3CCQI

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 8
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3ccqI00
5DM7F 3CCRI 3CD6I 1MMSA 3G71I 3CCQI 3G6EI 1VQMI 1VQ8I 2JQ7A 4UY8I 1S72I 4V19K 3I56I 3DLLF 1VQOI 3CCVI 2QA4I 3CCEI 1YI2I 2OTJI 3J7YJ 2E36A 4IO9F 1VQKI 1Y39A 3PIPF 3PIOF 3J7ZI 4IOCF 5JVGF 2NXNB 1FOWA 2ZJRF 3CCLI 5GAGJ 3CCSI 1VQPI 1YJNI 1QA6A 1VQ4I 3CCMI 2QEXI 2ZJQF 2E34A 3CJTB 3CCJI 2K3FA 1VQ9I 5DM6F 3G4SI 1VQLI 1ACIA 2ZJPF 1VQ5I 1YJWI 1VQ6I 1FOXA 1YITI 2OTLI 3CCUI 1YHQI 5GAEJ 1YJ9I 2FOWA 4IOAF 3CC7I 1HC8A 5GADJ 3CMAI 1VQ7I 3CC2I 2H8WA 3CC4I 3CMEI 1FOYA 3CF5F 2E35A 5GAHJ 1VQNI 3I55I 1YIJI
chains in the Genus database with same CATH superfamily
4S05A 5L3EA 3CCQI 1X19A 4AVPA 3ESWB 2LG4A 5J47A 2VQGA 1ON2A 3FMQA 1K6OA 1V54H 2JA6J 2IS1A 3E0JB 1WQ2A 3KZZA 3HRMA 3LSJA 4W97A 2UXXA 3FK7A 4ZYEA 3MWMA 2QSFX 1ITYA 4AUXA 1SAXA 1KYWA 3Q0VA 1GDTA 2OTLI 1TQMA 2DA7A 2MSYA 5LGTA 4PGHA 4X6AJ 2IGOA 3L2CA 2NVYJ 4I98B 4YFKF 3SDBA 2L0KA 5DEQA 1VQMI 1BJZA 2X1CA 4G8XA 4ASNA 4NDLA 4CYCA 3TW6A 2E36A 3ZQ7A 3P9CA 3FZVA 3F8MA 4DNCA 3N97A 3VDXA 4L5JA 5F1RA 3HB9A 2O0YA 3RZOJ 3MEXA 3S2DJ 3M4OJ 5HDNA 4NC8A 4ZYDA 2E60A 5CVVA 3OYFA 4F93B 4I6ZA 4YFXF 3W6VA 4RM2A 1OLTA 2LF7A 1VQ8I 4U7DA 2OJED 1RKTA 3LQQA 1BC7C 1WJAA 2P7VB 3K1PA 4KT5C 3F72A 1TW3A 1WH7A 3ABTA 3OOUA 2BV6A 2GLOA 4CICA 5LGUA 1KU7A 4MTDA 3GCMA 4B48A 3BTJA 4M74A 3GTLJ 2K9MA 3OS0A 1P7IA 5ILSA 2JA7J 3DKXA 3ELKA 4IOAF 1VQ7I 1BA5A 5HS9A 1BBYA 3IWFA 2HDWA 1HKTA 2VI6A 1O3SA 2DYRH 1IXCA 2R92J 2WADA 3F6OA 2VIXA 2XHKA 4BDYA 2HPMA 4ANJA 2FQ4A 1D8KA 3C18A 3ECOA 4Y3OA 4XLNF 4UHTA 4A6DA 3H92A 2ZJQF 2DMUA 2XAUA 2G7UA 2KRFA 5J3LA 2HYJA 2VJIA 4A3CJ 4B8XA 5E3MA 2HYGD 3QOEA 2JPBA 1WPKA 4EQQA 4MFDA 2IT0A 1G2HA 3JTGA 2P7CB 3ZQHA 3RKXA 3HPHA 4F55A 4ENKA 1DPUA 4D0PA 1U3EM 1ETYA 4CSWA 1B59A 3HKZN 2E71A 2YR2A 2FJ1A 2X6YA 4UB8C 3K1NA 2QQ8A 2ZXHA 3V8JA 2M7AA 3G1MA 1X1DA 1TQPA 1KQ9A 1I27A 2E34A 2ZCWA 4FE7A 1X3ZB 2AXLA 2V9PA 5TGTA 2BHZA 4EM0B 4DYQA 3S2HJ 1IDZA 2D45A 5CVUA 1HBXG 4QPOA 5F0FA 4C9YA 1X1PA 1SD6A 2ZNYA 5E17F 4YELA 2JJ7A 2I5UA 3DKWA 1AA7A 3I58A 5IYBJ 4LB6B 2G9WA 2XGXA 3GW2A 2X1EA 1HLVA 4RS8A 1SANA 2V9VA 4Y17A 4LD5A 1ONVA 1F43A 1Z77A 5CJ9A 2WB1N 1YJNI 3HTSB 1BJAA 3T8TA 2FU4A 1ZRFA 3ZOBA 3S14J 3Q0UA 2WAFA 4AYBN 3O3KA 3NARA 3BQYA 3WGHA 4FX0A 3FDYA 1SAUA 1MMDA 5TJJA 3RTRA 3WTSC 4HYEA 3A4CA 3K0LA 4HOBA 1JJ6C 3RZDJ 3ISPA 3A01A 4MNUA 3ZCOA 2ZXJA 2DXIA 1HA8A 2RN7A 3VWBA 3JRGA 2A6HF 3I56I 4P96A 3OIPA 1STZA 3BPVA 2XRLA 3CCMI 1K78A 2E1MB 4M6XA 1WGXA 5EF6A 1VQ9I 1WJCA 2LOOA 3TP0A 3E3VA 3LSGA 3TDUC 2GZWA 2R3SA 3ULQB 4Q4ZF 4F7ZA 5BS6A 2X0LA 4DOZA 2YS9A 3M3YJ 5J4VA 3R0AA 2XROA 1MMNA 2R7ZJ 2DMNA 3EUKL 2GWRA 3FXMA 3D1NI 3WU2C 1XSDA 1FYKA 4G6TB 1TP4A 3L9FA 3PSFA 4UVAA 3FX3A 4E7ZA 5E1WA 3QODA 4BQQA 3Q9SA 2XUBA 1IGNA 2K3FA 3TOBA 3DWLE 3HHGA 3K70C 1A5JA 5KK1A 2WAEA 2FNAA 2NAZA 2LK2A 3ERED 2CSOA 2E19A 2VN2A 3GZ5A 1FEXA 3HOZJ 1GHCA 3D5SC 3DBRB 5AIPA 1ENHA 2WC2A 2CQXA 3PL8A 4MFEA 4YFNF 1O7FA 1TNTA 4PCQA 1OCPA 4PJ0C 2ZJRF 2BHYA 1UG0A 2EZIA 3DV8A 2R0QC 4XLPF 4V2FA 2FRHA 1FIPA 3S1MJ 4ENMA 2EIKH 4YIRX 4HNTA 5L3BA 2CYYA 2D2WA 3E6DA 5DCMA 4N4OB 3ZQLA 4KIFA 3HGGA 2EB7A 3K4LA 2E2HJ 4HBLA 2PBIA 2WBMA 3KP2A 4F92B 2STWA 1G3WA 2WV1A 4RA2A 1XGMA 4XSXF 2LRDA 2BZTA 5E3LA 3W6KB 5K5QA 2E1MC 2ZBKA 3ZQFA 3PIPF 3SJMA 2EH3A 2I10A 2HVRA 3AG2H 1Y56A 2DA4A 4NQWA 3QPLA 3I64A 3GTMJ 3H5RA 2TRTA 1G3SA 2MD5A 3IC7A 4UB6C 4FASD 4U7BA 5BPIA 2K86A 1O3QA 3BG6A 3GLXA 2CUFA 2IRFG 4FHTA 2XAGA 2BXZA 3OMYA 2LREA 3R4KA 1SFKA 4HZFA 2XF6A 1R5HA 5DM7F 1LE8B 4RGXA 3HOVJ 1UHMA 2CU7A 3KCCA 3ZXSA 2NYXA 3EETA 4IO9F 3PIOF 3QU3A 2ACJA 4HW0A 2VJ4A 1OISA 1W5TA 4RAFA 5FFXA 1F36A 3PSIA 5EDNA 3T5XA 2GOXB 2LTPA 1FP1D 1FSHA 3OYHA 4A3GJ 1IN4A 3FBNB 3Q3SA 1UFMA 2YPRA 3L00A 4MGRA 2R7VA 4L9VA 3BG5A 3CMEI 3CDLA 1N75A 5B66C 2KDZA 1L3LA 4M3BA 3S93A 1D8JA 2Y30A 4GGGA 3CCVI 2ZXWH 3IRQA 3U2RA 2F4MB 2KFDA 2QCOA 2H8RA 4C30A 1LE8A 4HX7A 4XR6A 2RDPA 2PN6A 5E18F 4OIOF 1EKEA 3FXQA 4PFPA 2WTEA 4KA4A 1OQYA 1KU2A 4EM1A 1Z9CA 3PJRA 2Q2EB 4HRIA 3J7AY 1YLFA 3TQNA 3S1RJ 3RQIA 3FHZA 3S3OA 2XKOA 3KP5A 4C3IJ 2HZTA 2JRTA 2R4GA 3S2WA 1XMXA 4ZZLA 3OYAA 3VYTB 2QF7A 4MQ9F 2KJBA 3O8HA 2M4KA 1R58A 3O8GA 5EYRA 1XGNA 2QKLB 1G3YA 1QGPA 1ZGWA 3T0YA 4KJZA 2R7SA 2CJJA 3PUFA 3MZHA 1VQLI 1S7EA 2G7HA 2HFHA 2BXYA 3LQRA 1TLHB 4Y7NJ 3MAJA 2JN6A 3S32A 2A3SA 1R4NB 1WCMJ 5J40A 3M07A 1ZG1A 2HEOA 1FTZA 4AIJA 3L2UA 1OJLA 2MLKA 3WTYC 1GUUA 1GVDA 1ZYRF 1X58A 2H6BA 2EFOA 3DTIA 4BL0B 3OR2C 3TMOA 4BU2A 1BIAA 1U78A 4KFCA 4QIWN 2X6OA 3AG4H 4BYYA 5IT3A 1A35A 3M1EA 4QWQA 1R7JA 2VC1A 4XOPA 2B0LA 4GFBA 3I4PA 1R9TJ 4DGWB 3LNQA 2HXIA 5FGMA 1OYIA 2MC3A 5D4SA 1ERDA 3VSKA 2IGNA 5L3GA 5F08A 3MKZA 1IRGA 1HSJA 2R7FA 2O03A 4XLEA 2Y0SA 1FBUA 1F4KA 2R7DA 3E6CC 1K6YA 4CCNA 2Z9OA 4FT8A 2K85A 2CW0F 5CQGA 1ZELA 4D5FA 2IGKA 1VQNI 2CUZA 1FOKA 2EV6A 1FSEA 1BM9A 4E7HA 2UUZA 1A04A 2DA5A 4C2TA 4UY8I 3KZYA 2LSOA 5GPCA 2EILH 2Y31A 2QQBA 4Y15A 1M1EB 5HODA 4N0BA 3LOCA 4OMZA 4EGYA 4R8HA 4BY7J 2DA3A 3ZGKA 2QKMB 3CCJI 2X6XA 1WH5A 3PNTA 4V2GA 2IBDA 1J75A 5F6FA 3L2WA 3QQAA 4WK8F 2DU9A 3CLOA 2XB5A 3JR9A 3BJ6A 5FROA 3A2KA 2L2OA 5IP6A 4OWRB 2DK5A 3FHNA 3IHUA 4EJOA 3JRFA 1ZQ3P 4GDFA 2X6WA 1FBQA 2XRNA 5ICCA 2PQ8A 5LHIA 3BCBA 1G8XA 3LA7A 4IHYA 5E8IA 3EUHC 2R7TA 2ISYA 1R36A 3TGNA 3B73A 2FMLA 3TO6A 2QYOA 2RREA 4IRIA 3WE2A 4A3FJ 5HS7A 1ETXA 2CMPA 1BIBA 4M6YA 5DD8A 3MKWB 2A68F 2K02A 3AFHA 3NAUA 4XORA 4D9JA 2JVHA 3DQVC 2WY7Q 1XS9A 2E5ZA 5EGOB 1KA8A 4EJUA 5EG0A 3EQLF 1Z3YA 1A6IA 2LY1A 2XPVA 1H89C 2FOKA 5M3MJ 2HU9A 4MEXF 1REPC 2V4JC 4FX4A 4IQJA 5FKOA 2LF8A 1R23A 3R6SA 4ZYGA 2FEZA 5EEGA 2NRAC 5DCFA 5E1XA 4B09A 1JJ8C 3BTCA 3VEPA 4BXFA 1FIAA 4P1WA 5CKTA 3G1LA 5J1RA 4A12A 2K9NA 4IF4A 1IO2A 1U8BA 2MC4A 3ERMA 5FO5A 4LG0A 3A03A 1WVRA 1SC7A 1R71A 1FYLA 2MGQA 2RQPA 4CGZA 5D6EA 1Y8QB 2V1XA 1K78B 2O9LA 1OPCA 2YX4A 4HQMA 4BEHB 2QENA 5LHHA 4CCJA 2VXZA 2VJ5A 3CP8A 3HOXJ 3TOAA 4A93J 3CC7I 3H3VK 1Z3XA 1ZG3A 3O6BB 2A05A 4IHSA 5LEKA 4DIQA 2H1KA 4JX5A 3HGYA 9ANTA 2W1OA 2E5NA 1J7KA 3KP7A 2JA2A 4M73A 4M71A 2NVTJ 4RAYA 5ICFA 4XRSA 3KEYA 4P9FA 2DT5A 1T0FC 3BTIA 1W0TA 2CW8A 1IW7F 1ZK8A 1EH8A 2R7UA 3T1BA 3BP8A 1Z1DA 4GO1A 1V3FA 3PM1A 4XOTA 3WHCA 4G12A 2TCTA 2EA2A 5FD6A 3I4MJ 1A6QA 1E3PA 2O3FA 1I39A 4RB3C 1MKMA 5HVQC 3GFIA 3IKVA 4WXHA 2VOOA 1D1BA 1SD4A 2QA4I 1MNDA 2DT6A 2JTVA 3K4NA 3KYLA 1PYVA 1KGSA 2W24A 3ZQIA 4I02A 3T8RA 5F1JA 1Y1WJ 2ISZA 2V1DA 3EDPA 5BQTA 1X4PA 2H09A 1QVTA 5K7FA 2WAQN 3OV8A 1XCBA 1Z0XA 3FM3A 4XK4A 3ZQQA 5GAEJ 1JHFA 1JGGA 3OY9A 1G59A 1EF4A 1S8NA 2AQFA 3H1CA 1X1BA 1MJBA 2P6SA 1MZBA 4XIDA 1Q1HA 2JVGA 1ZRCA 2X85A 3K10A 1WWXA 2RKHA 1T8IA 2IAIA 3SHFA 2PX9A 3OYMA 1WI9A 1APLC 2ZMEA 3MZ8A 1R5GA 5J4YA 4NC7A 2D1VA 2CO5A 1MSEC 2VBWA 4HNVA 2XIGA 1LFBA 1P6RA 3E1SA 1I1GA 2MBFA 5IOZA 4RGRA 3IAM2 3LSIA 1YE9A 3BOQA 2HKXA 4CCMA 3K6GA 1RKWA 4XBFA 1XDUA 3ZMTA 2DTRA 2VBXA 5FKMA 4O6JA 4U0VA 4BBSJ 2ELJA 1V5EA 2EZKA 2ID3A 1HDDC 1UELB 1CF7A 4BHCA 3K69A 2FBIA 4II3A 3SEQA 4DJAA 5K7ZA 2DA1A 2WAQA 4YIIA 1QHGA 4AU7A 3HRUA 2H27A 4Y33A 2RNJA 5FLVA 1WJDA 2BY0A 1IRFA 1S9HA 4HQEA 1LFUP 1MJAA 2WWYA 1QQIA 4BQOA 3W2VA 3RKQA 4J19A 2A61A 4HV6A 1IV6A 2EINH 1JI8A 2LKPA 4GCVA 3FWEA 4FTHA 3CD6I 1XX5A 5D5VB 5K5RA 1ETWA 4IZZA 3LSMA 1S5LC 3BCAA 3CF2A 3DPLC 1X2NA 1OCOH 1I3QJ 1HF0A 1IRXA 1IN6A 2PG4A 3BC8A 4A3IJ 3MZYA 2H6CA 5IPAA 1YTYA 2MLGA 3E6BA 1FOXA 3DFGA 4LB5A 3UNGC 3H3UA 3KLNA 4XSZF 1BOAA 3ZMZA 4IHWA 1JXSA 2MG4A 1TT0A 1R1TA 3AKZA 1SFOJ 5B1BH 5L3DA 1BC8C 2P5KA 3WTZA 4IPAA 2HQNA 3I53A 3FXLA 4BHBA 4BACA 1D0XA 3OL3A 5D4RA 2QBYA 2DAOA 1XSXA 1E3HA 2LLKA 2M3AA 2ME6A 2WY8Q 2IP2A 2VKEA 4PDKA 4EM2A 3M9AA 3L2VA 4HF2A 5FKLA 2QZ8A 2KISA 1IJWC 2R7QA 4G7HF 1JT6A 1O3TA 5J8FA 1USTA 4IL6C 1YHQI 5CLSA 2OZ6A 2DFEA 2UZKA 1X3UA 2M8EA 3CJRB 4KITB 1N77A 4NNJA 2HOTA 4XLFA 5EZGA 1JUSA 4L5EA 1MDMA 4BHPA 1B1BA 2OAZA 2O6GE 2OUMA 4IOCF 1U5TC 3BZCA 2W85A 2YU9J 4KMUX 4OIRF 5FRNA 3BG7A 4KN7X 1T33A 3U21A 1ZG5A 1FBSA 3E6MA 3SQNA 4CZZA 1BN5A 1YS6A 3B02A 2ETHA 4IRHA 3PQJA 2LBFA 2MABA 1R00A 1K79A 3K1MA 1XMKA 3KYCB 3AAFA 3JAMK 5GADJ 2PJPA 3KX2A 1NTCA 5K7HA 1RUOA 1GV2A 5GPAA 4S0HB 4U87A 3IKTA 1KU3A 2A5WA 3LA2A 3HM5A 4II2A 4G7OF 1FPQA 1X1CA 4CUGA 2KIQA 4EJVA 2W82A 2WA0A 1QZZA 1X4OA 3F8NA 3Q9VA 4HLYA 4A6EA 3FM5A 1S7AA 1ZRDA 1JTYA 3S8PA 4IX7A 2PMZA 5IP9J 4UV8A 1BW6A 4XKCA 3ZRGA 1D3YA 2VUMJ 2HKOA 5FKNA 1GLNA 4OU0A 2K4BA 1R1VA 1RZ4A 3DLLF 1FYMA 3DEEA 3CTAA 2X9DA 3GTGJ 3IL2A 4BQNA 4I0BA 2DMPA 4C3HJ 1VF9A 1FY7A 1ZR2A 1T38A 2CUEA 4EV0A 3AL0C 2DFHA 1FT9A 2FD5A 2K4JA 5JLXA 4XLCA 3FKJA 2KHMA 2ME0A 2DCEA 1O4XA 5A2QZ 6PAXA 3S3MA 4R79A 1VQ6I 2CH0A 3L2RA 3SEZA 4KT6A 3PO3J 3VFZA 2FBHA 3J81K 2GQQA 3JAMZ 1WJFA 4I2OA 2HWVA 4HG2A 5EGOA 1QRYA 1BI3A 2P0WA 2AO9A 3TBIA 2Z3YA 1WFXA 3MN2A 4P55A 3EYIA 3B6CA 4ZZDA 2RC4A 4D5CA 1U9NA 1H9TA 5IOYA 2E7WA 1IV8A 3EUAA 4LLLA 3V7SA 2ECBA 2KP6A 3C3WA 3BR2A 4HPQA 2DPDA 2ZJPF 5LEJA 4B3XA 1K7AA 1G3TA 1YQAA 2XSJC 3CCUI 2KZVA 2IS2A 2O61A 1YX3A 2O7OA 1LB2A 3LWFA 5FB2A 2E1CA 1GXQA 3LFUA 3QYEA 1MBFA 4GYGA 5HNFA 4XMYA 4UVCA 3GX4X 1ODDA 1U0JA 5D8KB 3ROUA 1IAWA 2LY9A 1EH7A 2M0MA 3KP4A 1HW5A 2A69F 3VSLA 1J2XA 3GBGA 3OYEA 4BEHA 4WXDA 1OCZH 3E5UA 4G6DA 2OBPA 2VKVA 2HQRA 1MBGA 4J01A 1V5GA 2OV7A 3IP4B 3QOPA 5EJCA 4JP0A 4J00A 4E4HA 5BPDA 1IC8A 1HW2A 2EIJH 5D5UB 2XF7A 1P4XA 2BY2A 1S72I 4PZJA 3M8JA 4XN3A 2XSDC 3PO2J 2MYSA 4JYKA 3CCLI 3KETA 1FTTA 1RI7A 1EV7A 2K7LA 4RGSA 4CHUA 5F0HA 4OIQF 3CDIA 4MQVA 1L0OC 5JI6A 1AOYA 1ETKA 4RAZA 1B4AA 3RKYA 1HC8A 3OYCA 1WSUA 5M5WJ 3E7LA 4I7HA 2QSHX 2IVMA 3VOEA 5J8CA 3K4CA 1YRNB 1E17A 3OIOA 2HOAA 2JWTA 2NS8A 5FRMA 3RIRA 4IKFA 4HEA2 4NQWB 1RUNA 3KEQA 4AIKA 3ZPLA 4HDVA 1KU9A 4RDUA 2BVLA 3I59A 2ZNZA 1A36A 2FA5A 4I09A 3JSPA 5D5XB 4E7KA 1HKQA 4BXUA 1VI0A 1KQ8A 1ZLJA 1I50J 3RKWA 3KLOA 4AIDA 4WXCA 4AIHA 2EBIA 2GA1A 2EPFA 2FMYA 4TV7A 3WTTC 1ZGJA 2HVSA 2VBYA 2X4HA 3ZQCA 1MBKA 1UB9A 2QVOA 3UKGA 3M7GA 1I6HJ 4KUMA 2JT1A 4M3EA 1D5YA 4KISA 2P4WA 3BR1A 4DBRA 2HQAA 4BS9A 1LPQA 1B6AA 3PFYA 4M9ZA 3V8LA 4HDUA 2JRMA 1D5VA 3RPQA 1MBJA 3ASOH 2LC2A 1FC3A 1UCRA 1ZGAA 3JRHA 2HPIA 1OYWA 2VB6A 4I76A 1LFPA 2VLAA 5FD5A 2DMQA 2DPUA 3RPUA 1B9MA 2WV0A 2OF7A 3KZIC 2XGCA 3HPGA 1Q1VA 1X2MA 2FUG2 4ETSA 1DP3A 5L3FA 2MA3A 2BE5F 2JSCA 5KNLA 1JE8A 1HCRA 2XPWA 4L9NA 5B5EC 4Z2YA 3OYLA 4ESBA 2YSRA 2L3DA 2MFZA 4D1QA 2KPMA 1FWZA 3GLLA 4UUSB 3WU0A 3LAPA 1F9NA 1TL8A 3M1CA 1TQIA 5DDGA 3BR6A 3NEUA 2DQLA 4KMFA 3W6JB 3C1DA 1B72A 1GT0C 2VODA 1YW9A 1AKHB 2E7XA 3LMMA 2DK8A 3CUQB 1QZEA 5K1YA 5LGNA 1BL0A 1PVEA 5ICEA 4E7IA 3S3NA 3PUBA 4PSXA 2KDOA 2E2IJ 2KIMA 1R1UA 2M34A 2PJRA 2R93J 3EUHA 3JRDA 3QPHA 2E1OA 2QQAA 3LSTA 3BJOA 3ABKH 3RDIA 5BNGA 1G6NA 3D5RC 2M2EA 1MW7A 4ZJZA 1HXDA 2ZFUA 4XLAA 5LLQA 4DYRA 5F64A 4DYCA 2MW8A 3R60A 4HF1A 2DLLA 2BW3A 4EJWA 4H0EA 2IA1A 4AC0A 3QPTA 3IH3A 3VYSB 1G4DA 4BY1J 1XMAA 3I9V2 4LOCA 2A6TA 3GF2A 4PSWA 2QBYB 2AHQA 4IHVA 4RBOA 1XDSA 1MNEA 2EK5A 1ZN2A 3FISA 4LGWA 2BOLA 4AD9A 2HOEA 4HF0A 4XN0A 2Y48A 5HOOA 4NB5A 4E7SA 4KYWA 1MBEA 1QPIA 5M5YJ 4JX4A 2QSGX 2LR8A 1W1WE 3H5NA 2STTA 2ESNA 1ON1A 3GUDA 5KAFC 3VODA 4B47A 5D8LB 3I0TA 2F4OB 3GXOA 2N8GA 3K4KA 1MDMB 5D6FA 4B3AA 2BW3B 3KEOA 2EZHA 2VONA 2VE8A 4E7JA 3BT9A 2EIMH 3RSNA 5FLXK 3Q5FA 4LIVA 1T08B 3SYTA 3HL2A 1B8IA 3DXJF 4Q47A 2JSPA 2MH9A 1N25A 2L4MA 5EZHA 2DODA 3DLAA 1R6RA 2IA2A 3WTUC 2DOEA 2E35A 3RYRA 1TWHJ 3S16J 2K40A 1T39A 3PNYA 3HOUJ 1F1ZA 2W84A 5HLHA 1YFHA 3SZGA 2CG4A 3QAHA 5GTHC 3HBLA 1SVOA 1LUJB 2DJIA 1SD7A 2LD5A 2MH2A 1R5ID 5M3FJ 4BAYA 2EFNA 2DBBA 2LY2A 1JTXA 2CGPA 3ZP5A 1MMAA 1YW7A 1OCCH 1DQUA 4OINF 4YG2F 1UZCA 2QWWA 1B8IB 1J09A 1EH6A 1B9NA 1I1SA 4A5NA 3NQOA 3W2AA 2P6TA 4HNUA 4I01A 3L1PA 1S6LA 2DFFA 4WX9A 1LVKA 4BKXA 3OIQA 2CV0A 5DS9A 3ZMVA 2V1NA 2V7FA 2R7OA 3ABMH 1QA6A 3SZTA 3M8FA 3CUOA 3WHBA 3F8BA 3K2AA 4UUTA 3P9KA 4EATA 1VQ5I 2KJCA 2IXSA 2XKPA 3JRCA 2L9VA 4ZDLA 1RNLA 1U6GA 1DU6A 4ZDOA 1SMTA 3IV5A 4ITVA 1WI3A 5C44J 4BQAA 4MO7A 4O3MA 3ZMSA 1ETOA 3LSHA 2QUFA 4AM3A 1FMWA 3BR5A 2KT0A 3BZKA 1V5FA 2GA2A 3H5AA 2PMHA 3OYIA 3DKYA 1VQKI 4OAZA 4QLCU 2EA4A 3O2PE 5GAGJ 4AVZA 1W4MA 3MQ0A 5CVRA 2JPCA 1NK3P 1JT0A 2M4GA 4BE2A 3FIWA 4BUPA 2PEXA 2L7MP 3V7CA 1QVUA 1UHWA 1J59A 1S7OA 3FXJA 4B1RA 3TL4X 3RI4A 2HVQA 1WJ5A 3MFKA 1J0RA 2W7NA 4BXXJ 2GOMA 2OU2A 1AHDP 2DTZA 2CRGA 1U9OA 2DA2A 5CPRB 2D1HA 4B43A 4DZJA 1IF1A 3G71I 1MGTA 4KNYA 2Z33A 3NWSA 1NG7A 2L02A 4A2UA 2ID6A 1TZLA 3I4NJ 1V4RA 1JUMA 2EJRA 2BGCA 2Y75A 3SXYA 3HUGA 5IYCJ 3KYDB 1ACIA 4R1HA 5JHFA 3NRVA 3GFJA 4XONA 4A0YA 3HZJA 3HHHA 2ECCA 1RPWA 2L9SA 2ZO4A 4I0AA 1I6XA 4A3KJ 5E3NA 2PFBA 3F0CA 2CW7A 3F6VA 4YEJA 5F04A 3GFMA 4X1EA 1HKSA 2PMZN 3V42A 1HSTA 5IY5H 5DYMA 5GP9A 5LRSA 1F5TA 1NHAA 2F5EA 2UXNA 2GXAA 3ZN1A 3FXUA 3CDHA 2YX7A 2OD5A 5BMZA 5J1YA 2L9RA 3JRBA 2B9SA 3R0JA 2ZSHB 1PP8F 1SVLA 2X48A 1J5YA 1YX5A 3IAS2 3PQKA 1W36C 4PUSA 5DUKA 1LVAA 3G2BA 2F4IA 4Y4RA 5F27A 1XTAA 3GTQJ 3CQZJ 2JZYA 1D0ZA 2RAEA 4KICA 2FE3A 4RLQA 4L9JA 4NUBA 2VQLA 3HC7A 2VPRA 2ZMEB 3S17J 3MCZA 3HDDA 2CWEA 5HLGA 2LVSA 3F8FA 4YIFA 1VQPI 3K7AJ 4LG3A 2M0CA 1JUPA 1Z7UA 3OSFA 2LH9A 3MMYB 4CCLA 4LLGF 3HYIA 2EQRA 4IEJA 1O57A 4A3JJ 5DCMB 2K9SA 1V55H 3CF5F 4XRMA 3CCYA 1MMSA 3FKIJ 2HOSA 1CF7B 4WCGA 1X1AA 3TKYA 1RR8C 4RAGA 1FOWA 2Q2EA 2XDVA 3SFZA 4HA8A 3BLYA 4LMYA 2ZJ2A 1U5TA 3KP6A 3EYYA 2L9NA 3BY6A 3P9IA 1TT5B 3CJQB 1FX7A 2Y2ZA 3HG9A 3ZMDA 4CA0A 2AS5F 3KIOA 4HX4A 4A3LJ 2R5ZA 2QM3A 4M3GA 1RETA 4JOMA 4XM3A 5H6RA 1XSVA 1W5SA 3FMRA 4C2MJ 1HDPA 1H9GA 1T6SA 5LD2C 1TC3C 4UNOA 3D5LA 4BJ6C 3TDZC 4HV5A 2R7XA 2M30A 4O5VA 3ZN0A 2DJNA 1IXSB 1BR4A 1YOVB 3LSPA 1VQ4I 2RV8A 1XCVA 4IHXA 3L09A 1BR2A 3MD2A 4IQ4A 2NNYA 2L5QA 2VT3A 3LL7A 2ICWG 4LK1F 3S1NJ 1XGSA 4UUSA 2J5PA 3GEZA 3H3ZA 1U5TB 3OS2A 2DN0A 3KE2A 4JQFA 4CO8A 4NBQA 3RQ4A 4IHTA 3CP2A 1QHHD 2QQ9A 4L5IA 4S04A 2CQ7A 2OQRA 1UAAA 1MH4A 1JKRC 3AG1H 2R5ZB 5TRDA 3F3XA 4FE4A 2COMA 1TBXA 3OYNA 3I3LA 4G7ZF 2O8KA 5TISC 2Z2SB 3ABUA 3CUQA 4Q5SF 5DD4A 4XQFA 2OC6A 5C3EJ 1T2KA 2XGDA 4BH9A 1JHHA 3QU6A 4K2EA 2VC0A 3GTKJ 1K4TA 2W48A 3IUOA 4G9YA 3VYUB 2LNBA 3RCOA 2PLYA 2BY1A 2BY3A 4FCYA 3DTEA 5JLWA 5JHUA 1Z6RA 4Y52J 2KKOA 2V6CA 1GV5A 3UR3C 3J7ZI 3HOTA 3FXRA 3DBLB 4N9HA 2JA8J 2EZLA 4BJ5C 3BROA 1UJ8A 1W0UA 3S1QJ 3PNVA 3SZPA 4IRGA 3I5UA 1KZHA 2V26A 1PUFA 1RIOH 5LRRA 4M9XA 4X0GA 1QPMA 4AWXB 2CQQA 2LDUA 5H6QA 1VFCA 2AQEA 3OS1A 4EJTA 2JK3A 1CQTA 1T98A 2HDDA 4JK1X 2K27A 4RM3A 1LQ1A 1VNDA 2Z1DA 3CMMA 4XKWA 5KAIC 4PGGA 2NS7A 4ABZA 3K2ZA 3CO7C 4ENNA 1SEUA 2PMUA 3HOSA 3OWTA 4G94A 1FP2A 2GXGA 4V19K 1HOMA 2KLOA 3DU5A 5M5XJ 3BPXA 5ED4A 1PUEE 3RPUD 5B1AH 3JTHA 3DPTA 2IPQX 1IN7A 2F6CA 4Z6YA 3WTVC 1KYZA 1XB4A 3ASNH 2ZSIB 4Y13A 3G4SI 2R7RA 3DP7A 3GYHX 4HSRA 2DDBA 3RJPA 1I5ZA 4M3FA 3LSRA 4QPQA 2FOWA 2KIFA 1W7PA 4MIMA 3F23A 1PUFB 4XRFA 2OA4A 4M72A 3VYRB 2LKXA 3WGGA 2VBZA 3KFWX 4B4CA 5IT9K 3DEWA 4XKVA 3ZQGA 2DYSH 1XGOA 1LEBA 1BR1A 3FF5A 1NG6A 1ORKA 2GAUA 2L7ZA 1HQCA 1WJBA 4XLHA 2BYVE 4MHGA 2NVXJ 2ZC2A 4QTRA 1DUXC 4PJJA 2BEOA 4OOIA 1MBHA 3J80K 4XL9A 1XC5A 1FZPB 3H36A 3KP3A 2EV0A 2ZXIA 2V6EA 2F5DA 2CQKA 2HTSA 3QWLA 3CC4I 1FOYA 5CVJA 1DDNA 4A0XA 1UMQA 1MSFC 2UV1A 4YRVA 3I55I 4DQ2A 2RQQA 2FXAA 1W7PB 3H0GJ 4UXNA 1LKXA 2CV1A 3QPSA 1XPXA 2FQ3A 2HI3A 3BQZA 5HLIA 3H0DA 5JVGF 3K4BA 2XVCA 2XGEA 2M7BA 3CLQA 4XKBA 3F9KA 1R22A 3F22A 3G1OA 4P5OA 3P5JA 1T0FA 1H88C 2FF4A 1SFXA 4BE1A 1Y8RB 2W25A 4LLNA 2OQGA 1X3WB 4XNFA 1TNSA 1OFCX 3BWGA 4HLXA 3TW7A 1BI1A 1Y1VJ 1GVJA 4BE0A 4N9IA 4LITA 3G73A 4OIPF 1BI0A 3WG7H 3CC2I 2JUGA 3ML6A 1QU3A 2Y0SN 2DA6A 3DEUA 4CCKA 2DMTA 3A01B 4E6KG 2VKDA 3G6EI 2YUSA 2JQ7A 1A31A 4ON0A 2EFQA 2E1NA 3REOA 3JSOA 2NOJB 2NS0A 2M1BA 3CCSI 3M8EA 3FMSA 3GO5A 3OL4A 2QEXI 1DU0A 5EEHA 1D1CA 4ESJA 1K4SA 3E5XA 2GBYA 1LEAA 5DM6F 2H94A 4ZTJA 2HNHA 2XV4S 1IUYA 2V1UA 2OCEA 2M45A 5C4JJ 1S3JA 4CXFA 3QP5A 5H20A 2ADUA 2QGUA 5F0CA 4ZYHA 3COAC 2JUCA 4F91B 4QSHA 2F5VA 2Y69H 4N4NB 2VPLA 5GTIC 3AL0B 3ONQA 3CCEI 3CMYA 4JX6A 3WU1B 2HXOA 2NXNB 2RGVA 4LG0B 4WF2A 2KQRA 4U0YA 1XD7A 4L0ZB 3DCFA 3HKZA 3HRSA 2NNNA 1TWAJ 4LK0F 1RC9A 2XASA 3HUGB 3U1DA 1TWFJ 3WE3A 3C7JA 3V8KA 3F8CA 1TWCJ 2F5CA 1USSA 2P5VA 1RR7A 2GM4A 3FXKA 3HRTA 4BDZA 2JA5J 2Z5UA 2HQ5A 4PK4A 1K83J 2B7EA 4BJTA 1ETQA 2YU3A 3I59B 3P7NA 1H8AC 2I8DA 2ZKZA 2DW4A 5HLTA 3F21A 2XAHA 4E70A 4LJZF 3H9GA 3I71A 1WKMA 3LA3A 4ENJA 4KDPA 3GTPJ 4XICA 3ZMUA 3G3ZA 3CO6C 3Q0WA 1WJEA 3WTWC 4OMYA 4PJMA 1JKOC 3OYDA 1SFEA 2HR3A 5CYVA 2OPTA 1IXRC 5E1ZB 2ELHA 2KRHA 3LAJA 2P5LC 1Z6TA 1KONA 3SDGA 1IZ1A 2H1LA 3WTXC 3CESA 1R49A 1KQ0A 1P9QC 1S29A 4MLOA 3J7YJ 3KPHA 2Y9YA 2VL8A 2DO7A 1FNNA 3HJEA 5FKKA 2VT2A 3MVPA 1FMVA 1QO0D 3OYKA 2Q0OA 3A0BC 3HOWJ 2G0EA 4BNCA 3JCUC 3FK6A 1IG7A 3VB2A 1MIJA 4KN4X 2HDCA 1MD0A 3QYBA 5FLXZ 3C2HA 4RB1A 2GIZA 4DW6A 4P9UA 1YS7A 5IP7J 5KCMA 5DUIA 2A6EF 1PDNC 3S15J 4F52A 2HS5A 5B3SH 4KIBA 3OOPA 2MD0A 2W57A 3FBIB 2JMWA 3BZ6A 4L9TA 5CQEA 3TEDA 3OYGA 3QRFF 3B6AA 3HIFA 3PFIA 5EG0B 5EEAA 4MEYF 3BG9A 2NOGA 1RRJA 3ZR8X 1BI2A 1B72B 4FETA 5GAHJ 5IYDJ 1K61A 4FQGA 3HOYJ 4PJLA 2P8TA 4E7LA 1ZKGA 2RNGA 3JW4A 1UG2A 2VOPA 1UHSA 2VQHA 1DGRM 2E2JJ 3TO9A 3ABLH 1IN8A 3OSGA 4RLFA 1W5CC 2AXTC 2PJRB 2ELKA 3A0HC 2DT7B 1ZAOA 1FLIA 1IUFA 2Z99A 4ZYAA 3MKYB 2VQCA 4PFOA 3WGIA 3WODF 2W00A 3N05A 2A07F 1Y0NA 1YJ9I 2KMUA 3E97A 2M87A 2PI0A 1ZHFA 3L7WA 3LFKA 2L4AA 3HSRA 1YIJI 2WB1A 2FBKA 2QLZA 1MMGA 3X2QH 2KIUA 5ERIA 2OTJI 1OR7A 4OAYA 2F48A 4D7MA 4AYBA 2R5YA 4UV9A 2LFBA 2EFWA 5JFRA 4CYDA 3BG3A 1QBJA 1ETVA 3U1KA 2R7WA 1PP7U 3R61A 4F3QA 1JKQC 2K5CA 4I99C 1H0MA 1LJ9A 3GZNB 2L7FP 2EFPA 4CCOA 5CVIA 5LFAA 2DFIA 2IS6A 3A1YA 2BVMA 5D5WB 5JR3A 1LNWA 2GXBA 4NC6A 2XAJA 1LDKB 4C2UA 3E5QA 3IH2A 2HZDA 2HGCA 3JRIA 2F2EA 5J6XA 3C2BA 4A3BJ 1WHUA 3BJAA 2XAQA 3CCRI 1P2FA 1Y0UA 2X1DA 3A02A 1U8RA 1O7LA 2IW5A 2O8XA 1TWGJ 1MJ9A 2Z16A 3CJNA 4D7NA 1T95A 3EPZA 4Q48A 4JBAA 5IT9Z 5FJ8J 4IJAA 2R5YB 4GXOA 4MTEA 1IN5A 1SD5A 4FISA 1OR7C 4BBRJ 4EVIA 1ZTRA 2OZUA 3MKLA 1YG2A 2IJLA 2KL4A 2LMDA 3CMAI 1JKPC 2D5VA 2LP0A 2M5WA 1O3RA 4RMNA 4IVNA 5KVRA 2XF5A 2DI3A 2FX0A 1OYYA 1Y39A 4EGZA 4KIGA 1D1AA 1Y6IA 2KZGA 4C3JJ 1AU7A 1I3AA 3HSEA 3GTJJ 1MH3A 3OYJA 2RVCA 1P4AA 3TO7A 5KHDA 2TDXA 1IRZA 1DGWY 1POGA 1OCTC 3DBHB 1ZLKA 4IXAA 5E20A 1RESA 2LBFB 2M8GX 1Z05A 3GWZA 3VPRA 1OCRH 3QYFA 5BOXA 2LYCA 2VXDA 2FNPA 2O5RA 2L7KA 5FFZA 2DOFA 3GMEA 2L54A 3BR3A 2C6YA 5L3CA 1T56A 3CJTB 4A3DJ 4A3MJ 4GYIA 2NVUB 3BR0A 3J7AO 2K9QA 4A69C 4XRSG 1SVMA 1OMIA 1LDDA 1Z91A 2ESHA 3BDDA 4BGDA 4GRIA 3W3CA 3AG3H 1QNTA 3FXOA 2P81A 1VQOI 4U88A 3TP3A 1YI2I 3U9GA 2BBYA 3H35A 2ZMEC 2COBA 3OR1C 1XG1A 2VASA 5FLMJ 5ILUA 3DTKA 4U0WA 2CFXA 4EEFG 1Z21A 1ZR4A 3CZ6A 3HEFA 1BW5A 5HNHA 2Q1ZB 2IEKA 3K4MA 3GZ6A 5AONA 3V7RA 2UWMA 1Z7LA 4WWCA 1AWCA 3DF8A 3IRRA 1CGPA 3HXLA 1YW8A 1P7JA 2M9HA 3NWTA 1IDYA 2L01A 2V9KA 4RGUA 3K70D 1BOBA 1SMYF 1ULYA 2ZB9A 3GTOJ 2XB0X 5HDKA 2VE9A 2A5YB 5JVTA 4ESFA 1W7PD 4RB2C 1R4MB 1ZREA 2V79A 1VTNC 4ZDPA 5A2QK 3HSFA 3N4MA 1ZH5A 4PJNA 1Z67A 1YRNA 1YITI 4CH7A 4DBQA 3L2QA 5AIQA 2XPUA 1NK2P 2Q8KA 3SFIA 3J81Z 3JRAA 2EWNA 3C2GA 2IS4A 2EV5A 4L0YB 4CZCA 4A3EJ 5HS8A 1N78A 4LIUA 4L18B 1U2WA 3GFLA 3IH4A 4H4KC 1TTYA 3W2WA 4ZTFA 5HDGA 3BTLA 1W36D 3K9TA 1P4WA 5E8GA 2VJJA 1YO5C 3WG9A 1D0YA 2X51A 1EA3A 3QP6A 4B44A 1C0WA 1MNMC 1XN7A 2VKHA 4M9SA 1WRJA 4HAMA 5J1UA 2W4SA 4UVBA 1SFUA 1YJWI 1E3OC 1HW1A 5C4XJ 2IGMA 3GVAA 2IA0A 2Y0MA 3JREA 3D0SA 2CFOA 1GXPA 4ZC3A 2KRCA 1P92A 1LDJA 3I54A 4A5MA 5ILVA 2OCCH 3LSKA 3H9JA 2K9LA 4HX8A 2XC7A 3HTUA 2XAFA 2GIVA 3OYBA 1JGSA 2LKSA 1PJRA 3RYPA 2FSWA 2DQRA 2NVQJ 1EJ9A 3ECHA 3J80Z 2J5OA 4M3DA 3CUQC 4RB0A 3K4JA 3IWZA 2F5FA 1J9IA 1E2XA 4G6QA 5DTDA 1DPRA 1QZYA 2H8WA 1WZ2A 4LFUA 2CS3A 1E0EA 4A0ZA 5LBQA 1YIOA 4UUVA 1TW2A 1YYVA 4NHJA 4W1UA 3DPUA 1VZ0A 5K5OA 3H9QA 4HSTA 2ZFWA 2DOAA 1NH3A 2DDAA 4EMSA 2Y9ZA 1DP7P 2CUJA 5E79C 2HYFA 2CV2A 4M6VA 5ICGA 5H2FC 3DU6A 4DZPA 2HTJA 1FJLA 4ZH4F 5DV5A 1AKHA 2B63J 5E3OA 4CYCB 4CDGA 5LHGA 3V4GA 1OKRA 2K3PA 1ZARA 2CQNA
chains in the Genus database with same CATH topology
5DM7F 3CCRI 3CD6I 1MMSA 3G71I 3CCQI 3G6EI 1VQMI 1VQ8I 2JQ7A 4UY8I 1S72I 4V19K 3I56I 3DLLF 1VQOI 3CCVI 2QA4I 3CCEI 1YI2I 2OTJI 3J7YJ 2E36A 4IO9F 1VQKI 1Y39A 3PIPF 3PIOF 3J7ZI 4IOCF 5JVGF 2NXNB 1FOWA 2ZJRF 3CCLI 5GAGJ 3CCSI 1VQPI 1YJNI 1QA6A 1VQ4I 3CCMI 2QEXI 2ZJQF 2E34A 3CJTB 3CCJI 2K3FA 1VQ9I 5DM6F 3G4SI 1VQLI 1ACIA 2ZJPF 1VQ5I 1YJWI 1VQ6I 1FOXA 1YITI 2OTLI 3CCUI 1YHQI 5GAEJ 1YJ9I 2FOWA 4IOAF 3CC7I 1HC8A 5GADJ 3CMAI 1VQ7I 3CC2I 2H8WA 3CC4I 3CMEI 1FOYA 3CF5F 2E35A 5GAHJ 1VQNI 3I55I 1YIJI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DM7 F;  3CCR I;  3CD6 I;  1MMS A;  3G71 I;  3CCQ I;  3G6E I;  1VQM I;  1VQ8 I;  2JQ7 A;  4UY8 I;  1S72 I;  4V19 K;  3I56 I;  3DLL F;  1VQO I;  3CCV I;  2QA4 I;  3CCE I;  1YI2 I;  2OTJ I;  3J7Y J;  2E36 A;  4IO9 F;  1VQK I;  1Y39 A;  3PIP F;  3PIO F;  3J7Z I;  4IOC F;  5JVG F;  2NXN B;  1FOW A;  2ZJR F;  3CCL I;  5GAG J;  3CCS I;  1VQP I;  1YJN I;  1QA6 A;  1VQ4 I;  3CCM I;  2QEX I;  2ZJQ F;  2E34 A;  3CJT B;  3CCJ I;  2K3F A;  1VQ9 I;  5DM6 F;  3G4S I;  1VQL I;  1ACI A;  2ZJP F;  1VQ5 I;  1YJW I;  1VQ6 I;  1FOX A;  1YIT I;  2OTL I;  3CCU I;  1YHQ I;  5GAE J;  1YJ9 I;  2FOW A;  4IOA F;  3CC7 I;  1HC8 A;  5GAD J;  3CMA I;  1VQ7 I;  3CC2 I;  2H8W A;  3CC4 I;  3CME I;  1FOY A;  3CF5 F;  2E35 A;  5GAH J;  1VQN I;  3I55 I;  1YIJ I; 
#chains in the Genus database with same CATH topology
 4S05 A;  5L3E A;  3CCQ I;  1X19 A;  4AVP A;  3ESW B;  2LG4 A;  5J47 A;  2VQG A;  1ON2 A;  3FMQ A;  1K6O A;  1V54 H;  2JA6 J;  2IS1 A;  3E0J B;  1WQ2 A;  3KZZ A;  3HRM A;  3LSJ A;  4W97 A;  2UXX A;  3FK7 A;  4ZYE A;  3MWM A;  2QSF X;  1ITY A;  4AUX A;  1SAX A;  1KYW A;  3Q0V A;  1GDT A;  2OTL I;  1TQM A;  2DA7 A;  2MSY A;  5LGT A;  4PGH A;  4X6A J;  2IGO A;  3L2C A;  2NVY J;  4I98 B;  4YFK F;  3SDB A;  2L0K A;  5DEQ A;  1VQM I;  1BJZ A;  2X1C A;  4G8X A;  4ASN A;  4NDL A;  4CYC A;  3TW6 A;  2E36 A;  3ZQ7 A;  3P9C A;  3FZV A;  3F8M A;  4DNC A;  3N97 A;  3VDX A;  4L5J A;  5F1R A;  3HB9 A;  2O0Y A;  3RZO J;  3MEX A;  3S2D J;  3M4O J;  5HDN A;  4NC8 A;  4ZYD A;  2E60 A;  5CVV A;  3OYF A;  4F93 B;  4I6Z A;  4YFX F;  3W6V A;  4RM2 A;  1OLT A;  2LF7 A;  1VQ8 I;  4U7D A;  2OJE D;  1RKT A;  3LQQ A;  1BC7 C;  1WJA A;  2P7V B;  3K1P A;  4KT5 C;  3F72 A;  1TW3 A;  1WH7 A;  3ABT A;  3OOU A;  2BV6 A;  2GLO A;  4CIC A;  5LGU A;  1KU7 A;  4MTD A;  3GCM A;  4B48 A;  3BTJ A;  4M74 A;  3GTL J;  2K9M A;  3OS0 A;  1P7I A;  5ILS A;  2JA7 J;  3DKX A;  3ELK A;  4IOA F;  1VQ7 I;  1BA5 A;  5HS9 A;  1BBY A;  3IWF A;  2HDW A;  1HKT A;  2VI6 A;  1O3S A;  2DYR H;  1IXC A;  2R92 J;  2WAD A;  3F6O A;  2VIX A;  2XHK A;  4BDY A;  2HPM A;  4ANJ A;  2FQ4 A;  1D8K A;  3C18 A;  3ECO A;  4Y3O A;  4XLN F;  4UHT A;  4A6D A;  3H92 A;  2ZJQ F;  2DMU A;  2XAU A;  2G7U A;  2KRF A;  5J3L A;  2HYJ A;  2VJI A;  4A3C J;  4B8X A;  5E3M A;  2HYG D;  3QOE A;  2JPB A;  1WPK A;  4EQQ A;  4MFD A;  2IT0 A;  1G2H A;  3JTG A;  2P7C B;  3ZQH A;  3RKX A;  3HPH A;  4F55 A;  4ENK A;  1DPU A;  4D0P A;  1U3E M;  1ETY A;  4CSW A;  1B59 A;  3HKZ N;  2E71 A;  2YR2 A;  2FJ1 A;  2X6Y A;  4UB8 C;  3K1N A;  2QQ8 A;  2ZXH A;  3V8J A;  2M7A A;  3G1M A;  1X1D A;  1TQP A;  1KQ9 A;  1I27 A;  2E34 A;  2ZCW A;  4FE7 A;  1X3Z B;  2AXL A;  2V9P A;  5TGT A;  2BHZ A;  4EM0 B;  4DYQ A;  3S2H J;  1IDZ A;  2D45 A;  5CVU A;  1HBX G;  4QPO A;  5F0F A;  4C9Y A;  1X1P A;  1SD6 A;  2ZNY A;  5E17 F;  4YEL A;  2JJ7 A;  2I5U A;  3DKW A;  1AA7 A;  3I58 A;  5IYB J;  4LB6 B;  2G9W A;  2XGX A;  3GW2 A;  2X1E A;  1HLV A;  4RS8 A;  1SAN A;  2V9V A;  4Y17 A;  4LD5 A;  1ONV A;  1F43 A;  1Z77 A;  5CJ9 A;  2WB1 N;  1YJN I;  3HTS B;  1BJA A;  3T8T A;  2FU4 A;  1ZRF A;  3ZOB A;  3S14 J;  3Q0U A;  2WAF A;  4AYB N;  3O3K A;  3NAR A;  3BQY A;  3WGH A;  4FX0 A;  3FDY A;  1SAU A;  1MMD A;  5TJJ A;  3RTR A;  3WTS C;  4HYE A;  3A4C A;  3K0L A;  4HOB A;  1JJ6 C;  3RZD J;  3ISP A;  3A01 A;  4MNU A;  3ZCO A;  2ZXJ A;  2DXI A;  1HA8 A;  2RN7 A;  3VWB A;  3JRG A;  2A6H F;  3I56 I;  4P96 A;  3OIP A;  1STZ A;  3BPV A;  2XRL A;  3CCM I;  1K78 A;  2E1M B;  4M6X A;  1WGX A;  5EF6 A;  1VQ9 I;  1WJC A;  2LOO A;  3TP0 A;  3E3V A;  3LSG A;  3TDU C;  2GZW A;  2R3S A;  3ULQ B;  4Q4Z F;  4F7Z A;  5BS6 A;  2X0L A;  4DOZ A;  2YS9 A;  3M3Y J;  5J4V A;  3R0A A;  2XRO A;  1MMN A;  2R7Z J;  2DMN A;  3EUK L;  2GWR A;  3FXM A;  3D1N I;  3WU2 C;  1XSD A;  1FYK A;  4G6T B;  1TP4 A;  3L9F A;  3PSF A;  4UVA A;  3FX3 A;  4E7Z A;  5E1W A;  3QOD A;  4BQQ A;  3Q9S A;  2XUB A;  1IGN A;  2K3F A;  3TOB A;  3DWL E;  3HHG A;  3K70 C;  1A5J A;  5KK1 A;  2WAE A;  2FNA A;  2NAZ A;  2LK2 A;  3ERE D;  2CSO A;  2E19 A;  2VN2 A;  3GZ5 A;  1FEX A;  3HOZ J;  1GHC A;  3D5S C;  3DBR B;  5AIP A;  1ENH A;  2WC2 A;  2CQX A;  3PL8 A;  4MFE A;  4YFN F;  1O7F A;  1TNT A;  4PCQ A;  1OCP A;  4PJ0 C;  2ZJR F;  2BHY A;  1UG0 A;  2EZI A;  3DV8 A;  2R0Q C;  4XLP F;  4V2F A;  2FRH A;  1FIP A;  3S1M J;  4ENM A;  2EIK H;  4YIR X;  4HNT A;  5L3B A;  2CYY A;  2D2W A;  3E6D A;  5DCM A;  4N4O B;  3ZQL A;  4KIF A;  3HGG A;  2EB7 A;  3K4L A;  2E2H J;  4HBL A;  2PBI A;  2WBM A;  3KP2 A;  4F92 B;  2STW A;  1G3W A;  2WV1 A;  4RA2 A;  1XGM A;  4XSX F;  2LRD A;  2BZT A;  5E3L A;  3W6K B;  5K5Q A;  2E1M C;  2ZBK A;  3ZQF A;  3PIP F;  3SJM A;  2EH3 A;  2I10 A;  2HVR A;  3AG2 H;  1Y56 A;  2DA4 A;  4NQW A;  3QPL A;  3I64 A;  3GTM J;  3H5R A;  2TRT A;  1G3S A;  2MD5 A;  3IC7 A;  4UB6 C;  4FAS D;  4U7B A;  5BPI A;  2K86 A;  1O3Q A;  3BG6 A;  3GLX A;  2CUF A;  2IRF G;  4FHT A;  2XAG A;  2BXZ A;  3OMY A;  2LRE A;  3R4K A;  1SFK A;  4HZF A;  2XF6 A;  1R5H A;  5DM7 F;  1LE8 B;  4RGX A;  3HOV J;  1UHM A;  2CU7 A;  3KCC A;  3ZXS A;  2NYX A;  3EET A;  4IO9 F;  3PIO F;  3QU3 A;  2ACJ A;  4HW0 A;  2VJ4 A;  1OIS A;  1W5T A;  4RAF A;  5FFX A;  1F36 A;  3PSI A;  5EDN A;  3T5X A;  2GOX B;  2LTP A;  1FP1 D;  1FSH A;  3OYH A;  4A3G J;  1IN4 A;  3FBN B;  3Q3S A;  1UFM A;  2YPR A;  3L00 A;  4MGR A;  2R7V A;  4L9V A;  3BG5 A;  3CME I;  3CDL A;  1N75 A;  5B66 C;  2KDZ A;  1L3L A;  4M3B A;  3S93 A;  1D8J A;  2Y30 A;  4GGG A;  3CCV I;  2ZXW H;  3IRQ A;  3U2R A;  2F4M B;  2KFD A;  2QCO A;  2H8R A;  4C30 A;  1LE8 A;  4HX7 A;  4XR6 A;  2RDP A;  2PN6 A;  5E18 F;  4OIO F;  1EKE A;  3FXQ A;  4PFP A;  2WTE A;  4KA4 A;  1OQY A;  1KU2 A;  4EM1 A;  1Z9C A;  3PJR A;  2Q2E B;  4HRI A;  3J7A Y;  1YLF A;  3TQN A;  3S1R J;  3RQI A;  3FHZ A;  3S3O A;  2XKO A;  3KP5 A;  4C3I J;  2HZT A;  2JRT A;  2R4G A;  3S2W A;  1XMX A;  4ZZL A;  3OYA A;  3VYT B;  2QF7 A;  4MQ9 F;  2KJB A;  3O8H A;  2M4K A;  1R58 A;  3O8G A;  5EYR A;  1XGN A;  2QKL B;  1G3Y A;  1QGP A;  1ZGW A;  3T0Y A;  4KJZ A;  2R7S A;  2CJJ A;  3PUF A;  3MZH A;  1VQL I;  1S7E A;  2G7H A;  2HFH A;  2BXY A;  3LQR A;  1TLH B;  4Y7N J;  3MAJ A;  2JN6 A;  3S32 A;  2A3S A;  1R4N B;  1WCM J;  5J40 A;  3M07 A;  1ZG1 A;  2HEO A;  1FTZ A;  4AIJ A;  3L2U A;  1OJL A;  2MLK A;  3WTY C;  1GUU A;  1GVD A;  1ZYR F;  1X58 A;  2H6B A;  2EFO A;  3DTI A;  4BL0 B;  3OR2 C;  3TMO A;  4BU2 A;  1BIA A;  1U78 A;  4KFC A;  4QIW N;  2X6O A;  3AG4 H;  4BYY A;  5IT3 A;  1A35 A;  3M1E A;  4QWQ A;  1R7J A;  2VC1 A;  4XOP A;  2B0L A;  4GFB A;  3I4P A;  1R9T J;  4DGW B;  3LNQ A;  2HXI A;  5FGM A;  1OYI A;  2MC3 A;  5D4S A;  1ERD A;  3VSK A;  2IGN A;  5L3G A;  5F08 A;  3MKZ A;  1IRG A;  1HSJ A;  2R7F A;  2O03 A;  4XLE A;  2Y0S A;  1FBU A;  1F4K A;  2R7D A;  3E6C C;  1K6Y A;  4CCN A;  2Z9O A;  4FT8 A;  2K85 A;  2CW0 F;  5CQG A;  1ZEL A;  4D5F A;  2IGK A;  1VQN I;  2CUZ A;  1FOK A;  2EV6 A;  1FSE A;  1BM9 A;  4E7H A;  2UUZ A;  1A04 A;  2DA5 A;  4C2T A;  4UY8 I;  3KZY A;  2LSO A;  5GPC A;  2EIL H;  2Y31 A;  2QQB A;  4Y15 A;  1M1E B;  5HOD A;  4N0B A;  3LOC A;  4OMZ A;  4EGY A;  4R8H A;  4BY7 J;  2DA3 A;  3ZGK A;  2QKM B;  3CCJ I;  2X6X A;  1WH5 A;  3PNT A;  4V2G A;  2IBD A;  1J75 A;  5F6F A;  3L2W A;  3QQA A;  4WK8 F;  2DU9 A;  3CLO A;  2XB5 A;  3JR9 A;  3BJ6 A;  5FRO A;  3A2K A;  2L2O A;  5IP6 A;  4OWR B;  2DK5 A;  3FHN A;  3IHU A;  4EJO A;  3JRF A;  1ZQ3 P;  4GDF A;  2X6W A;  1FBQ A;  2XRN A;  5ICC A;  2PQ8 A;  5LHI A;  3BCB A;  1G8X A;  3LA7 A;  4IHY A;  5E8I A;  3EUH C;  2R7T A;  2ISY A;  1R36 A;  3TGN A;  3B73 A;  2FML A;  3TO6 A;  2QYO A;  2RRE A;  4IRI A;  3WE2 A;  4A3F J;  5HS7 A;  1ETX A;  2CMP A;  1BIB A;  4M6Y A;  5DD8 A;  3MKW B;  2A68 F;  2K02 A;  3AFH A;  3NAU A;  4XOR A;  4D9J A;  2JVH A;  3DQV C;  2WY7 Q;  1XS9 A;  2E5Z A;  5EGO B;  1KA8 A;  4EJU A;  5EG0 A;  3EQL F;  1Z3Y A;  1A6I A;  2LY1 A;  2XPV A;  1H89 C;  2FOK A;  5M3M J;  2HU9 A;  4MEX F;  1REP C;  2V4J C;  4FX4 A;  4IQJ A;  5FKO A;  2LF8 A;  1R23 A;  3R6S A;  4ZYG A;  2FEZ A;  5EEG A;  2NRA C;  5DCF A;  5E1X A;  4B09 A;  1JJ8 C;  3BTC A;  3VEP A;  4BXF A;  1FIA A;  4P1W A;  5CKT A;  3G1L A;  5J1R A;  4A12 A;  2K9N A;  4IF4 A;  1IO2 A;  1U8B A;  2MC4 A;  3ERM A;  5FO5 A;  4LG0 A;  3A03 A;  1WVR A;  1SC7 A;  1R71 A;  1FYL A;  2MGQ A;  2RQP A;  4CGZ A;  5D6E A;  1Y8Q B;  2V1X A;  1K78 B;  2O9L A;  1OPC A;  2YX4 A;  4HQM A;  4BEH B;  2QEN A;  5LHH A;  4CCJ A;  2VXZ A;  2VJ5 A;  3CP8 A;  3HOX J;  3TOA A;  4A93 J;  3CC7 I;  3H3V K;  1Z3X A;  1ZG3 A;  3O6B B;  2A05 A;  4IHS A;  5LEK A;  4DIQ A;  2H1K A;  4JX5 A;  3HGY A;  9ANT A;  2W1O A;  2E5N A;  1J7K A;  3KP7 A;  2JA2 A;  4M73 A;  4M71 A;  2NVT J;  4RAY A;  5ICF A;  4XRS A;  3KEY A;  4P9F A;  2DT5 A;  1T0F C;  3BTI A;  1W0T A;  2CW8 A;  1IW7 F;  1ZK8 A;  1EH8 A;  2R7U A;  3T1B A;  3BP8 A;  1Z1D A;  4GO1 A;  1V3F A;  3PM1 A;  4XOT A;  3WHC A;  4G12 A;  2TCT A;  2EA2 A;  5FD6 A;  3I4M J;  1A6Q A;  1E3P A;  2O3F A;  1I39 A;  4RB3 C;  1MKM A;  5HVQ C;  3GFI A;  3IKV A;  4WXH A;  2VOO A;  1D1B A;  1SD4 A;  2QA4 I;  1MND A;  2DT6 A;  2JTV A;  3K4N A;  3KYL A;  1PYV A;  1KGS A;  2W24 A;  3ZQI A;  4I02 A;  3T8R A;  5F1J A;  1Y1W J;  2ISZ A;  2V1D A;  3EDP A;  5BQT A;  1X4P A;  2H09 A;  1QVT A;  5K7F A;  2WAQ N;  3OV8 A;  1XCB A;  1Z0X A;  3FM3 A;  4XK4 A;  3ZQQ A;  5GAE J;  1JHF A;  1JGG A;  3OY9 A;  1G59 A;  1EF4 A;  1S8N A;  2AQF A;  3H1C A;  1X1B A;  1MJB A;  2P6S A;  1MZB A;  4XID A;  1Q1H A;  2JVG A;  1ZRC A;  2X85 A;  3K10 A;  1WWX A;  2RKH A;  1T8I A;  2IAI A;  3SHF A;  2PX9 A;  3OYM A;  1WI9 A;  1APL C;  2ZME A;  3MZ8 A;  1R5G A;  5J4Y A;  4NC7 A;  2D1V A;  2CO5 A;  1MSE C;  2VBW A;  4HNV A;  2XIG A;  1LFB A;  1P6R A;  3E1S A;  1I1G A;  2MBF A;  5IOZ A;  4RGR A;  3IAM 2;  3LSI A;  1YE9 A;  3BOQ A;  2HKX A;  4CCM A;  3K6G A;  1RKW A;  4XBF A;  1XDU A;  3ZMT A;  2DTR A;  2VBX A;  5FKM A;  4O6J A;  4U0V A;  4BBS J;  2ELJ A;  1V5E A;  2EZK A;  2ID3 A;  1HDD C;  1UEL B;  1CF7 A;  4BHC A;  3K69 A;  2FBI A;  4II3 A;  3SEQ A;  4DJA A;  5K7Z A;  2DA1 A;  2WAQ A;  4YII A;  1QHG A;  4AU7 A;  3HRU A;  2H27 A;  4Y33 A;  2RNJ A;  5FLV A;  1WJD A;  2BY0 A;  1IRF A;  1S9H A;  4HQE A;  1LFU P;  1MJA A;  2WWY A;  1QQI A;  4BQO A;  3W2V A;  3RKQ A;  4J19 A;  2A61 A;  4HV6 A;  1IV6 A;  2EIN H;  1JI8 A;  2LKP A;  4GCV A;  3FWE A;  4FTH A;  3CD6 I;  1XX5 A;  5D5V B;  5K5R A;  1ETW A;  4IZZ A;  3LSM A;  1S5L C;  3BCA A;  3CF2 A;  3DPL C;  1X2N A;  1OCO H;  1I3Q J;  1HF0 A;  1IRX A;  1IN6 A;  2PG4 A;  3BC8 A;  4A3I J;  3MZY A;  2H6C A;  5IPA A;  1YTY A;  2MLG A;  3E6B A;  1FOX A;  3DFG A;  4LB5 A;  3UNG C;  3H3U A;  3KLN A;  4XSZ F;  1BOA A;  3ZMZ A;  4IHW A;  1JXS A;  2MG4 A;  1TT0 A;  1R1T A;  3AKZ A;  1SFO J;  5B1B H;  5L3D A;  1BC8 C;  2P5K A;  3WTZ A;  4IPA A;  2HQN A;  3I53 A;  3FXL A;  4BHB A;  4BAC A;  1D0X A;  3OL3 A;  5D4R A;  2QBY A;  2DAO A;  1XSX A;  1E3H A;  2LLK A;  2M3A A;  2ME6 A;  2WY8 Q;  2IP2 A;  2VKE A;  4PDK A;  4EM2 A;  3M9A A;  3L2V A;  4HF2 A;  5FKL A;  2QZ8 A;  2KIS A;  1IJW C;  2R7Q A;  4G7H F;  1JT6 A;  1O3T A;  5J8F A;  1UST A;  4IL6 C;  1YHQ I;  5CLS A;  2OZ6 A;  2DFE A;  2UZK A;  1X3U A;  2M8E A;  3CJR B;  4KIT B;  1N77 A;  4NNJ A;  2HOT A;  4XLF A;  5EZG A;  1JUS A;  4L5E A;  1MDM A;  4BHP A;  1B1B A;  2OAZ A;  2O6G E;  2OUM A;  4IOC F;  1U5T C;  3BZC A;  2W85 A;  2YU9 J;  4KMU X;  4OIR F;  5FRN A;  3BG7 A;  4KN7 X;  1T33 A;  3U21 A;  1ZG5 A;  1FBS A;  3E6M A;  3SQN A;  4CZZ A;  1BN5 A;  1YS6 A;  3B02 A;  2ETH A;  4IRH A;  3PQJ A;  2LBF A;  2MAB A;  1R00 A;  1K79 A;  3K1M A;  1XMK A;  3KYC B;  3AAF A;  3JAM K;  5GAD J;  2PJP A;  3KX2 A;  1NTC A;  5K7H A;  1RUO A;  1GV2 A;  5GPA A;  4S0H B;  4U87 A;  3IKT A;  1KU3 A;  2A5W A;  3LA2 A;  3HM5 A;  4II2 A;  4G7O F;  1FPQ A;  1X1C A;  4CUG A;  2KIQ A;  4EJV A;  2W82 A;  2WA0 A;  1QZZ A;  1X4O A;  3F8N A;  3Q9V A;  4HLY A;  4A6E A;  3FM5 A;  1S7A A;  1ZRD A;  1JTY A;  3S8P A;  4IX7 A;  2PMZ A;  5IP9 J;  4UV8 A;  1BW6 A;  4XKC A;  3ZRG A;  1D3Y A;  2VUM J;  2HKO A;  5FKN A;  1GLN A;  4OU0 A;  2K4B A;  1R1V A;  1RZ4 A;  3DLL F;  1FYM A;  3DEE A;  3CTA A;  2X9D A;  3GTG J;  3IL2 A;  4BQN A;  4I0B A;  2DMP A;  4C3H J;  1VF9 A;  1FY7 A;  1ZR2 A;  1T38 A;  2CUE A;  4EV0 A;  3AL0 C;  2DFH A;  1FT9 A;  2FD5 A;  2K4J A;  5JLX A;  4XLC A;  3FKJ A;  2KHM A;  2ME0 A;  2DCE A;  1O4X A;  5A2Q Z;  6PAX A;  3S3M A;  4R79 A;  1VQ6 I;  2CH0 A;  3L2R A;  3SEZ A;  4KT6 A;  3PO3 J;  3VFZ A;  2FBH A;  3J81 K;  2GQQ A;  3JAM Z;  1WJF A;  4I2O A;  2HWV A;  4HG2 A;  5EGO A;  1QRY A;  1BI3 A;  2P0W A;  2AO9 A;  3TBI A;  2Z3Y A;  1WFX A;  3MN2 A;  4P55 A;  3EYI A;  3B6C A;  4ZZD A;  2RC4 A;  4D5C A;  1U9N A;  1H9T A;  5IOY A;  2E7W A;  1IV8 A;  3EUA A;  4LLL A;  3V7S A;  2ECB A;  2KP6 A;  3C3W A;  3BR2 A;  4HPQ A;  2DPD A;  2ZJP F;  5LEJ A;  4B3X A;  1K7A A;  1G3T A;  1YQA A;  2XSJ C;  3CCU I;  2KZV A;  2IS2 A;  2O61 A;  1YX3 A;  2O7O A;  1LB2 A;  3LWF A;  5FB2 A;  2E1C A;  1GXQ A;  3LFU A;  3QYE A;  1MBF A;  4GYG A;  5HNF A;  4XMY A;  4UVC A;  3GX4 X;  1ODD A;  1U0J A;  5D8K B;  3ROU A;  1IAW A;  2LY9 A;  1EH7 A;  2M0M A;  3KP4 A;  1HW5 A;  2A69 F;  3VSL A;  1J2X A;  3GBG A;  3OYE A;  4BEH A;  4WXD A;  1OCZ H;  3E5U A;  4G6D A;  2OBP A;  2VKV A;  2HQR A;  1MBG A;  4J01 A;  1V5G A;  2OV7 A;  3IP4 B;  3QOP A;  5EJC A;  4JP0 A;  4J00 A;  4E4H A;  5BPD A;  1IC8 A;  1HW2 A;  2EIJ H;  5D5U B;  2XF7 A;  1P4X A;  2BY2 A;  1S72 I;  4PZJ A;  3M8J A;  4XN3 A;  2XSD C;  3PO2 J;  2MYS A;  4JYK A;  3CCL I;  3KET A;  1FTT A;  1RI7 A;  1EV7 A;  2K7L A;  4RGS A;  4CHU A;  5F0H A;  4OIQ F;  3CDI A;  4MQV A;  1L0O C;  5JI6 A;  1AOY A;  1ETK A;  4RAZ A;  1B4A A;  3RKY A;  1HC8 A;  3OYC A;  1WSU A;  5M5W J;  3E7L A;  4I7H A;  2QSH X;  2IVM A;  3VOE A;  5J8C A;  3K4C A;  1YRN B;  1E17 A;  3OIO A;  2HOA A;  2JWT A;  2NS8 A;  5FRM A;  3RIR A;  4IKF A;  4HEA 2;  4NQW B;  1RUN A;  3KEQ A;  4AIK A;  3ZPL A;  4HDV A;  1KU9 A;  4RDU A;  2BVL A;  3I59 A;  2ZNZ A;  1A36 A;  2FA5 A;  4I09 A;  3JSP A;  5D5X B;  4E7K A;  1HKQ A;  4BXU A;  1VI0 A;  1KQ8 A;  1ZLJ A;  1I50 J;  3RKW A;  3KLO A;  4AID A;  4WXC A;  4AIH A;  2EBI A;  2GA1 A;  2EPF A;  2FMY A;  4TV7 A;  3WTT C;  1ZGJ A;  2HVS A;  2VBY A;  2X4H A;  3ZQC A;  1MBK A;  1UB9 A;  2QVO A;  3UKG A;  3M7G A;  1I6H J;  4KUM A;  2JT1 A;  4M3E A;  1D5Y A;  4KIS A;  2P4W A;  3BR1 A;  4DBR A;  2HQA A;  4BS9 A;  1LPQ A;  1B6A A;  3PFY A;  4M9Z A;  3V8L A;  4HDU A;  2JRM A;  1D5V A;  3RPQ A;  1MBJ A;  3ASO H;  2LC2 A;  1FC3 A;  1UCR A;  1ZGA A;  3JRH A;  2HPI A;  1OYW A;  2VB6 A;  4I76 A;  1LFP A;  2VLA A;  5FD5 A;  2DMQ A;  2DPU A;  3RPU A;  1B9M A;  2WV0 A;  2OF7 A;  3KZI C;  2XGC A;  3HPG A;  1Q1V A;  1X2M A;  2FUG 2;  4ETS A;  1DP3 A;  5L3F A;  2MA3 A;  2BE5 F;  2JSC A;  5KNL A;  1JE8 A;  1HCR A;  2XPW A;  4L9N A;  5B5E C;  4Z2Y A;  3OYL A;  4ESB A;  2YSR A;  2L3D A;  2MFZ A;  4D1Q A;  2KPM A;  1FWZ A;  3GLL A;  4UUS B;  3WU0 A;  3LAP A;  1F9N A;  1TL8 A;  3M1C A;  1TQI A;  5DDG A;  3BR6 A;  3NEU A;  2DQL A;  4KMF A;  3W6J B;  3C1D A;  1B72 A;  1GT0 C;  2VOD A;  1YW9 A;  1AKH B;  2E7X A;  3LMM A;  2DK8 A;  3CUQ B;  1QZE A;  5K1Y A;  5LGN A;  1BL0 A;  1PVE A;  5ICE A;  4E7I A;  3S3N A;  3PUB A;  4PSX A;  2KDO A;  2E2I J;  2KIM A;  1R1U A;  2M34 A;  2PJR A;  2R93 J;  3EUH A;  3JRD A;  3QPH A;  2E1O A;  2QQA A;  3LST A;  3BJO A;  3ABK H;  3RDI A;  5BNG A;  1G6N A;  3D5R C;  2M2E A;  1MW7 A;  4ZJZ A;  1HXD A;  2ZFU A;  4XLA A;  5LLQ A;  4DYR A;  5F64 A;  4DYC A;  2MW8 A;  3R60 A;  4HF1 A;  2DLL A;  2BW3 A;  4EJW A;  4H0E A;  2IA1 A;  4AC0 A;  3QPT A;  3IH3 A;  3VYS B;  1G4D A;  4BY1 J;  1XMA A;  3I9V 2;  4LOC A;  2A6T A;  3GF2 A;  4PSW A;  2QBY B;  2AHQ A;  4IHV A;  4RBO A;  1XDS A;  1MNE A;  2EK5 A;  1ZN2 A;  3FIS A;  4LGW A;  2BOL A;  4AD9 A;  2HOE A;  4HF0 A;  4XN0 A;  2Y48 A;  5HOO A;  4NB5 A;  4E7S A;  4KYW A;  1MBE A;  1QPI A;  5M5Y J;  4JX4 A;  2QSG X;  2LR8 A;  1W1W E;  3H5N A;  2STT A;  2ESN A;  1ON1 A;  3GUD A;  5KAF C;  3VOD A;  4B47 A;  5D8L B;  3I0T A;  2F4O B;  3GXO A;  2N8G A;  3K4K A;  1MDM B;  5D6F A;  4B3A A;  2BW3 B;  3KEO A;  2EZH A;  2VON A;  2VE8 A;  4E7J A;  3BT9 A;  2EIM H;  3RSN A;  5FLX K;  3Q5F A;  4LIV A;  1T08 B;  3SYT A;  3HL2 A;  1B8I A;  3DXJ F;  4Q47 A;  2JSP A;  2MH9 A;  1N25 A;  2L4M A;  5EZH A;  2DOD A;  3DLA A;  1R6R A;  2IA2 A;  3WTU C;  2DOE A;  2E35 A;  3RYR A;  1TWH J;  3S16 J;  2K40 A;  1T39 A;  3PNY A;  3HOU J;  1F1Z A;  2W84 A;  5HLH A;  1YFH A;  3SZG A;  2CG4 A;  3QAH A;  5GTH C;  3HBL A;  1SVO A;  1LUJ B;  2DJI A;  1SD7 A;  2LD5 A;  2MH2 A;  1R5I D;  5M3F J;  4BAY A;  2EFN A;  2DBB A;  2LY2 A;  1JTX A;  2CGP A;  3ZP5 A;  1MMA A;  1YW7 A;  1OCC H;  1DQU A;  4OIN F;  4YG2 F;  1UZC A;  2QWW A;  1B8I B;  1J09 A;  1EH6 A;  1B9N A;  1I1S A;  4A5N A;  3NQO A;  3W2A A;  2P6T A;  4HNU A;  4I01 A;  3L1P A;  1S6L A;  2DFF A;  4WX9 A;  1LVK A;  4BKX A;  3OIQ A;  2CV0 A;  5DS9 A;  3ZMV A;  2V1N A;  2V7F A;  2R7O A;  3ABM H;  1QA6 A;  3SZT A;  3M8F A;  3CUO A;  3WHB A;  3F8B A;  3K2A A;  4UUT A;  3P9K A;  4EAT A;  1VQ5 I;  2KJC A;  2IXS A;  2XKP A;  3JRC A;  2L9V A;  4ZDL A;  1RNL A;  1U6G A;  1DU6 A;  4ZDO A;  1SMT A;  3IV5 A;  4ITV A;  1WI3 A;  5C44 J;  4BQA A;  4MO7 A;  4O3M A;  3ZMS A;  1ETO A;  3LSH A;  2QUF A;  4AM3 A;  1FMW A;  3BR5 A;  2KT0 A;  3BZK A;  1V5F A;  2GA2 A;  3H5A A;  2PMH A;  3OYI A;  3DKY A;  1VQK I;  4OAZ A;  4QLC U;  2EA4 A;  3O2P E;  5GAG J;  4AVZ A;  1W4M A;  3MQ0 A;  5CVR A;  2JPC A;  1NK3 P;  1JT0 A;  2M4G A;  4BE2 A;  3FIW A;  4BUP A;  2PEX A;  2L7M P;  3V7C A;  1QVU A;  1UHW A;  1J59 A;  1S7O A;  3FXJ A;  4B1R A;  3TL4 X;  3RI4 A;  2HVQ A;  1WJ5 A;  3MFK A;  1J0R A;  2W7N A;  4BXX J;  2GOM A;  2OU2 A;  1AHD P;  2DTZ A;  2CRG A;  1U9O A;  2DA2 A;  5CPR B;  2D1H A;  4B43 A;  4DZJ A;  1IF1 A;  3G71 I;  1MGT A;  4KNY A;  2Z33 A;  3NWS A;  1NG7 A;  2L02 A;  4A2U A;  2ID6 A;  1TZL A;  3I4N J;  1V4R A;  1JUM A;  2EJR A;  2BGC A;  2Y75 A;  3SXY A;  3HUG A;  5IYC J;  3KYD B;  1ACI A;  4R1H A;  5JHF A;  3NRV A;  3GFJ A;  4XON A;  4A0Y A;  3HZJ A;  3HHH A;  2ECC A;  1RPW A;  2L9S A;  2ZO4 A;  4I0A A;  1I6X A;  4A3K J;  5E3N A;  2PFB A;  3F0C A;  2CW7 A;  3F6V A;  4YEJ A;  5F04 A;  3GFM A;  4X1E A;  1HKS A;  2PMZ N;  3V42 A;  1HST A;  5IY5 H;  5DYM A;  5GP9 A;  5LRS A;  1F5T A;  1NHA A;  2F5E A;  2UXN A;  2GXA A;  3ZN1 A;  3FXU A;  3CDH A;  2YX7 A;  2OD5 A;  5BMZ A;  5J1Y A;  2L9R A;  3JRB A;  2B9S A;  3R0J A;  2ZSH B;  1PP8 F;  1SVL A;  2X48 A;  1J5Y A;  1YX5 A;  3IAS 2;  3PQK A;  1W36 C;  4PUS A;  5DUK A;  1LVA A;  3G2B A;  2F4I A;  4Y4R A;  5F27 A;  1XTA A;  3GTQ J;  3CQZ J;  2JZY A;  1D0Z A;  2RAE A;  4KIC A;  2FE3 A;  4RLQ A;  4L9J A;  4NUB A;  2VQL A;  3HC7 A;  2VPR A;  2ZME B;  3S17 J;  3MCZ A;  3HDD A;  2CWE A;  5HLG A;  2LVS A;  3F8F A;  4YIF A;  1VQP I;  3K7A J;  4LG3 A;  2M0C A;  1JUP A;  1Z7U A;  3OSF A;  2LH9 A;  3MMY B;  4CCL A;  4LLG F;  3HYI A;  2EQR A;  4IEJ A;  1O57 A;  4A3J J;  5DCM B;  2K9S A;  1V55 H;  3CF5 F;  4XRM A;  3CCY A;  1MMS A;  3FKI J;  2HOS A;  1CF7 B;  4WCG A;  1X1A A;  3TKY A;  1RR8 C;  4RAG A;  1FOW A;  2Q2E A;  2XDV A;  3SFZ A;  4HA8 A;  3BLY A;  4LMY A;  2ZJ2 A;  1U5T A;  3KP6 A;  3EYY A;  2L9N A;  3BY6 A;  3P9I A;  1TT5 B;  3CJQ B;  1FX7 A;  2Y2Z A;  3HG9 A;  3ZMD A;  4CA0 A;  2AS5 F;  3KIO A;  4HX4 A;  4A3L J;  2R5Z A;  2QM3 A;  4M3G A;  1RET A;  4JOM A;  4XM3 A;  5H6R A;  1XSV A;  1W5S A;  3FMR A;  4C2M J;  1HDP A;  1H9G A;  1T6S A;  5LD2 C;  1TC3 C;  4UNO A;  3D5L A;  4BJ6 C;  3TDZ C;  4HV5 A;  2R7X A;  2M30 A;  4O5V A;  3ZN0 A;  2DJN A;  1IXS B;  1BR4 A;  1YOV B;  3LSP A;  1VQ4 I;  2RV8 A;  1XCV A;  4IHX A;  3L09 A;  1BR2 A;  3MD2 A;  4IQ4 A;  2NNY A;  2L5Q A;  2VT3 A;  3LL7 A;  2ICW G;  4LK1 F;  3S1N J;  1XGS A;  4UUS A;  2J5P A;  3GEZ A;  3H3Z A;  1U5T B;  3OS2 A;  2DN0 A;  3KE2 A;  4JQF A;  4CO8 A;  4NBQ A;  3RQ4 A;  4IHT A;  3CP2 A;  1QHH D;  2QQ9 A;  4L5I A;  4S04 A;  2CQ7 A;  2OQR A;  1UAA A;  1MH4 A;  1JKR C;  3AG1 H;  2R5Z B;  5TRD A;  3F3X A;  4FE4 A;  2COM A;  1TBX A;  3OYN A;  3I3L A;  4G7Z F;  2O8K A;  5TIS C;  2Z2S B;  3ABU A;  3CUQ A;  4Q5S F;  5DD4 A;  4XQF A;  2OC6 A;  5C3E J;  1T2K A;  2XGD A;  4BH9 A;  1JHH A;  3QU6 A;  4K2E A;  2VC0 A;  3GTK J;  1K4T A;  2W48 A;  3IUO A;  4G9Y A;  3VYU B;  2LNB A;  3RCO A;  2PLY A;  2BY1 A;  2BY3 A;  4FCY A;  3DTE A;  5JLW A;  5JHU A;  1Z6R A;  4Y52 J;  2KKO A;  2V6C A;  1GV5 A;  3UR3 C;  3J7Z I;  3HOT A;  3FXR A;  3DBL B;  4N9H A;  2JA8 J;  2EZL A;  4BJ5 C;  3BRO A;  1UJ8 A;  1W0U A;  3S1Q J;  3PNV A;  3SZP A;  4IRG A;  3I5U A;  1KZH A;  2V26 A;  1PUF A;  1RIO H;  5LRR A;  4M9X A;  4X0G A;  1QPM A;  4AWX B;  2CQQ A;  2LDU A;  5H6Q A;  1VFC A;  2AQE A;  3OS1 A;  4EJT A;  2JK3 A;  1CQT A;  1T98 A;  2HDD A;  4JK1 X;  2K27 A;  4RM3 A;  1LQ1 A;  1VND A;  2Z1D A;  3CMM A;  4XKW A;  5KAI C;  4PGG A;  2NS7 A;  4ABZ A;  3K2Z A;  3CO7 C;  4ENN A;  1SEU A;  2PMU A;  3HOS A;  3OWT A;  4G94 A;  1FP2 A;  2GXG A;  4V19 K;  1HOM A;  2KLO A;  3DU5 A;  5M5X J;  3BPX A;  5ED4 A;  1PUE E;  3RPU D;  5B1A H;  3JTH A;  3DPT A;  2IPQ X;  1IN7 A;  2F6C A;  4Z6Y A;  3WTV C;  1KYZ A;  1XB4 A;  3ASN H;  2ZSI B;  4Y13 A;  3G4S I;  2R7R A;  3DP7 A;  3GYH X;  4HSR A;  2DDB A;  3RJP A;  1I5Z A;  4M3F A;  3LSR A;  4QPQ A;  2FOW A;  2KIF A;  1W7P A;  4MIM A;  3F23 A;  1PUF B;  4XRF A;  2OA4 A;  4M72 A;  3VYR B;  2LKX A;  3WGG A;  2VBZ A;  3KFW X;  4B4C A;  5IT9 K;  3DEW A;  4XKV A;  3ZQG A;  2DYS H;  1XGO A;  1LEB A;  1BR1 A;  3FF5 A;  1NG6 A;  1ORK A;  2GAU A;  2L7Z A;  1HQC A;  1WJB A;  4XLH A;  2BYV E;  4MHG A;  2NVX J;  2ZC2 A;  4QTR A;  1DUX C;  4PJJ A;  2BEO A;  4OOI A;  1MBH A;  3J80 K;  4XL9 A;  1XC5 A;  1FZP B;  3H36 A;  3KP3 A;  2EV0 A;  2ZXI A;  2V6E A;  2F5D A;  2CQK A;  2HTS A;  3QWL A;  3CC4 I;  1FOY A;  5CVJ A;  1DDN A;  4A0X A;  1UMQ A;  1MSF C;  2UV1 A;  4YRV A;  3I55 I;  4DQ2 A;  2RQQ A;  2FXA A;  1W7P B;  3H0G J;  4UXN A;  1LKX A;  2CV1 A;  3QPS A;  1XPX A;  2FQ3 A;  2HI3 A;  3BQZ A;  5HLI A;  3H0D A;  5JVG F;  3K4B A;  2XVC A;  2XGE A;  2M7B A;  3CLQ A;  4XKB A;  3F9K A;  1R22 A;  3F22 A;  3G1O A;  4P5O A;  3P5J A;  1T0F A;  1H88 C;  2FF4 A;  1SFX A;  4BE1 A;  1Y8R B;  2W25 A;  4LLN A;  2OQG A;  1X3W B;  4XNF A;  1TNS A;  1OFC X;  3BWG A;  4HLX A;  3TW7 A;  1BI1 A;  1Y1V J;  1GVJ A;  4BE0 A;  4N9I A;  4LIT A;  3G73 A;  4OIP F;  1BI0 A;  3WG7 H;  3CC2 I;  2JUG A;  3ML6 A;  1QU3 A;  2Y0S N;  2DA6 A;  3DEU A;  4CCK A;  2DMT A;  3A01 B;  4E6K G;  2VKD A;  3G6E I;  2YUS A;  2JQ7 A;  1A31 A;  4ON0 A;  2EFQ A;  2E1N A;  3REO A;  3JSO A;  2NOJ B;  2NS0 A;  2M1B A;  3CCS I;  3M8E A;  3FMS A;  3GO5 A;  3OL4 A;  2QEX I;  1DU0 A;  5EEH A;  1D1C A;  4ESJ A;  1K4S A;  3E5X A;  2GBY A;  1LEA A;  5DM6 F;  2H94 A;  4ZTJ A;  2HNH A;  2XV4 S;  1IUY A;  2V1U A;  2OCE A;  2M45 A;  5C4J J;  1S3J A;  4CXF A;  3QP5 A;  5H20 A;  2ADU A;  2QGU A;  5F0C A;  4ZYH A;  3COA C;  2JUC A;  4F91 B;  4QSH A;  2F5V A;  2Y69 H;  4N4N B;  2VPL A;  5GTI C;  3AL0 B;  3ONQ A;  3CCE I;  3CMY A;  4JX6 A;  3WU1 B;  2HXO A;  2NXN B;  2RGV A;  4LG0 B;  4WF2 A;  2KQR A;  4U0Y A;  1XD7 A;  4L0Z B;  3DCF A;  3HKZ A;  3HRS A;  2NNN A;  1TWA J;  4LK0 F;  1RC9 A;  2XAS A;  3HUG B;  3U1D A;  1TWF J;  3WE3 A;  3C7J A;  3V8K A;  3F8C A;  1TWC J;  2F5C A;  1USS A;  2P5V A;  1RR7 A;  2GM4 A;  3FXK A;  3HRT A;  4BDZ A;  2JA5 J;  2Z5U A;  2HQ5 A;  4PK4 A;  1K83 J;  2B7E A;  4BJT A;  1ETQ A;  2YU3 A;  3I59 B;  3P7N A;  1H8A C;  2I8D A;  2ZKZ A;  2DW4 A;  5HLT A;  3F21 A;  2XAH A;  4E70 A;  4LJZ F;  3H9G A;  3I71 A;  1WKM A;  3LA3 A;  4ENJ A;  4KDP A;  3GTP J;  4XIC A;  3ZMU A;  3G3Z A;  3CO6 C;  3Q0W A;  1WJE A;  3WTW C;  4OMY A;  4PJM A;  1JKO C;  3OYD A;  1SFE A;  2HR3 A;  5CYV A;  2OPT A;  1IXR C;  5E1Z B;  2ELH A;  2KRH A;  3LAJ A;  2P5L C;  1Z6T A;  1KON A;  3SDG A;  1IZ1 A;  2H1L A;  3WTX C;  3CES A;  1R49 A;  1KQ0 A;  1P9Q C;  1S29 A;  4MLO A;  3J7Y J;  3KPH A;  2Y9Y A;  2VL8 A;  2DO7 A;  1FNN A;  3HJE A;  5FKK A;  2VT2 A;  3MVP A;  1FMV A;  1QO0 D;  3OYK A;  2Q0O A;  3A0B C;  3HOW J;  2G0E A;  4BNC A;  3JCU C;  3FK6 A;  1IG7 A;  3VB2 A;  1MIJ A;  4KN4 X;  2HDC A;  1MD0 A;  3QYB A;  5FLX Z;  3C2H A;  4RB1 A;  2GIZ A;  4DW6 A;  4P9U A;  1YS7 A;  5IP7 J;  5KCM A;  5DUI A;  2A6E F;  1PDN C;  3S15 J;  4F52 A;  2HS5 A;  5B3S H;  4KIB A;  3OOP A;  2MD0 A;  2W57 A;  3FBI B;  2JMW A;  3BZ6 A;  4L9T A;  5CQE A;  3TED A;  3OYG A;  3QRF F;  3B6A A;  3HIF A;  3PFI A;  5EG0 B;  5EEA A;  4MEY F;  3BG9 A;  2NOG A;  1RRJ A;  3ZR8 X;  1BI2 A;  1B72 B;  4FET A;  5GAH J;  5IYD J;  1K61 A;  4FQG A;  3HOY J;  4PJL A;  2P8T A;  4E7L A;  1ZKG A;  2RNG A;  3JW4 A;  1UG2 A;  2VOP A;  1UHS A;  2VQH A;  1DGR M;  2E2J J;  3TO9 A;  3ABL H;  1IN8 A;  3OSG A;  4RLF A;  1W5C C;  2AXT C;  2PJR B;  2ELK A;  3A0H C;  2DT7 B;  1ZAO A;  1FLI A;  1IUF A;  2Z99 A;  4ZYA A;  3MKY B;  2VQC A;  4PFO A;  3WGI A;  3WOD F;  2W00 A;  3N05 A;  2A07 F;  1Y0N A;  1YJ9 I;  2KMU A;  3E97 A;  2M87 A;  2PI0 A;  1ZHF A;  3L7W A;  3LFK A;  2L4A A;  3HSR A;  1YIJ I;  2WB1 A;  2FBK A;  2QLZ A;  1MMG A;  3X2Q H;  2KIU A;  5ERI A;  2OTJ I;  1OR7 A;  4OAY A;  2F48 A;  4D7M A;  4AYB A;  2R5Y A;  4UV9 A;  2LFB A;  2EFW A;  5JFR A;  4CYD A;  3BG3 A;  1QBJ A;  1ETV A;  3U1K A;  2R7W A;  1PP7 U;  3R61 A;  4F3Q A;  1JKQ C;  2K5C A;  4I99 C;  1H0M A;  1LJ9 A;  3GZN B;  2L7F P;  2EFP A;  4CCO A;  5CVI A;  5LFA A;  2DFI A;  2IS6 A;  3A1Y A;  2BVM A;  5D5W B;  5JR3 A;  1LNW A;  2GXB A;  4NC6 A;  2XAJ A;  1LDK B;  4C2U A;  3E5Q A;  3IH2 A;  2HZD A;  2HGC A;  3JRI A;  2F2E A;  5J6X A;  3C2B A;  4A3B J;  1WHU A;  3BJA A;  2XAQ A;  3CCR I;  1P2F A;  1Y0U A;  2X1D A;  3A02 A;  1U8R A;  1O7L A;  2IW5 A;  2O8X A;  1TWG J;  1MJ9 A;  2Z16 A;  3CJN A;  4D7N A;  1T95 A;  3EPZ A;  4Q48 A;  4JBA A;  5IT9 Z;  5FJ8 J;  4IJA A;  2R5Y B;  4GXO A;  4MTE A;  1IN5 A;  1SD5 A;  4FIS A;  1OR7 C;  4BBR J;  4EVI A;  1ZTR A;  2OZU A;  3MKL A;  1YG2 A;  2IJL A;  2KL4 A;  2LMD A;  3CMA I;  1JKP C;  2D5V A;  2LP0 A;  2M5W A;  1O3R A;  4RMN A;  4IVN A;  5KVR A;  2XF5 A;  2DI3 A;  2FX0 A;  1OYY A;  1Y39 A;  4EGZ A;  4KIG A;  1D1A A;  1Y6I A;  2KZG A;  4C3J J;  1AU7 A;  1I3A A;  3HSE A;  3GTJ J;  1MH3 A;  3OYJ A;  2RVC A;  1P4A A;  3TO7 A;  5KHD A;  2TDX A;  1IRZ A;  1DGW Y;  1POG A;  1OCT C;  3DBH B;  1ZLK A;  4IXA A;  5E20 A;  1RES A;  2LBF B;  2M8G X;  1Z05 A;  3GWZ A;  3VPR A;  1OCR H;  3QYF A;  5BOX A;  2LYC A;  2VXD A;  2FNP A;  2O5R A;  2L7K A;  5FFZ A;  2DOF A;  3GME A;  2L54 A;  3BR3 A;  2C6Y A;  5L3C A;  1T56 A;  3CJT B;  4A3D J;  4A3M J;  4GYI A;  2NVU B;  3BR0 A;  3J7A O;  2K9Q A;  4A69 C;  4XRS G;  1SVM A;  1OMI A;  1LDD A;  1Z91 A;  2ESH A;  3BDD A;  4BGD A;  4GRI A;  3W3C A;  3AG3 H;  1QNT A;  3FXO A;  2P81 A;  1VQO I;  4U88 A;  3TP3 A;  1YI2 I;  3U9G A;  2BBY A;  3H35 A;  2ZME C;  2COB A;  3OR1 C;  1XG1 A;  2VAS A;  5FLM J;  5ILU A;  3DTK A;  4U0W A;  2CFX A;  4EEF G;  1Z21 A;  1ZR4 A;  3CZ6 A;  3HEF A;  1BW5 A;  5HNH A;  2Q1Z B;  2IEK A;  3K4M A;  3GZ6 A;  5AON A;  3V7R A;  2UWM A;  1Z7L A;  4WWC A;  1AWC A;  3DF8 A;  3IRR A;  1CGP A;  3HXL A;  1YW8 A;  1P7J A;  2M9H A;  3NWT A;  1IDY A;  2L01 A;  2V9K A;  4RGU A;  3K70 D;  1BOB A;  1SMY F;  1ULY A;  2ZB9 A;  3GTO J;  2XB0 X;  5HDK A;  2VE9 A;  2A5Y B;  5JVT A;  4ESF A;  1W7P D;  4RB2 C;  1R4M B;  1ZRE A;  2V79 A;  1VTN C;  4ZDP A;  5A2Q K;  3HSF A;  3N4M A;  1ZH5 A;  4PJN A;  1Z67 A;  1YRN A;  1YIT I;  4CH7 A;  4DBQ A;  3L2Q A;  5AIQ A;  2XPU A;  1NK2 P;  2Q8K A;  3SFI A;  3J81 Z;  3JRA A;  2EWN A;  3C2G A;  2IS4 A;  2EV5 A;  4L0Y B;  4CZC A;  4A3E J;  5HS8 A;  1N78 A;  4LIU A;  4L18 B;  1U2W A;  3GFL A;  3IH4 A;  4H4K C;  1TTY A;  3W2W A;  4ZTF A;  5HDG A;  3BTL A;  1W36 D;  3K9T A;  1P4W A;  5E8G A;  2VJJ A;  1YO5 C;  3WG9 A;  1D0Y A;  2X51 A;  1EA3 A;  3QP6 A;  4B44 A;  1C0W A;  1MNM C;  1XN7 A;  2VKH A;  4M9S A;  1WRJ A;  4HAM A;  5J1U A;  2W4S A;  4UVB A;  1SFU A;  1YJW I;  1E3O C;  1HW1 A;  5C4X J;  2IGM A;  3GVA A;  2IA0 A;  2Y0M A;  3JRE A;  3D0S A;  2CFO A;  1GXP A;  4ZC3 A;  2KRC A;  1P92 A;  1LDJ A;  3I54 A;  4A5M A;  5ILV A;  2OCC H;  3LSK A;  3H9J A;  2K9L A;  4HX8 A;  2XC7 A;  3HTU A;  2XAF A;  2GIV A;  3OYB A;  1JGS A;  2LKS A;  1PJR A;  3RYP A;  2FSW A;  2DQR A;  2NVQ J;  1EJ9 A;  3ECH A;  3J80 Z;  2J5O A;  4M3D A;  3CUQ C;  4RB0 A;  3K4J A;  3IWZ A;  2F5F A;  1J9I A;  1E2X A;  4G6Q A;  5DTD A;  1DPR A;  1QZY A;  2H8W A;  1WZ2 A;  4LFU A;  2CS3 A;  1E0E A;  4A0Z A;  5LBQ A;  1YIO A;  4UUV A;  1TW2 A;  1YYV A;  4NHJ A;  4W1U A;  3DPU A;  1VZ0 A;  5K5O A;  3H9Q A;  4HST A;  2ZFW A;  2DOA A;  1NH3 A;  2DDA A;  4EMS A;  2Y9Z A;  1DP7 P;  2CUJ A;  5E79 C;  2HYF A;  2CV2 A;  4M6V A;  5ICG A;  5H2F C;  3DU6 A;  4DZP A;  2HTJ A;  1FJL A;  4ZH4 F;  5DV5 A;  1AKH A;  2B63 J;  5E3O A;  4CYC B;  4CDG A;  5LHG A;  3V4G A;  1OKR A;  2K3P A;  1ZAR A;  2CQN A; 
#chains in the Genus database with same CATH homology
 5DM7 F;  3CCR I;  3CD6 I;  1MMS A;  3G71 I;  3CCQ I;  3G6E I;  1VQM I;  1VQ8 I;  2JQ7 A;  4UY8 I;  1S72 I;  4V19 K;  3I56 I;  3DLL F;  1VQO I;  3CCV I;  2QA4 I;  3CCE I;  1YI2 I;  2OTJ I;  3J7Y J;  2E36 A;  4IO9 F;  1VQK I;  1Y39 A;  3PIP F;  3PIO F;  3J7Z I;  4IOC F;  5JVG F;  2NXN B;  1FOW A;  2ZJR F;  3CCL I;  5GAG J;  3CCS I;  1VQP I;  1YJN I;  1QA6 A;  1VQ4 I;  3CCM I;  2QEX I;  2ZJQ F;  2E34 A;  3CJT B;  3CCJ I;  2K3F A;  1VQ9 I;  5DM6 F;  3G4S I;  1VQL I;  1ACI A;  2ZJP F;  1VQ5 I;  1YJW I;  1VQ6 I;  1FOX A;  1YIT I;  2OTL I;  3CCU I;  1YHQ I;  5GAE J;  1YJ9 I;  2FOW A;  4IOA F;  3CC7 I;  1HC8 A;  5GAD J;  3CMA I;  1VQ7 I;  3CC2 I;  2H8W A;  3CC4 I;  3CME I;  1FOY A;  3CF5 F;  2E35 A;  5GAH J;  1VQN I;  3I55 I;  1YIJ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...