY A;  1MSF C;  3FK7 A;  4MGR A;  2ETH A;  4ENK A;  1TQI A;  3V8K A;  2DYR H;  3B6A A;  2XHK A;  3CCY A;  2EQR A;  3BG6 A;  3K69 A;  2J5O A;  4RLF A;  4KMF A;  1MMD A;  2MD5 A;  2QQA A;  4XLC A;  3EQL F;  3HOT A;  2WTE A;  2R7Z J;  3FK6 A;  5EF6 A;  4B48 A;  5IYC J;  2RQQ A;  1FYL A;  1V5G A;  2DLL A;  2ECB A;  3LSH A;  3I9V 2;  1VND A;  1BC8 C;  3FXO A;  2MAB A;  2UUZ A;  4N9H A;  1LE8 A;  3HOW J;  1DQU A;  1R71 A;  4LK1 F;  2LG4 A;  4A5N A;  2XC7 A;  2O3F A;  5CJ9 A;  1X3Z B;  3S2H J;  2M0C A;  2V4J C;  1FWZ A;  4P1W A;  4WX9 A;  1XC5 A;  3R60 A;  1Z91 A;  3TL4 X;  2ZC2 A;  4A3J J;  3H9J A;  1HQC A;  1ZR4 A;  2MA3 A;  3M07 A;  1JTY A;  5LGT A;  4BHP A;  5HS9 A;  4ABZ A;  3HOU J;  3WOD F;  4I99 C;  4U87 A;  6PAX A;  1AHD P;  2TRT A;  4KIB A;  1WH7 A;  4GRI A;  5BOX A;  2VQL A;  4UV8 A;  1ON2 A;  2FBH A;  4I6Z A;  4U88 A;  4HG2 A;  3QPL A;  2DA7 A;  2ZME C;  1Z3Y A;  4KYW A;  3OYH A;  1D5V A;  2F5C A;  2QQ9 A;  1JI8 A;  2NS8 A;  2HU9 A;  4I7H A;  4Y52 J;  2MFZ A;  2R7Q A;  3WTY C;  2EIK H;  3W3C A;  2VJJ A;  2H8R A;  1LJ9 A;  1ZGA A;  3LWF A;  4RDU A;  3A01 B;  4DZJ A;  3LQR A;  4P55 A;  5GAH J;  3H5A A;  3M1E A;  2R93 J;  3I4N J;  2X85 A;  3MCZ A;  5DD8 A;  1QNT A;  1X1P A;  4RGX A;  3MN2 A;  3N97 A;  5DCM A;  3F22 A;  1N78 A;  3KX2 A;  4XL9 A;  2NVX J;  2M8E A;  3H36 A;  3H0D A;  2IJL A;  4AC0 A;  4PFO A;  3HHH A;  3AKZ A;  4KIC A;  5ILU A;  2OCC H;  3MKY B;  3K4M A;  1TWA J;  1GV5 A;  2Z99 A;  3CUQ C;  4C30 A;  4PJL A;  2XV4 S;  1MMA A;  4C2T A;  4MHG A;  3KCC A;  2YPR A;  1TWF J;  4BUP A;  3CCJ I;  3O3K A;  1R1V A;  2UXN A;  2ZKZ A;  3SYT A;  1OJL A;  1R7J A;  3WTX C;  1AWC A;  3CMY A;  5M3M J;  4OAY A;  3ECO A;  2DU9 A;  5CPR B;  5FKN A;  2KMU A;  4XLF A;  2HI3 A;  1U9O A;  3MMY B;  1TW2 A;  2X6W A;  1HC8 A;  1XTA A;  3T8T A;  3JSP A;  3OYE A;  2HQ5 A;  2QQ8 A;  3IWF A;  4ITV A;  4XMY A;  2QQB A;  4HRI A;  4BE1 A;  3GTG J;  1E3H A;  3BCB A;  1B6A A;  2OTL I;  1KU2 A;  1V3F A;  1K4S A;  1IGN A;  2O03 A;  3GLL A;  1W0U A;  1R6R A;  4DYQ A;  1YJW I;  3DKY A;  3TQN A;  5KVR A;  4UVC A;  4P96 A;  4D5F A;  2A5W A;  2XAS A;  3RYP A;  2XSD C;  2QKL B;  1T33 A;  2IA1 A;  4NUB A;  3U21 A;  3JAM K;  2M30 A;  4HYE A;  3CCR I;  2GLO A;  2VKV A;  4WXD A;  1IN6 A;  2V1D A;  1XGM A;  3BRO A;  3CUO A;  3MZY A;  3QYE A;  1OYY A;  2PG4 A;  3C2H A;  2DMT A;  1WPK A;  2PJR A;  1I27 A;  1T0F A;  4RAG A;  4ZTF A;  3F8B A;  2HZD A;  3CJT B;  3CC2 I;  4Y3O A;  2IEK A;  2F4O B;  3I4P A;  4DOZ A;  4C3J J;  3A1Y A;  4HX8 A;  4UUS B;  2DT5 A;  2PEX A;  4AM3 A;  1ZEL A;  2F6C A;  4RM3 A;  1MD0 A;  3I53 A;  2HXI A;  4PCQ A;  4LIV A;  3O8G A;  4RAY A;  3S32 A;  1ORK A;  2W84 A;  3WTW C;  2FEZ A;  2G7U A;  2LY2 A;  3FXQ A;  2CRG A;  4I09 A;  4ZC3 A;  2QSG X;  2KIS A;  3PM1 A;  1CF7 A;  3P9K A;  4ZH4 F;  2KLO A;  2R5Y A;  3HKZ A;  3H3Z A;  3GO5 A;  3DEU A;  3BTC A;  5JI6 A;  1IW7 F;  1LVK A;  4LLG F;  1A6Q A;  3J80 K;  3JRH A;  1WZ2 A;  2FNP A;  4QPO A;  3WU1 B;  1LDK B;  2CFO A;  1CF7 B;  2LP0 A;  2GQQ A;  2MGQ A;  2X6O A;  2K7L A;  2WAQ N;  2DQL A;  2DFH A;  3MWM A;  2QF7 A;  5AON A;  1ZK8 A;  1IN7 A;  2P7V B;  5E8G A;  1K61 A;  2JT1 A;  1G3W A;  1SMT A;  1UHW A;  3H92 A;  4PJ0 C;  1E3O C;  1F1Z A;  2DJI A;  4L9J A;  3VFZ A;  1JT6 A;  2J5P A;  1ETO A;  3OOP A;  3G3Z A;  2KFD A;  3FDY A;  4XLP F;  2M34 A;  1HXD A;  1TTY A;  1U3E M;  2IPQ X;  3I5U A;  3J7A O;  4WCG A;  1MMG A;  4RMN A;  3HHG A;  1LFB A;  3AG4 H;  1IJW C;  5E3L A;  2P81 A;  3WU0 A;  1U2W A;  3HGY A;  2ECC A;  2YSR A;  1FY7 A;  3HGG A;  5B66 C;  2N8G A;  5GAD J;  4BY7 J;  4IOC F;  2ELJ A;  1XGN A;  3PL8 A;  3F8N A;  4LIU A;  1SEU A;  1WWX A;  4UVB A;  4XID A;  5CVR A;  4QSH A;  3JRI A;  1D0Z A;  4E7L A;  1K7A A;  3A01 A;  2L2O A;  1K4T A;  3OYB A;  2COB A;  1R36 A;  1IN4 A;  5DUI A;  2ID6 A;  1P9Q C;  4HQE A;  2OPT A;  4ON0 A;  1Y39 A;  3ROU A;  2OUM A;  1ZN2 A;  4KIF A;  4HSR A;  2HVS A;  2O6G E;  2G0E A;  4X0G A;  1Z0X A;  3ERE D;  1DGR M;  1TT0 A;  3KE2 A;  3ONQ A;  3RQI A;  2XF7 A;  2PMU A;  3QAH A;  4IRG A;  3SZP A;  5FKK A;  1N25 A;  5DCF A;  3QYF A;  2HPI A;  3L1P A;  4UY8 I;  3ABK H;  4FE4 A;  1S72 I;  3R4K A;  4J00 A;  3S2D J;  2KZV A;  3RI4 A;  2MLG A;  1HOM A;  2AQE A;  1I5Z A;  4M6Y A;  2ADU A;  2VIX A;  3PFI A;  4QIW N;  1WFX A;  3KP7 A;  2GXA A;  2NVQ J;  2LBF B;  2DW4 A;  2VLA A;  1KU7 A;  1UZC A;  5HDN A;  5ED4 A;  1O7L A;  1Z6R A;  4BAY A;  3S3M A;  1GVJ A;  3HXL A;  1G3Y A;  1HCR A;  1V5E A;  5HNF A;  1MBG A;  3LA3 A;  4UB6 C;  4LLN A;  4A3B J;  1WQ2 A;  5FKO A;  5K7H A;  1TC3 C;  3B73 A;  4GGG A;  3CP8 A;  3LFK A;  4CIC A;  1H0M A;  3S1M J;  1DGW Y;  1T6S A;  2PMH A;  3ZMV A;  4M9X A;  4F92 B;  2QKM B;  2V9K A;  2DQR A;  2W24 A;  3S3N A;  3HPG A;  3HRS A;  2BY0 A;  2R7W A;  2CW0 F;  3LQQ A;  2JWT A;  5LHH A;  1Z9C A;  1W4M A;  1SFU A;  3KP4 A;  1ZRD A;  3HOY J;  4A3M J;  3F0C A;  2ME6 A;  4YIR X;  1ACI A;  1IXR C;  4OWR B;  3TED A;  3L2V A;  1SMY F;  2M0M A;  2R0Q C;  4IQ4 A;  4MLO A;  3IL2 A;  1S7O A;  2RV8 A;  2MW8 A;  3LL7 A;  2BXY A;  3EYI A;  3K2Z A;  1FYM A;  3O6B B;  3BPV A;  4LD5 A;  1JJ8 C;  4CCO A;  4UUS A;  2RN7 A;  3ZXS A;  2BZT A;  1FYK A;  5JVG F;  4JX4 A;  5KAF C;  4MTD A;  3MZH A;  1BA5 A;  4J19 A;  2MH9 A;  2L4M A;  1OFC X;  1DUX C;  4XSX F;  1ZRC A;  4KNY A;  2XRN A;  2QUF A;  2CUZ A;  2EIJ H;  4NNJ A;  4UUT A;  2IGN A;  3TO6 A;  5CVJ A;  2VXZ A;  1IXC A;  5GTI C;  1Z1D A;  2ID3 A;  3L2W A;  1YS7 A;  2E35 A;  3BR5 A;  3GFM A;  2FMY A;  1D8K A;  1FSE A;  2HTS A;  5D6F A;  4LG0 A;  3RSN A;  1VQN I;  1Z77 A;  1XPX A;  4V19 K;  2JQ7 A;  1XGO A;  3GTO J;  2DMU A;  2ZFW A;  3GFI A;  1REP C;  3DCF A;  1JHF A;  1V54 H;  4HAM A;  3QOP A;  3ELK A;  3ZOB A;  4NC8 A;  4XKV A;  2JA7 J;  1TT5 B;  4LB6 B;  1BI0 A;  2YU3 A;  2OBP A;  4KT5 C;  3EET A;  4H0E A;  3G1O A;  1MBH A;  1QRY A;  2L3D A;  4F93 B;  3F9K A;  2OQR A;  3OYA A;  4KDP A;  1JKO C;  2PN6 A;  3F8M A;  3D5S C;  3R6S A;  2ZJP F;  1X1D A;  2KQR A;  1BC7 C;  4FIS A;  2Z2S B;  2XDV A;  3WG9 A;  4EMS A;  3M4O J;  4O3M A;  3P7N A;  4KFC A;  3GTL J;  4Q48 A;  3SZG A;  4ETS A;  1W0T A;  2PFB A;  1VI0 A;  1GXQ A;  2FA5 A;  2NRA C;  1RR8 C;  2LR8 A;  3RCO A;  4G6T B;  1PUF B;  2PMZ A;  2HOT A;  2XAU A;  2L9S A;  3I59 A;  2P6S A;  1X1A A;  1ITY A;  4DYR A;  4EGZ A;  1U8B A;  4NHJ A;  4LK0 F;  4W97 A;  4FCY A;  3PNT A;  4N4N B;  3ASN H;  1ZHF A;  1SC7 A;  1R5G A;  2M87 A;  3ZMZ A;  1BR2 A;  4FX4 A;  1YRN B;  5IYD J;  3CLQ A;  1XMX A;  3LSI A;  3WHC A;  5KNL A;  1ULY A;  2LH9 A;  2NS0 A;  2FQ4 A;  5B1A H;  4EJV A;  2YU9 J;  3B6C A;  1R5I D;  1T38 A;  1STZ A;  4PSX A;  2DT6 A;  3PJR A;  2HDC A;  5GPC A;  4WXH A;  2K85 A;  1ENH A;  2DFE A;  3L9F A;  2D2W A;  2WY8 Q;  2DT7 B;  5EZG A;  2JMW A;  3VOE A;  2QA4 I;  2NS7 A;  2XPW A;  1JJ6 C;  3ECH A; 
#chains in the Genus database with same CATH homology
 3G4S I;  3I56 I;  1YIJ I;  3CC7 I;  2NXN B;  3PIO F;  5GAD J;  2E34 A;  1VQ7 I;  3CCR I;  4IOC F;  4IOA F;  3CCQ I;  3CCU I;  3CCL I;  1ACI A;  1YJN I;  4V19 K;  5DM7 F;  1FOY A;  3J7Z I;  1FOW A;  3CD6 I;  1HC8 A;  2OTJ I;  1VQL I;  2E35 A;  3G6E I;  5GAG J;  3CCM I;  4UY8 I;  1S72 I;  1VQN I;  3G71 I;  2ZJP F;  3CJT B;  1VQ4 I;  5GAH J;  5GAE J;  3CCE I;  2JQ7 A;  3DLL F;  3CC2 I;  1VQO I;  2OTL I;  3I55 I;  1QA6 A;  1VQ6 I;  1Y39 A;  1MMS A;  2K3F A;  1VQM I;  1YHQ I;  1VQ5 I;  2E36 A;  2ZJR F;  3CMA I;  3J7Y J;  3CME I;  3CCJ I;  3CCS I;  4IO9 F;  1VQP I;  3CF5 F;  1YI2 I;  3CCV I;  5JVG F;  1YJ9 I;  1VQK I;  1YJW I;  3CC4 I;  1FOX A;  1YIT I;  2QEX I;  2H8W A;  2ZJQ F;  2QA4 I;  1VQ9 I;  3PIP F;  5DM6 F;  2FOW A;  1VQ8 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...