3CCQS

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 18
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ccqS00
1Q81T 4UY8T 4LIRA 2NZ4A 2KXNB 5DDRC 1KOOA 3CC7S 4WFAQ 3NNCA 3TYTA 2D9OA 3VAMA 1K73T 3UD4P 1M5PC 3MUMP 2CQBA 2MYFA 1U1QA 5MLCV 1X5PA 2L9WA 3VAFA 4YOEA 3IRWP 2XB2D 4WFNQ 2MKKA 2MQNA 2DK2A 2X1FA 2LCWA 1U1NA 5CXTA 1X4DA 2RVJA 2KT5A 2MZTA 3NNAA 3B4DA 3UCGA 2HVZA 3VF0B 2KM8B 1VBZA 2MQOA 3S8SA 2QEXS 3CC4S 1U1LA 3MD3A 2I2YA 3US5A 1VQ5S 1H2TZ 2EK1A 3EGNA 3J7YU 1PO6A 1FXLA 1UW4A 1WF1A 1WI8A 1YJ9S 1DHMA 3SDEA 1K8AT 2J0SD 5GADU 1SXLA 3THTA 5FJ4A 2CQ1A 3MI7X 1VQNS 5LXYA 2DO4A 4A8XA 3MDFA 1M5OC 4UQTA 2J76E 2KH9A 3G6ES 2DNKA 2ZJQQ 1SJFA 1YI2S 3B4MA 2N3OA 4WCEQ 2DGVA 3SXLA 2AYMA 2MSTA 5DM6Q 1X4AA 1SJ3P 4W92B 1DZ5A 5IQQA 5IM0B 2RT3A 4PKDB 1JMTA 2L41A 3LQVA 4V19X 1WF2A 4CH1A 1G2EA 2YTCA 2KXHA 2CPHA 1QM9A 2DISA 4IOAQ 1VQ7S 2U2FA 2EVZA 2K8GA 5LJ5Y 1HD0A 2X1AA 3EGZA 5IM0A 3EX7B 1WWHA 4Z2XA 4YUDA 2MGZA 4PR6A 1WHWA 5HO4A 1WEZA 3CCES 1Q7YT 3NS5A 1P1TA 2M8DB 4LMZA 2MY7A 1U6FA 4M5DB 1HA1A 1N88A 2F9JA 2D9PA 2KHCA 3P3DA 2M52A 2MKCA 2LXIA 2XS2A 2MZJA 5DM7Q 2UP1A 3G9CA 2LECA 2M9KA 3LPYA 2OSRA 1WTBA 1UAWA 2M88A 4TU7A 1VQ4S 2M2BA 1WHXA 2DGSA 2E44A 3R1LA 3IWNC 2DO0A 3VAHA 1U2FA 2KFYA 2OTLS 4EGLA 3BS9A 2CQGA 2DHGA 3G71S 2DB1A 1RK8A 2DIVA 2YKAA 2KN4A 4ZKAA 1KQSR 1H6KX 2PEHA 2RNEA 2DITA 5LJ3Y 1W2BR 2DNQA 3V4MA 2RS8A 2MKHA 2G0CA 2KRBA 5GVQA 3G4SS 5HL7Q 4F02A 3CCJS 2CPZA 1N54B 1X4BA 4IUFA 3S6EA 2DGQA 2DNNA 2DHXA 2MQMA 1A9NB 4PRFA 1X4CA 4Y0FA 4TU8A 2KM8C 2NLWA 3H2VE 2M8HA 2OIHA 2MMYA 4IO9Q 3CCRS 4U67Q 2LKZA 2N7CA 4BS2A 3CTRA 3TP2A 2KXFA 2YH1A 1H2VZ 1M5KC 5DDPC 3CCSS 4OZ1A 2V94A 2MKSA 2HGNA 1ZZFA 2AD9A 4C0OC 1WG4A 2RRAA 2SXLA 1WEYA 5IFMA 1NO8A 1QVGR 4WFBQ 2CQIA 1WG1A 5CYJA 4TLQA 4C7QA 4ERDA 1WF0A 2RQCA 2M4MA 2DHAA 2DNGA 2U1AA 2CQ4A 5GAEU 3MD1A 1PGZA 2DGUA 5GMKa 2JVRA 2LXUA 3G96A 2MGZB 1OIAA 1R8PA 1VC6A 1VBXA 2FPHX 2E5IA 4OZ0A 2LYVA 2KG1A 1D9AA 2DGWA 1OPIA 3CMAS 3P6YC 2Q79A 2JVOA 2YWKA 2BZ2A 2RU3A 2DNRA 1VQ6S 2G1DA 3MXHP 3JB9k 2XSFA 2MJUA 3UD3P 2B0GA 1SJ4P 1CVJA 3G8TA 2XNRA 4TU9A 2L08A 2BOPA 1WHYA 1X5OA 4FXVA 1YJWS 2OTJS 2RRBA 1VQ9S 2O3DA 2D3OR 1FHTA 2DH7A 4CIOA 2FHOB 2J8AA 1SJQA 5JVGQ 4P6QA 5BJRA 1NJIT 2MB0B 1FT8A 3CCQS 3FEXB 2OSQA 2DHSA 1X4EA 1XN9A 3CXCR 2EK6A 3S01A 3MUTP 2CPXA 2HZCA 2KU7A 1P27B 2KI2A 1QVFR 1JJ4A 3UCZP 1FJEB 3RW7A 3SMZA 2MQPA 5LSLA 3PIOQ 3VAJA 1R8HA 3NMRA 1KD1T 4Y00A 3H2UB 3FEYB 2ADCA 4LJMA 2MKJA 2MQLA 2VOOA 1FJ7A 1U1PA 2CPFA 5JVHQ 2MSSA 3BO4A 1VC5A 2WBRA 2DNPA 2M70A 2MY8A 2ERRA 1S72S 2LA6A 2DNMA 3NNHA 3MUVP 1U1MA 3MURP 2DGOA 2KG0A 3CF5Q 1H2UX 3PIPQ 1YHQS 3CCVS 2MJNA 3UWTA 2QFJA 3CC2S 2DH8A 2E5JA 2MKIA 1JJHA 2DNHA 5H1SV 5DETA 3D2WA 4ED5A 3TO8A 5GAHU 1U1KA 5D78A 3CCUS 2JRSA 1Q86T 1JJ2R 2KVIA 2MQQA 2CPJA 2MZQA 1WHVA 1BY9A 4RU2A 2YH0A 1VQPS 1VQMS 2LQ5A 1AUDA 1X5SA 1IQTA 2HGMA 2MZSA 1S79A 2ZJPQ 1URNA 2VOPA 4IOCQ 1DBDA 3RW6A 3ULHA 1WI6A 2MZ1A 3N9UC 2F3JA 4F26A 3I55S 2KRRA 3P5TL 3VAIA 2CQCA 3BO2A 3HI9A 3J7ZT 2MZRA 4QQBA 5DDQC 2RS2A 2N3LA 3ZZYA 1A7GE 5D77A 2LMIA 2KYXA 1HL6A 2LEAA 2PE8A 1M1KT 1FJCA 1F9FA 3Q2SC 3OW2R 2AYGA 3S7RA 2CJKA 2XS7A 3P49B 3CMES 3CUNA 3I56S 3CD6S 2CQ2A 3U1MA 1YJNS 2OJ3A 1WELA 2CQHA 2N82B 2GO9A 2DNZA 1N52B 3U1LA 5CA5A 2DIUA 2VODA 2CPYA 1X0FA 1VC0A 2CPEA 1YITS 2FC8A 1U1RA 2MHNA 2F9DA 2LA4A 3DXBA 1O0PA 2DGXA 2HGLA 4QPTA 2X1BA 4YB1P 4F25A 3VAKA 1WG5A 3L3CA 3VALA 1VQ8S 2XNQA 4J5OA 1ZH5A 3CPWR 2M7SA 3CULA 1M5VC 1WEXA 2VONA 2CQPA 2MPUA 2RQ4A 3UE2A 1U1OA 5LSOA 1U6BA 3G8SA 3CCMS 5ITHA 2RUGA 1Q82T 2DNOA 2J0QD 2ZJRQ 3VAGA 2DNYA 1OWXA 3CCLS 4C4WA 1UFWA 3R27A 1M90T 1X4GA 1DRZA 2AYBA 1KC8T 1HD1A 2DH9A 3R1HA 3NS6A 2QA4S 2HYIB 2LEBA 2FC9A 2ADBA 1K9MT 2CQDA 1YWXA 3HHNB 1X4FA 4WKRA 1X5TA 4QU7A 1FNXH 1VQOS 3THPA 2E5GA 2FY1A 1B7FA 3BEGB 3ZZZA 1OO0B 2I38A 2E5HA 2CQ3A 4CQ1A 2CPDA 3SDEB 5LXRA 1ZZNA 5EN1A 1VQLS 5DDOC 1FO1A 1NU4A 1SJRA 1VQKS 2XS5A 4WF9Q 2MXYA 2JWNA 1VBYA 2CPIA 5GAGU 4W90B 2A3JA 4FXWA 1X4HA 1YIJS 2GHPA 3DLLQ 3UCUP 3K0JA 1UP1A 1L3KA 2CQ0A 1YTYA 4WIIA 2K3KA 2DNLA 2DGTA 1D8ZA 3Q2TC 1N8RT 1KOHA 1RKJA 3MOJB 4QU6A 2JX2A 2M0GB 2G4BA 4CH0S 2AYEA 3BO3A 2X1GA
chains in the Genus database with same CATH superfamily
2BKPA 1RLDA 3DYAB 4USUA 4ZCMA 3PX6A 2VU5A 4KB7A 4UY8T 4CLSA 4G3IA 3QZ8A 2KXNB 3GCXP 2RU9A 1N5YB 3CC7S 1EJ7L 4WFAQ 1YZ7A 4B3RF 2CJQA 4HH1A 5D0HA 1PC5A 2XULA 3UD4P 4PWDA 2IJRA 1M5PC 2F4FA 4OHVA 5DLGA 2CQBA 3H5SA 2YWFA 2MYFA 1GMUA 5L1IA 2Z2YB 1VK3A 1W26A 4UUWA 1HNVB 1NDCA 1XTZA 3TQ1A 1PILA 2AJ4A 4OI0A 4U95A 3BYRA 3CE8A 4WFNQ 4FNIA 2DK2A 2FGOA 1NAQA 1X8DA 3IM9A 3ITHA 3QWUA 5HAOA 1U1NA 5HJYA 1F5AA 2JOQA 2FLOA 2BVZA 3JYTA 1FKPB 1EB0A 1YK9A 2ZWPA 4HVZA 3OVBA 4RBUA 5A8KB 1UA0A 1T8EA 3IG1A 3D6HB 1VBZA 1SC6A 4PQUA 3V2UC 3MR5A 3QNWB 2HHWA 3FRYA 3PCOB 1V5VA 3CEDA 4ED7A 5KG2A 3US5A 3N01A 2IC3A 3AD7C 2RKIA 2AHOB 2WTFA 4IOBA 3MWBA 5AE3A 2EK1A 3TZYA 1NB7A 2YX4A 5HQLA 2JEFA 3OFHA 1EKSA 2W4DA 1T9VA 1PO6A 1KNZA 1N0UA 4IDKB 5F41A 1EQMA 1UW4A 5DZ7A 4C97A 1S1UB 1T3NA 5B0EA 3SDEA 1PKUA 3LAKA 2F4VF 4CM2A 3TJ9A 4CDIA 1RHJB 2POKA 1UPMB 1SXLA 1GX5A 4DV1F 2J0SD 1ZTWA 4V19J 1TQLA 2CQ1A 3LO3A 4I6YA 4RNMA 4I69A 1TK8A 4G1IA 1V3SA 2GQCA 1M5OC 4NLPA 1NCLA 2YKPA 3ENQA 2DNKA 3AJ1A 5KFWA 1JLFB 4X65F 3HPOA 2J0XA 3DU5A 4MFBA 5DG8A 4NYPA 4KKOA 5I4MA 4K7QA 2D1CA 3MM9B 5SZTA 2RHQB 4USVA 1T0TV 2XSJA 1VJQA 3IBWA 1X4AA 2WK4A 3HJFA 1DZ5A 3NWGA 2R7TA 3HDSA 1RT2A 2QIFA 5C7PA 5D8HB 4HYKA 5KG3A 4C6AA 2L41A 3PXGa 3LQVA 4V19X 1YZ6A 1WF2A 3IN5A 1K44A 1HQEA 3I0SB 2WOMA 4DU7A 2BJ1A 1B0VA 1BHNA 2F7VA 3GYNA 3G8QA 3UNYA 4X64J 3C14B 3ZO7A 2EWHA 2YNGA 4IOAQ 1K0VA 2EI5A 2OLWA 5T14A 4YR0A 2IVFB 4WPAA 5LJ5Y 5LL6d 3J7A1 2XSJB 1IKYB 1PJ6A 3KDOA 3MCMA 3H7HB 4G1QB 4P9SA 1TZ0A 1RHRB 4CCHA 5IT9Y 4IFVA 1TL7A 2ILYA 4Z2XA 2MGZA 3A3PB 1NZ8A 3OTDA 3GILA 4ZOSA 3D1HA 1WHWA 4KR0B 1Q78A 3WIVA 1ZAVA 4HACB 4ZVHA 4JI3J 2OMOA 3BV8A 3M32B 3Q22A 1RBLA 4PG4A 3KMSA 2M8DB 4LR9A 3HVAA 4J9MA 1PSDA 1U6FA 5DS7A 2XCPA 1HA1A 3C16A 5FDLB 3JSRA 4K8RA 1NDKA 1RBAA 2AX0A 4C0BA 4B9LA 2DR6A 1C2PA 3HKWA 2Y8WA 2D9PA 1QUVA 2W8LA 2KKHA 1BUXA 5DM7Q 1JLEA 2FB0A 3RR7A 4ES2A 2LECA 2M9KA 1S59A 2ALZA 1BE4A 1WC3A 1RWOB 4LF2A 1WTBA 2ACMA 1AXQA 5J1NA 1RZMA 2DY9A 3I82A 4ZLLA 4TU7A 3UW1A 1VQ4S 1ROFA 3I96A 4RU9A 2M2BA 4B02A 1WHXA 2E44A 2V5HG 5AXKA 2HHUA 2YNIA 2O67A 4OIXA 2ZDPA 1RT5B 2ZHAA 2ASJA 4X4VA 2BJ9A 1HBOA 1DQ9A 5KFAA 5K8OA 4OL8A 4WZMA 4ZVQB 2ZVIA 2C3OA 5HQ8A 1U2FA 4ANEA 5ETKA 4K0KF 2IVYA 3G6XA 3RR8A 3VGTA 4V1Ak 1EAYC 1Y3KA 4DV7F 5A6WA 3AA8A 1CC7A 5CAAA 5IV3A 1UWAA 1UWBA 2GHWA 4TYAA 2WVFA 3BPSP 5BYQA 2UU9J 5IQ6A 4HHUA 4FBUA 4B08A 3OXLA 3LA0A 1KEKA 2YKAA 2EXUA 4K59A 1XEZA 2HKEA 1SB6A 3WX4A 1HNVA 1IVZA 2PEHA 3ELHA 1REVA 4ALZA 5HMWA 2DNQA 4A8KA 3AD8C 4Y3CA 1KLMA 1FTCA 1FDDA 2R7UA 4OJ1A 4NLUA 5KG7A 3FZ2A 4KGZB 4BC7A 4DUYF 2F8MA 4DUZJ 1J5EF 2VKRA 5A2QU 4J9RA 4JYAJ 3DRSA 5HL7Q 3CCJS 2F5GA 4A46A 5D4OA 4EYHB 5A8KA 1TK5A 4ICLB 1N54B 1EP4B 4DR7F 3KJVB 3KLEA 1TL7B 4NX9A 4LFBF 3I5CA 4S0MA 1SKSA 3QGGA 4DSFA 3GMGA 4ZVEA 1BQMA 1VFJA 2DHXA 5L39A 2FHJD 3WQPA 4Y0FA 5A2QY 1V3ZA 3JAMY 4TU8A 2Z58B 3A8IA 2P6TA 2RAQA 5H9FJ 3UQSA 3WC2A 2KJWA 1TL4A 2MMYA 3M2UB 2HNZB 3M8WA 3I0SA 4JOUA 4U67Q 2LKZA 4LR7A 1UZHA 1HNIB 4LVOP 2AMCB 2ROPA 1DFDA 3FNNA 4M5GA 1TL3A 3QJPA 4IQXA 3SSQA 4XIUA 2K7JA 1IWAA 2XWXA 3FFIA 1CJKA 3I9V9 4I7FA 3MAQA 3I87A 2H4WB 3DDKA 3NLCA 1NDLA 5DDPC 3CCSS 4AL7A 4OZ1A 2V2ZA 4C8YA 2V94A 1Q16B 2MKSA 3MPWA 5B09A 4URQU 5K5MA 5E41A 2KZMA 4K4ZA 4WU3A 4CWBA 2RRAA 3AOAA 2QJ3A 4KIAA 4OLOA 3L7UA 1NO8A 1C0UB 3W63A 4KRWA 4WFBQ 3Q24A 4ED3A 1FRKA 4KSEB 1QVGR 1L3TA 2C2MB 4ERDA 2L48A 3QGHA 5KT6A 3NGDA 3BGRA 1JLAB 1YQHA 2HS4A 2WZ1A 2K1RA 2BYCA 1P8GA 4JB8B 4M5DA 3KJVA 3HT0A 4M5MA 4OLPA 1UWBB 1N33F 2DGUA 3NCQA 1QDUB 1RAIB 1S6OA 1DTTA 2R7OA 5CYMB 2OHDA 2OPPB 2CJAA 4W98A 3RZAA 4Z37A 3V4IA 4B9UA 4B3OB 4LF7F 4OJGA 3PW7A 2AJ2A 4R0JA 3W61A 1SUQB 4FF2A 3MMAA 3P96A 4MYTA 4OZ0A 4YDDB 3ZNJ1 4YQWA 3VHQA 4QW9A 3RRHA 4B3MF 2ZZNA 1D9AA 1F3VA 2ZVSA 3GPAA 1R27B 1IR0A 1RT5A 1FTRA 2Q79A 4YY3J 3HVRA 1CPZA 1IKXB 3R7SB 2RU3A 2DNRA 3LP1A 1XERA 5ETOA 1F0XA 4KHRA 3Q8YA 1NSQA 2ZH1A 3V6DA 1N0VC 5H9EJ 2UVUA 2A2CA 2W25A 1VCTA 1TELA 5B0CA 2XEXA 2DJWA 5E2QA 1NM2A 2QYGA 4HEA9 3PYDA 4UOGA 5T7LA 1YIJS 1X60A 5KT4A 4J37A 4ZS6A 1SL0A 1WOPA 1IBMJ 4JI4J 4GC7A 1MLAA 3C16B 4WYWA 3MMJA 5FD1A 4DQSA 1J2VA 1TP7A 3G8TA 2J5AA 3N28A 2YQ0A 3HHLA 2YQ1A 1UTAA 1R0AB 4CO2A 4B3RJ 1R43A 2OO4A 2OEKA 2MLXA 4ECUA 3SIPB 1N5QA 4KHPF 2XZDB 2ZNYA 3GJQB 4YS2A 3MMCA 4FYXB 3BGFA 4G1QA 4DFPA 2OTJS 2OPPA 3VWSA 3GV8B 4LF9F 2FQQB 3PG9A 4YR2A 1DY3A 2O3DA 2D3OR 1FHTA 1N48A 3M1VB 2FHOB 4HHHA 1EZZB 3AY0A 1CJUA 2IAJB 3TR5A 1H74A 4X4UA 5BJRA 3V5RA 3M9OB 1FT8A 3R5BA 3SQGB 2HFOA 3AD9C 2C2OB 1S0VA 5DJBA 2HPUA 2BV3A 4WP8A 4DR6F 2L9DA 5DG7A 2CXEA 4AL6A 4PXBA 1IBKJ 3TZXA 1QVFR 1FEHA 2DXEA 1JJ4A 3T9ZA 3MMBB 3OT9A 5EHHA 4DFKA 2BANA 2GFFA 2IBOA 4PZVA 1Y9OA 1QAJA 3NMRA 3OL9A 3WDOA 2ZH8A 4OX6A 1NK0A 4ZN3A 5HVGA 2ADCA 4U6PA 1H98A 2QE5A 2MKJA 1BWVA 2MQLA 1FXRA 4HT7A 2VBYA 4ED4A 3CD0A 5JVHQ 1VC5A 3BO4A 2BACA 2VPZB 2M70A 1YDLA 3LP1B 2ERRA 3O6QA 4ECWA 1QD1A 3LWMA 1YRUA 2G13A 1V3RA 2QYCA 3EGWB 3PTWA 3MUVP 3RAQA 1RYSA 2IY5B 3KG1A 3LGNA 2ZH7A 3H0PA 4M8LA 2HWIA 2ZOMA 3BKUA 2Q6BA 4KAIA 5KG1A 3MGJA 4IH7A 1F5CA 4TYBA 2F8EX 1P6TA 2MJNA 4OYAA 1N6QB 3IGVA 3C6UB 2W2OP 4CYUB 1FJGJ 2VF3A 2LXFA 4C48A 3CGIA 1FVQA 1YJTA 1R0CB 5J2PB 3T1YF 2ZC3A 3Q23A 5K14A 3PACA 5EX0A 1KQGB 1XR5A 2ZZMA 1JX4A 4QR0A 1GXUA 3QRQA 3D2WA 4M5HA 2HQIA 4ED6A 4ZP7A 3TAMB 1PAUB 1NBEB 4DL0C 5GAHU 2CZVC 3V6HA 3G2XA 2JRSA 3AJDA 3BH7B 1XK8A 3D28A 2MQQA 4WBFA 2VHGA 2FJXA 2BOAA 2MZQA 1WHVA 3KUHA 5IT0A 4X4OA 2Y1LB 2YH0A 1OYEA 3BKTA 1HWLA 2HLUA 2HQCA 4QR2A 5DO2A 1L5UA 2KZZA 4A48A 3OVAA 2HGMA 2V8VA 1AW0A 2VOPA 1CQNA 3FC9A 5HVFA 2LU1A 2OMLA 3HVTB 4KPCA 4CH7A 4YMEA 4ZCIA 4IOCQ 4JI2J 4LF8F 2ZBIA 2V63A 1HWKA 1JLCA 3POTB 2B43A 5CQGA 2IHR1 3R7BB 3CJ0A 4ITSA 1HNIA 4DQQA 3RAXA 2F3JA 2OPRA 4JV5J 3MM7B 1TAQA 1I3OB 2COLA 1H3DA 3MECB 3NOGA 3OXFA 2J7KA 2MKYA 1IUJA 1FKOB 1HW8A 3BGUA 1U2RA 3HFKA 3M2RB 1FRXA 3IFEA 4JI2F 1LQ9A 5EX3A 2MLYA 2G2OA 4X4TA 3HHLC 2HHHJ 1UJ5A 3FZBA 3H5UA 4KY3A 2OFGX 5DDQC 4RNNA 2BDPA 4LF6J 3KXDA 1HBUB 1A6LA 3MEGA 2XY5A 2LMIA 3U02A 2KYXA 1VISA 4KYZA 1HL6A 2HWHA 3GIRA 4ZJLA 4X66J 3D68A 3WBZA 1M1KT 4K4VA 5KFEA 1RAHB 1F9FA 3VCDA 1RABB 1TUVA 1BXNA 1GT8A 1ZM2A 4ATNA 1ZAWA 1P9YA 1U09A 4Q2LA 4WFXA 1L3UA 2GJFA 1S77D 1NPPA 4IFVB 3TAQA 3K17A 4K4UA 1LWCB 1V9OA 3FCHA 3UDCA 1HWUA 2BE7D 1GFWB 5HMZA 3TUPA 2CQ2A 2R7RA 4OI4A 2C22A 3OXGA 1YJNS 1WELA 3T5LA 1FFGB 2AIRB 4ZDNA 2J6TA 3K59A 2NUUG 2AF6A 1VIOA 3A8KA 2VG7A 2CPEA 3W3SA 4NA1A 3ET6B 1RTIB 2LA4A 1V6HA 2E9RX 3DXBA 3TARA 1RT1A 1S6PA 4JI6J 3KWMA 2DGXA 3QRPA 3OVSA 4F25A 5HLFA 3KTQA 4C8MA 1WG5A 1UETA 3I5AA 2HVDA 3HM9A 1HBOB 4DV3J 4DSKA 4L6V3 5BYRA 3CSKA 4OHYA 4TXSA 1Y3JA 2ZKTA 3DKDA 2MPUA 4DL4A 2D69A 3NBPB 3TAPA 1MSWD 4YHHJ 5KFQA 3CCMS 1T94A 1VOMA 2Y1JA 2J0QD 1GXLA 2HNDB 1W2IA 3MHYA 5EDWA 3KLGB 3EJMA 2ZJRQ 3VAGA 4HT5A 3R6LB 1UFWA 3C3LA 2Y8YA 4Y65A 1Q8LA 3CIMA 5ETLA 2HBRB 1DRZA 2GZOA 4OX9F 3JYTB 4CO1A 4Y6IA 1KC8T 1AZSA 3QSYB 4TN2A 5A6PA 4DR2F 4FYDA 1SPBP 2EBGA 4ZJOA 4NRTA 3OL7A 3M05A 3CJKB 4RNOA 2FC9A 3M30B 2ZH6A 2YNIB 1K9MT 2CQDA 2EFGA 3HD2A 1Q79A 3BSAA 3HHNB 1X4FA 4WKRA 4JI5F 1X5TA 1FNXH 1XMQJ 1F3FA 4RUAA 3UVJA 3K5NA 4DR2J 1RU2A 1C4AA 3BEGB 2FZCB 4K4SA 3DGPB 3ISNC 2E7XA 4PXEA 2E5HA 5D6GA 3BZQA 2CQ3A 4ES1A 3TX0A 4DV4J 1CULB 3EXYA 4ER8A 4KT0C 2XZWA 3EDRB 5KFBA 2XMVA 5CABA 2UXDF 2E5LF 3HZEA 2ZEJA 1UJ4A 1VQLS 1ZA1B 4OZJA 5KFMA 4WF9Q 1HHSA 3D1OA 3M6UA 5IWAF 2HURA 2YPZA 1TK0A 4P7TA 4RW8B 4LBPA 1F9EB 4OHWA 4ED1A 1NPKA 4O0NA 2ZBRA 3KG0A 3Q8SB 1X4HA 5DQIA 1TL3B 4DL6A 2UXDJ 1Q1KA 5THWA 4WIIA 3O1LA 3MFHA 2HZVA 4PUOA 4OZLA 3KK3B 4DV4F 1D8ZA 1B4SA 2FJEB 2BBEA 1RKJA 1SH2A 1TKXB 3ENAA 4QU6A 2E1RA 2IFXA 3DHXA 4DFJA 1RACB 3RTVA 3TZZA 2ZJPQ 2M0GB 5C25B 3IRXB 2AYEA 4F8RA 4WXWA 4U7UD 1VLYA 2XMTA 3F41A 4M5NA 2HSEB 1Q81T 2CJBA 3T5JA 3V6DB 3M2RA 4FYVB 2AJFE 3PVXA 2N4DA 1MN7A 4GVBA 2CDQA 1KOOA 2ZC4A 1RHUB 3ZC4A 4R8UA 3NNCA 1IKWB 3B82A 2D9OA 4PXCA 1N34F 2R8IA 2BA9A 3MUMP 2XTJP 4YB7A 1W2BR 4U8YA 5EWEA 5H9EK 1X5PA 2YKOA 3I5BA 2CG4A 3M30A 4DZDA 4C3LA 4LF5J 2RE1A 3NAHA 5E0OA 2UXBF 3K58A 4YOEA 1OMSA 1OY8A 2MKKA 1SQGA 2OKQA 4LT6A 2DXDA 2VD3A 3F56A 3LW5C 1S10A 2YPYA 3C15B 2X1FA 4RW6A 4ETXA 5CXTA 4YB5A 2FVRA 1X4DA 3CMQA 1U8WA 2RVJA 3OL6A 1UVLA 3MM7A 5I42A 2K7KA 3PJWA 2UVWA 1VJWA 1EX8A 3UCGA 2XMMA 4ZPWR 1FNOA 1QY7A 1REGX 2Y0BB 2DEIA 4Q7AA 3U7JA 1VK8A 1EQ0A 2GAHC 1HNZJ 2KDOA 1R8BA 2YWHA 3S8SA 1S0NA 4ZHRB 1FX2A 4DUTA 2ZNZA 4H54A 3MD3A 4JI7J 2B56A 3MZIA 4DQPA 3K5PA 1PYOB 1TV6A 3E51A 3PDNA 1BMQB 2VFVA 3FEZA 3HT3A 1VQ5S 2VG5B 2VZ9A 4K4XA 1NKBA 2GMHA 1S97A 2Z4PA 5B0DA 4ZLJA 1RTJA 3UD5A 3VV2B 3J7AN 2ILZA 1MMLA 2IBKA 2PDAA 3PEJA 4DV0J 2OELA 1WI8A 6FDRA 5HROA 3UN2A 2M5YA 4DWIA 1GMVA 2VBZA 1RWKB 1JK9B 1MG7A 4FKXA 1IR2A 3UPFA 5E7OB 5GADU 1KWMA 4JBCA 3THTA 4JV2A 4LIWA 2FVQA 3ZZPA 4LRAA 1QUPA 3UR3C 4G1PA 4DPOA 4A8XA 1RLCL 1CULA 2XM3A 5M2UA 2W7AA 1GNKA 2CVEA 1IXKA 5J2NB 4K5RA 4NYZA 3ZZTA 4OYOA 3G6ES 2A1BA 4DV0F 2C3YA 1Q7LB 4DV6F 3AOCA 1TL1A 2CJYB 1ZYQA 2PFDA 1SJFA 2GMLA 2WW8A 5K9FA 4ZK7M 4Q8FA 4J9LA 2RIJA 3E2EA 4NLSA 2VA3A 4PCQA 2BJDA 2G0JA 1Q0NA 1BGXT 3LGHA 3PJ9A 1IBKF 3CW2C 4NRUA 3DLGB 3I0RA 2N7YA 4FPRA 4K0KJ 2AP6A 1D0EA 1LKZA 1GX6A 3R6GB 1X31C 2W2NP 3DRRB 1AB8A 3ISND 2YTCA 3QSIA 3DDNA 1NHVA 1N32F 3BBFA 2AW0A 5GAEI 3R5JB 1M0SA 3OLBA 3LWLA 3MR7A 4LBIA 1VQ7S 3DGPA 1RTHB 2EVZA 3RB6A 1HD0A 2X7IA 1SV5B 2ZBCA 2HNDA 3CJ5A 3DN9A 4J9UE 4XAKA 3AQPA 3KHRA 4YHHF 3Q86A 1BQNB 1NKEA 2ZH2A 3A4TA 4OYXA 3MPUB 4I2QB 4OHZA 1HHQA 1I5OB 3G87A 3T5HA 3CDUA 2HFUA 3WC0A 2C28A 4P2XA 1QSSA 4Y28C 1S12A 3HHLB 2PEBA 2J8SA 4ECVA 4ANCA 4I2QA 4YDXA 2JFKA 2E29A 1WJ9A 2JLGA 1N88A 1HW9A 3EDQB 1DURA 2JJ4D 2LXIA 2MZJA 4OI2A 3R7NB 3A3NB 3NG8A 1TR0A 3KG4A 4EEYA 1TAUA 3LPYA 3EZ5A 2OSRA 1WTFA 2WCXA 2XMUA 3JTOA 2PT0A 3SFUA 2E1PA 2V4QA 1RWMB 2B9YA 1S9EB 3R1LA 1HIYA 1VHIA 2AQ4A 4USMA 5HATA 2XWYA 4ID8A 2O5DA 5DGAA 2VC0A 3W66A 1A0OB 4QIEA 3ICLA 3M2VB 1SIZA 2UVVA 3MPDA 3H5XA 1KTQA 4FDFA 3NRBA 2HQ3A 1DLOA 3HO1A 1HNWF 2QLBB 3NY0A 2C2DA 4EGLA 5JJBA 2FLNA 3A8JA 3QT8A 2VQFF 5DGBA 5LMUF 3NXZA 2BW7A 2DHGA 4KO0B 4PAAA 4DPYA 1HHTP 3ZTQA 1TFYA 4DZ6A 1KHVA 2YVSA 5IS2A 3IWXA 2HMIB 5G4DA 4DR4J 4ZKAA 1HQEB 1KQSR 2ALYB 5F8JA 1FDNA 3IBCB 2WSCC 1H6KX 3VGVA 2XMWA 1HWIA 3L95X 3W5ZA 7FDRA 1RUSA 2RNEA 2DITA 4F4YA 2IYGA 4TLRA 1F6TA 3DC2A 4FNHA 4I68A 3PYEA 5AXMA 1PCAA 2G0CA 4K5SA 3BH6B 4P74A 2BQRA 1L3VA 1KRPA 3G82B 1IKYA 1FA0A 2BM0A 4U9RA 1LEOA 1SV5A 4DV7J 1RT1B 1S6PB 2RILA 2CPZA 1TL1B 1UVKA 1P1LA 4I2PA 5J1EA 3DRPA 4OX8A 2NXJA 4F67A 1UA1A 2F8HA 2DGQA 1U0HA 1DQ8A 2MQMA 4FVCA 1X4CA 2LU2A 3GFXA 5T7LB 2ZUGA 4ENOA 4DSLA 3BQ0A 3PR4A 1U48A 1MROB 5CZVA 3GIKA 1ZA2B 4EZ9A 3IA0A 1LWFA 1S1VB 1MMNA 2NLWA 2IAJA 1DLOB 2P9GA 3C19A 4QJVA 5F8LA 4IO9Q 3HK2A 2HK2A 2VFUA 1NB2A 3DOMA 4GVLA 2N7CA 1FXLA 1EARA 2Q3PA 3NAIA 3IR7B 3QO9B 3CTRA 3MTJA 4BCAA 3M9NB 3QRRA 1KHWA 2IMOA 3OJSA 4A8SA 4OZNA 2J6UA 1NH8A 2RHSB 3RB3A 1FNMA 3CJ4A 1RQ0A 4P2SA 1RTDA 1M5KC 2DT9A 4F3OA 5RUBA 1T3OA 2QLXA 2AU0A 2HGNA 4M63A 2X3GA 2KT3A 2KYZA 4MIAA 4ECQA 1ZZFA 2AD9A 5KFZA 1JWWA 4UF4A 2IVMA 1WG4A 4X65J 4A8YA 2NCKL 1YLXA 5I3UB 2AJ1A 2SXLA 1VRQC 1WEYA 1NZAA 2QL9B 3MAHA 4HI1A 4IH6A 5LM7E 5KFJA 4DFMA 1WG1A 3DOMB 3I9ZA 3UN3A 4C7QA 5CYJA 5ETRA 5HI7A 2H5IB 2DHHA 5K8MA 2M4MA 1T03B 4AQYF 2DHAA 2DNGA 2EFOA 3N5BA 2AJ0A 3PNIA 4NLXA 2YWWA 1IM6A 5GAEU 4JI1J 2V8PA 3T41A 3M8PA 4LQ3A 2DD8S 1C0TB 4DCPB 5GMKa 2HK3A 2P2CB 1LK5A 3G96A 2AZ1A 1OIAA 3D66A 1OQ3A 4HHJA 1VC6A 3H8YA 3D0GE 4C0HA 1VGYA 2FPHX 2E5IA 2NXUA 1VBXA 3H42A 1RGVA 1Q4RA 2LYVA 2I5JA 2NYHA 2QO3A 3MR3A 2WONA 3C6UA 2GGPA 4OFZA 3BSNA 1OPIA 2XBPA 2CZ9A 4J9KA 4DG1A 3CMAS 1LK7A 1B64A 4BWMA 1RA6A 2JVOA 2HBYB 1VHFA 2YWKA 4P7VA 3KFWX 3PW0A 1BQNA 2HHTA 2PO4A 2H48B 2XQCA 2BJ3A 5K20B 2G1DA 2CNLB 1TKDA 2MEWA 3D67A 4NASA 1YBUA 2ROEA 1X9MA 4M5KA 1NK4A 1S76D 4UTGA 1UVNA 3MAAA 3KK2B 2V4RA 4ILRA 1HFEL 2MJUA 2V8GA 3LOUA 3UD3P 2GW8A 1N5TA 4MMOA 1SJ4P 2EG2A 2CADA 5L9NA 1TKXA 2CDRB 2GV1A 1LWXA 3DOLB 4UQGA 1CVJA 2PFFB 2W4PA 2XNRA 2HBZB 4TU9A 1KFSA 2L08A 2CRLA 2EFPA 1MWYA 3M32A 5E3QA 2BOPA 2EFVA 5HMYA 1WHYA 4LQ9A 3GV7B 1S1XA 3W8GA 1I1GA 4ZVFA 1RI7A 2JEGA 1B0PA 1TMJA 3Q89A 2C2RA 2IM1A 4FP9A 1CLFA 4DXLA 1X5OA 2BKNA 2PD1A 4I7FB 2VQEF 1IBMF 2YNFB 3MEDA 4O0IA 1ZTTA 2RRBA 3H90A 1Q5VA 3M9MB 5KFLA 4IO1A 3K57A 4DLEA 1XWLA 3DOLA 2DH7A 2XY7A 4JI4F 1KBRA 1U24A 2AYGA 1VRUB 2J8AA 3DRPB 1HQ2A 4JI1F 2HS0A 1TKTB 4NLGA 2UUAJ 3NGKA 2KFZA 3ZXWA 1NJIT 2E7VA 3EM1A 2VQEJ 3FEXB 3C6TB 3H98A 1T9XA 1O6XA 1KFDA 1WOOA 2L9NA 3MM8A 3S1TA 1VDHA 1CJVA 3SCJE 5C42B 2XC9A 1ZETA 4IDKA 3MM9A 1EKRA 2NS1B 3N0VA 2CPXA 3MUTP 3HFZB 1VQNS 4F4WA 3GJSB 3ILIA 1TUGB 4ICLA 2Q66A 1NK5A 1AFJA 2DRDA 4I1TA 2GS8A 3GB0A 1FJEB 2XG8A 3TW0A 1F2GA 2NXEA 2QL5B 5LSLA 3OTBA 1IQZA 4PYAA 1KD1T 3CCZA 4CLPA 2QLWA 3TRGA 1T95A 3TQEA 4LF5F 2RUSA 5HP1A 2W8KA 3P4UB 5D4PA 3J81U 3KLGA 1FJ7A 1WOSA 5F0WA 3RYLA 2HFNA 3OJUA 2DNPA 4HH0A 1HD1A 1QTNB 2MY8A 4L3NA 3MOZA 2LA6A 4P52A 1LNQA 2MLZA 1LXNA 1FXDA 2QMWA 4KQZA 5D15A 4EWTA 2DGOA 2KG0A 3CF5Q 3IC1A 2JFDA 1E6YA 2IRYA 4PEOA 1D1UA 4WFYA 1HR0J 1LFWA 5CHCB 1AFIA 1NK8A 4JI8F 4JV1A 3L4BC 1JLQB 1KONA 5CYQB 4KGXB 1T11A 3UWTA 1XMOF 4XTTA 3HSZA 2DH8A 4DN0A 1MWQA 4E8UA 3Q8UA 4DR5J 3CVKA 1MN9A 2DNHA 3ZZOA 5HMXA 5M2RA 5H1SV 3H4BA 4ZPTR 4AT1B 1SCJB 2C2ZB 1WSVA 3DLJA 1RTIA 2MDAA 3EMTA 3DLHA 1U1KA 5KFHA 5D78A 1Q86T 3MPVA 5KT3A 3UDEA 1JJ2R 2GNKA 2JC0A 4DPXA 2HQFA 3PEHA 4RL1A 3KMQA 4I6AA 3K5LA 2I6WA 2J7WA 1VQPS 3HP6A 2LQ5A 2KVQE 1AUDA 2VIHA 1X5SA 5KT2A 4C8ZA 1IQTA 2MZSA 2GQ2A 2Q43A 1ZPWX 4RW7A 3KHHA 1NK7A 1URNA 2CIMA 2YX1A 2EC2A 1RHKB 4RW8A 4LF4J 3RW6A 2NQPA 1WI6A 2MZ1A 1FRHA 3M8RA 2B51A 2C2NA 2HRTA 2V8DA 3MM6A 1KVIA 1GTHA 4KH0B 2GJ2A 4F26A 3BGRB 3PV8A 4L72B 3I4HX 4MKYA 4RPFA 3VAIA 4USKA 2CQCA 1RCXB 2OFHX 1RJJA 3RBZA 2EPIA 3HI9A 2IYIA 3DRRA 1QAYA 3FVYA 3J7ZT 1PYTA 2RS2A 4OJ3A 5E33A 1LXJA 2HAIA 4OZ5A 5L9XA 3ZZYA 1A7GE 4DEZA 5IZHA 2B4VA 4I6WA 4RW6B 3PO4A 2OPQB 3HHDA 3DOKB 1NEEA 1BLUA 2G1HA 4Y2AA 1JXVA 1FJCA 2ZHOA 2YNHB 2B3TB 3FFIB 4URSA 3R9LA 1RWUA 3HXMA 1TTHB 4M5JA 4ETZA 2FLPA 3DCAA 3OTEA 4EK2A 2A18A 3PJXA 4BLGA 2OUGA 4Q43A 4EMDA 4FS1A 1Z2LA 5B08A 5KFCA 1X9WA 1XNQJ 2XS7A 5J2QB 2W24A 3H2LA 3CUNA 2VFRA 4ZP6A 2LEPA 5KG0A 2PI4A 1R31A 3U1MA 1XJWB 4D3GA 3J7Z5 2HHXA 4EO8A 3DLBA 1REVB 1XR7A 2CQHA 3FSYA 1CC8A 4XPEA 2YX7A 3U1LA 2J9EA 5CA5A 4MH8A 2LDYA 2CPYA 2WSFC 3QAUA 3OV7A 1HI8A 1YITS 1VR6A 1WC6A 1U1RA 1VC0A 2FZKB 1R7IA 1LW2A 1Y11A 2F9DA 2RDIA 3IGNA 4N5SA 4ECTA 3H59A 4DHVA 2J0WA 3J81j 2HGLA 8ATCB 3T19A 3U27A 5DG9A 1N5VA 3VAKA 2HZAA 2VH7A 1GMWD 5AJ3F 1SUQA 2CZ4A 3M8QA 2AZ3A 3OBIA 2NPFA 4CYUA 3W2WA 5EGYA 3L3CA 5KFUA 2GAGC 3VGUA 1HLWA 2OH2A 2QTWA 1ZH5A 2PN6A 4ZPBA 3TVYA 3CPWR 3OFGA 4RNHA 4KTQA 3CULA 2B4PA 4O3NA 5HSPA 1Y10A 2GO8A 3DOKA 3K5MA 4DR7J 1EIYB 4DL2A 2VONA 2CQPA 3K8VA 1ZS6A 2HHPA 2RQ4A 9ATCB 4ECSA 1U1OA 1U6BA 1UCNA 4CT8A 3G8SA 2HFVA 3OR1A 3Q8RB 3IRXA 3OR2A 3TAMA 3TUJC 4DN9A 4J9SA 5AXLA 2FLLA 2CWKA 1OWXA 2DNYA 3CCLS 4NI2A 2QX0A 1RWXB 1M90T 2E9ZA 1X4GA 2CNOB 1LWEB 4WE1A 2YNFA 3MEDB 2XZTB 1S7HA 5J1EB 3HCXA 3A1YG 4LSNA 3RG6A 4NMLA 3W64A 3R1HA 4IYQA 1ELOA 3HHLD 2HYIB 1N6QA 4PPZA 2QT7A 3OFFA 3BSOA 3GCWP 4R0EA 1YWXA 1XBWA 2YKMB 4WKYA 3QT6A 2QMXA 1FD2A 2AEMA 3CCTA 2HLTA 4QU7A 1NSKL 3G82A 4ZCLA 4CLYA 2FY1A 2VICA 3CDEA 5C25A 4JYAF 1B7FA 2WB1D 4K2JA 1BC6A 4K4WA 1CS4A 4WWSA 4O3PA 3ZZZA 4YR3A 1WKJA 2Z2MA 3PO5A 1PG5B 4LSNB 4CQ1A 1RE1B 2XMKA 2F63A 1FWLA 1LOUA 4RLEA 5LXRA 1ZZNA 5ETNA 2FVPA 1HBUA 4WIQA 4KFBA 2EFNA 4EUVA 3PKYA 3QJJA 1OSCA 2YQ3A 3EVWA 1Q5YA 3G86A 3VVUA 1S6QB 4C8NA 3OR2B 4LF6F 2JWNA 2IRXA 5IT4A 1NJWA 2FD2A 4QZVB 1NSAA 3ZNUA 4W90B 1X0PA 3ZTSA 3BDEA 5JUMA 4ZPAA 3B8HA 1UP1A 4USHA 2CQ0A 4B3TJ 5HBMA 1U0SA 4UUXA 5EWGA 2GIQA 4QWDA 3KK1B 1G6BA 1C1CB 3DI6B 2V2QA 3ILLA 3M1VA 2R7WA 3MOJB 3FGVA 1QSYA 2AJQA 1AZSB 3WX8A 2IJNA 3BR8A 4QBUA 5IC4B 1IKVB 4IG0B 2MQ8A 4NLRA 2H9ZA 3LTOA 4GKJF 2GVZA 2XHCA 5IWAJ 3DI6A 2FGCA 2ZBQA 4I0WA 2HEKA 2J9DE 5C24B 1T03A 3EUNA 1XR6A 4QYZK 2LP4A 2VJVA 2NZ4A 2Z2LA 4ILLA 5HBMB 1S1WB 4DBQA 4MKAA 1UEUA 3D5MA 1EHWA 2HS3A 1QSLA 2HNYB 3TA0A 2KFNA 3TYTA 1K73T 2CKWA 2B9WA 2PC6A 1Y5LB 2FHMA 5J2PA 4DV2J 5F3ZA 1RT4A 4IFYB 4Y2MA 4QR1A 5C2CA 5MLCV 1U1QA 2L9WA 3AB2B 2GVZB 4RO0A 2R8HA 3IM8A 3IRWP 3SQOP 3SV3A 4EBDA 3D6FB 2AEJA 5E3AA 4N56A 2FY8A 1SC3B 3CB4A 3FJ2A 3PRBA 3B78A 2IM3A 2OAUA 3H5YA 3GLJA 3Q0AA 5GAHI 2RF2B 2W2MP 1YVFA 3D0IE 4MKVA 1T9UA 2GJIA 3PFOA 2KT5A 1RA7A 4NA2A 3FSIA 2XYPB 2W9CA 4F04B 2E5LJ 1S1TA 3NNAA 3W8PA 1RU1A 1RAFB 3D9BA 1SVDA 3M6WA 2VBWA 3PW4A 1S4FA 4HTIA 1GMWA 4F3MA 2IC3B 2KM8B 2MQOA 4N77A 4DPWA 1LWCA 4ZIWA 5D3GA 1UJ6A 2H1YA 3EGVA 1FK9A 3L7PA 1U1LA 1CBKA 4ZLPA 1RWNB 2I2YA 4C8OA 2EFQA 1HI0P 2A2DA 3OQ2A 5K8PA 2Y1IA 3K7RA 3C6TA 1H2TZ 1ICEB 3EGNA 4OJHA 1N33J 4CLFA 5LSRA 4ANDA 2YNGB 4WFZA 4USJC 3M7VA 2VG7B 1WF1A 4O4GB 4MTPA 1TL5A 2BW2A 2W01A 4IR1A 1M5HA 2VL1A 4O3QA 5KFGA 7FD1A 4ZITA 1ZOTA 3A8EA 4DV3F 1CS4B 3G6VA 3MAAB 4OHXA 3GQCA 1XNQF 1O8BA 2ZBPA 2ZDOA 3LANA 2DO4A 3D4JA 5KFOA 2XY6A 3FCVA 4QIGA 3MDFA 3PYGA 4DUYJ 1I6JA 4UQTA 1NJYA 3GSDA 2Y0SD 4B9TA 3D3BJ 3FDSA 1JLCB 2FYXA 3TI0A 4BC9A 3B4MA 2N3OA 1T9TA 3A13A 5LMNF 2V9WA 4F7VA 3T1YJ 1HNWJ 3N5FA 2H65B 2MSTA 2NSCA 2R4FA 3NP5A 1BQXA 3SXLA 5DM6Q 1SJ3P 2VPYB 1NK9A 1RWWB 2ZKUA 3LP2B 2RT3A 1GK8A 5D0EA 5A76A 2HNYA 1FVSA 1SC1B 5IM0B 5KFKA 2HVHA 2IA6A 5C5JA 5BR8F 1U7LA 2UXCF 4WK3A 2GIFA 5B7WA 3HD1A 4M95A 5MAOA 2CPHA 3EYZA 1NJZA 2HHQA 1FDBA 1S9FA 1QM9A 1F5BA 1JKHB 3CDAA 3HFVA 3MTKA 5D4LA 4TQSA 4W4MA 1SJ1A 4B3MJ 3C15A 4OQJA 3FRZA 4KH1B 3TJAA 2U2FA 1S0MA 5CH7B 1JLBA 1Y00A 2V6AA 1TV6B 2PSZA 4H4MB 4QIVA 6AT1B 1JIHA 2X1AA 3EGZA 4FVMA 3ENVA 3LP2A 4WP3A 5IM0A 3FCWA 2QRRA 4ECXA 2EBEA 4PR6A 2R7QA 1CG2A 4ZVOB 3V6JA 2XGPA 3CCES 1S1WA 1Q7YT 3NS5A 3VQTA 3K8WA 1XNRF 1GQEA 2UUBF 4IH5A 1RAOA 1UL3A 2MY7A 1UEVA 1JLAA 4M5DB 5E3PA 4U96A 4HDHA 4MK8A 5EWFA 3B6BA 2WW4A 3GG1A 2KHCA 5KFPA 3KHLA 2FUG9 2M52A 3P3DA 1VQYA 4MKBA 1RTHA 3G9CA 5SUHA 2UP1A 4NLQA 1QE1A 3HJVA 4LRFA 1RHMB 5FDLA 1Y5IB 2NXNA 3MM5A 1KQFB 2XLJA 2V69A 4J9OA 2BR0A 1UAWA 1EETB 4DV5F 1JXLA 1OY9A 3BR9A 4DPTA 1PYSB 4HACA 2C3PA 1Y7PA 4XDCA 3W65A 5FLXY 4DL7A 1RTDB 2JEIA 1YSJA 4NCGA 5ETPA 1FRIA 1K47A 5J2NA 1UEKA 3UVJB 3SYZA 5D3GB 2EW9A 2OPQA 1S1XB 1S6QA 2WRMA 4TY9A 2DR9A 4NEZA 4Y2KA 4MFBB 3HHEA 3SQGA 1N5YA 2OTLS 2ZZTA 4DU8A 2CQGA 2KL8A 3R2CJ 3G71S 1EETA 5L1KA 2DIVA 3CJ3A 3GU0A 4O4GA 2KN4A 3KHGA 3EVOA 2K2PA 3T3FA 4NA3A 2KJVA 2UUTA 5DLFA 4NZ7A 3AH6A 4AUKA 4UT4A 2OPSA 5G0RB 1B7YB 1VS3A 2V34A 4KV8B 4LR8A 3PX4A 1IJEB 2B4UA 1IBCB 3W9HA 3V4MA 1YJUA 5A8RB 1GH8A 4ZLNA 4CP5A 4L76A 4WU2A 1IM4A 3GTYX 2OEJA 3QPIA 1UZDA 5GVQA 2E7WA 2EC0A 5DQGA 4USTA 3P45B 5L8RC 1S7IA 4TVAB 3ZFVA 3D6MB 4PG8A 2UUCF 1X4BA 3M8QB 1CJUB 3S6EA 4JI0F 4JI7F 1A9NB 2WHOA 3A3OB 4PG5A 2Z56B 3SEOA 5A0YB 1AYEA 4XDDA 4ID5B 1JB0C 1Y4ZB 2KM8C 4DV2F 5HP1B 2BEFA 2GCFA 4JV5F 3U1NA 3GFZA 4NE9C 5A0YA 1S57A 2OIHA 1S48A 2IM2A 3OR1B 4WTOB 1S1UA 3EXCX 2AGPA 4A8FA 3W9JA 3M2VA 4BWJA 1OYDA 2Y1RI 1IKXA 3W2VA 5F9NA 2B8PA 4GKKJ 5F8GA 1NSPA 3CD7A 1W25A 2KXFA 4LRDA 2YH1A 1KKHA 4NLWA 3QT5A 1NDPA 1GEHA 2VPWB 1S9EA 4AYBD 5HJXA 1WKLA 2QA2A 1XMQF 5KT7A 4F0KA 2QV6A 2FDNA 3MR2A 4DR6J 4JUZA 4CRJA 1RT6A 2ZHBA 4KV8A 2P6SA 1KN6A 3W1YC 4CNYA 1MW7A 1XIQA 4C0OC 4DS4A 1AA1B 3QBCA 2JL9A 4DCOB 4KHMA 4YB6A 1RAEB 2CUYA 2HAFA 5IFMA 3PW2A 3NOCA 2CQIA 3OUYB 1U47A 1U8SA 1WF0A 2NYIA 2QFIA 1HPZA 3D0HE 2RQCA 1T7PA 2CQ4A 3NCPA 4NLYA 3MD1A 1RB0A 2LVWA 3M6XA 5B0GA 1PJ5A 1URRA 3IAS9 3ZTPA 2ZD1B 1BQMB 4X4NA 3BBCA 3R8YA 2KT2A 4FKYA 1R8PA 3SV4A 2UUCJ 4QCLA 4KE5A 4HR2A 3JQKA 2I0XA 3GONA 1DTTB 5CYMA 4X4SA 4B9VA 2YNHA 2DGWA 2YKMA 2AEFA 4DL3A 3B54A 3P6YC 1M1HA 4Q0BA 1XMBA 4EFAC 1VQ6S 1NNDA 2HRYA 1N36F 1VRTA 1YKWA 3MXHP 2H5EA 5F8IA 2VQFJ 1FDAA 2Q6CA 2GQQA 2RDDA 1U0HB 4WK1A 2XSFA 4MAKA 1SIWB 1C1BA 3CO9A 4TNOA 4B9NA 1G1XA 3Q2TC 3TEGA 2B5JB 4A8MP 2A0FB 2W9BA 3C2PA 2HFSA 3BN7A 1FI4A 2CYYA 2ZOGA 1YRTA 4ZVGA 4ZMMA 2HBQB 5CZXA 1UFLA 4RZRA 2ZFHA 1DTQA 2AT1B 1FERA 2OP5A 1HBMA 2B4OA 2VG5A 3EZOA 4NPOA 3SCIE 5B0FA 1KLMB 3N79A 4NXMF 3SI8A 5A8WB 4H4KC 3QAEA 2ZH9A 1JLBB 1KVKA 4FXVA 4H4MA 4ES3A 1YJWS 2D3ZA 4Z7YA 3SCKE 4NXNJ 1D3WA 2J7UA 3KK2A 2BJ7A 4PYDA 5KG4A 3H25A 2NREA 1LFPA 4OYZA 4DR5F 1J5OA 2HMIA 4RNFA 1CQMA 2AGQA 3D54A 4QYZJ 3RRGA 3KYLA 3PYFA 1TVRA 1T9YA 4DR1F 1I94J 3FUYA 4E2FB 2RH3A 3KJFB 4PG7A 3ENWA 2MB0B 3CCQS 4DR3J 2ASYA 2DCLA 2OSQA 4M1KA 4URGA 2H51B 2ZOFA 2I5JB 1OJ4A 1F1BB 3NGTA 1XN9A 3PFEA 2EK6A 1FESA 3S01A 1MNEA 1NHUA 5IV4A 2HZCA 2VDHA 2KU7A 2K3IA 5AE1A 3LPEA 1SKRA 2KI2A 1E6YB 2W2PP 4P10A 3C8YA 3W2VB 3M8SA 2YBVA 3RW7A 2HFZA 3HSJA 2W9BB 1IWGA 3SMZA 2MQPA 2QSWA 3KJNB 1HNXF 1YX2A 2L3MA 1R8HA 3TZWA 2IA0A 1HMVA 4O44A 1Q95G 4LSLB 4DCJB 1GAOA 3QIDA 1SQFA 2V68A 3H2UB 4KBIA 2VB6A 3VVTA 1YBAA 4LJMA 5JMNA 4Q8EA 3SFGA 1S1VA 1U1PA 2O1PA 3CIZA 4PWUA 4CO3A 4TKTA 1SH3A 1RBOB 2HIYA 2DNMA 3GG0A 3KUEA 3MPYA 2M3DA 4K2XA 1KP6A 2D74B 3TOQA 3DLEA 3DRYA 3MURP 5GMDA 2VV5A 3MMBA 3J80U 1H2UX 3PIPQ 1ZM4A 2BANB 3AXMA 4LFCJ 3CCVS 1VIXA 1U45A 2UU9F 4BDPA 2R8GA 2C2KB 2NR0A 2BQUA 3WHIA 4RW7B 5ETSA 2QFJA 3BGLA 1KTVA 3C46A 2HNZA 3EE3A 3CC2S 3N4WA 4DQIA 5FLXU 3IWLA 4ZVSB 3ET6A 5M2PA 1TKTA 1JJHA 1C4CA 1R0BG 3H4DA 5KFVA 1IN0A 1HKAA 3GYGA 4YY3F 4QOTA 1G3OA 3CCUS 2KVIA 1NUEA 2JEJA 2UUAF 1DJ0A 2RF2A 2HVEA 2F4VJ 2R2TA 2GMJA 1B3TA 2LQBA 2BKOA 2B7BB 2MHEA 3IR6B 4M94A 4DJBA 2DCUB 4TY8A 3BQ2A 2LQJA 1O51A 7AT1B 1DAXA 1DBDA 3OHBA 3ETMA 3F44A 5AJ3J 3ZZUA 3HULA 4CM0A 4DG1B 2HG4A 4WJBA 3EPIA 2RSQA 2UUBJ 3FK4A 4QWAA 3DLEB 2R7XA 2BUNA 1XC9A 4NOHA 2DR8A 2PA3A 3V4IB 4DR4F 2KRRA 4CLWA 2JSXA 3RBEA 4F3QA 2XGQA 3BO2A 1WDDA 2Q1LA 2DRBA 4PG6A 5KFXA 2EG1A 1F60B 2MZRA 4QQBA 2V50A 3FQKA 1FKOA 1IKVA 2N3LA 1AROP 2JHEA 4IG0A 5I3PA 4JI8J 2QLJB 3QWPA 3CJSA 1SKUB 3TUIC 1M1GA 4OX9J 4FPIA 1C0UA 5CYQA 3T9NA 2PE8A 3RAMA 4DS5A 1D9DA 2GGPB 1WD6A 2GA7A 3W5YA 2W7PA 1HI1A 1LW0A 4O3OA 2O01C 1JNZB 2XI2A 1FFWB 3MCNA 3Q2SC 1JLFA 4L74A 4X62J 4QWEA 3SZ2A 4P2FA 4QW8A 1RKIA 3VGSA 1V5IB 3AA9A 4PQUB 1RSCA 3W2WB 5F8HA 4DL5A 3P49B 2W4CA 2JDJA 4UZCA 3I56S 1AUSL 3CD6S 2FVCA 4TY8B 2ASDA 1JLGA 3KLHA 4USWA 2OJ3A 1YGYA 3HSGA 4F4XA 3DU6A 2N82B 1VRUA 2DNZA 4KC5A 2DIUA 4H4KA 1ACMB 4YEAA 3NCRA 2ZE2A 3H20A 4RW4A 1X0FA 1HQUB 3FSXA 3BF4A 3OTOJ 3TUZC 1IR1A 3RU0A 2MHNA 1JLEB 1TMMA 2NSBA 3CDWA 3OD2A 4NMXA 4C98A 4J90A 4X4PA 3OHAA 3KLIA 5DZ6A 3ISZA 5GMEA 4C8LA 4WXOA 4YB1P 4Y2CA 4CLLA 3O2IA 1N4LA 2QG9B 2DVIA 3VALA 4EZ6A 1OQ6A 2VPXB 2XNQA 4IG3B 4MIWA 4NCGB 3GV5B 3O5TB 3PKMA 2ABYA 4PWDB 4CLTA 4JP8A 2OPSB 5G0RA 1RDRA 2UZAA 1WEXA 4FYWB 2XCAA 4AFFA 3AB4B 3QQCD 1BWEA 5LSOA 1ZM3A 2ZH5A 4J9VA 1Q82T 2RUGA 1HARA 2AWZA 3TA1A 4C8KA 1NRKA 2JLEA 5E3RA 5LT5A 5ETVA 4C4WA 4MT1A 2PIIA 4ECZA 2GC8A 1Q8KA 3HVWA 2AYBA 3DM2A 3QFWA 1XNRJ 2WOMB 4CO5A 2VASA 2YWEA 4PUOB 4O44B 3V6KA 5J2MA 2R7VA 3VQSA 1SL2A 3QLHA 3I4PA 2QA4S 3T6BA 4F50A 4LRCA 3THVA 2ADBA 2KTQA 1FRLA 1FK9B 3GFHA 5J2MB 3V81A 2RQMA 3EVMA 3OTCA 1VQOS 2HQDA 4HI2A 4CTAB 4AE5A 3KOAA 2KB2A 5KOWA 3UN5A 3L7OA 1VYAA 2V4JB 4LFCF 2E1CA 1SI9A 5I42B 4QIWD 3RBDA 2W9CB 5H9FK 2W7OA 4F2RA 1S1TB 2CPDA 4O4RA 3SDEB 4JI0J 3JTNA 3MECA 3UR0A 3P5BP 2I8EA 2ZUAA 3DGVA 5IOLA 4ELVA 2KO1A 4XK8C 2LFVA 1FO1A 1NU4A 1SJRA 4P71A 1SQEA 3GIMA 1KQKA 1FKAF 1D8YA 2RD5C 3HSDA 2MXYA 1IBLF 2VG6B 3NGSA 4RX6A 1TKZA 1JXEA 5KFTA 3BDPA 4K50A 4FXWA 2QL7B 2WVDA 3AAWB 2GHPA 4R25A 4X84A 5T41A 4JV0A 3IG1B 2VG6A 1M5SA 3Q8PB 3UCUP 3EWGA 4GVBB 1YTYA 3NWRA 1H73A 2DNLA 2K3KA 3SBMA 4F4KA 2NUHA 3QLHB 3PRDA 4B3OA 3LP0A 3QGPA 1E6VB 5HANA 1HYSA 4P73A 1FWPA 2JX2A 4B3SF 2J9DA 6FD1A 1U2CA 4ZPCA 2G4BA 4KJIA 1JLGB 3ZZ0A 3KLHB 3F0NA 3BO3A 4B3TF 4RR5A 2X1GA 2FTRA 2PMZD 1OY6A 3OSPA 2J6SA 3ZTRA 1CJTB 4LIRA 1RADB 4N8NA 4NLDA 3W60A 5CCMA 1RISA 3O44A 3IP0A 5DDRC 2VJUA 3GR0A 1S0OA 1NPRA 2C3MA 3W5XA 3KK3A 4F0HA 1R8AA 3J7YI 3JSBA 2Z8QA 3DLGA 3I0RB 1BD6A 4P72A 5E5NA 3VAMA 4DF4A 4O3RA 4M5LA 4K4YA 5B0AA 4EO6A 4Q5VA 1TU0B 2D3UA 4UY85 1KLNA 2CVIA 3GIIA 1RT7B 2XYHB 4R5PB 4HKQA 2LDIA 3VAFA 1F9HA 2XB2D 2P9EA 1PBAA 4AXIA 2FJBB 3IXQA 1XQIA 2MQNA 4IRCA 2QGFB 4UOCA 1CJTA 4B17A 3DDIA 2LCWA 1Q8BA 3CT9A 3NGUA 4YFUA 2CFXA 1Z4UA 3Q83A 2EKYA 2MZTA 3RBXA 3DHWC 4DR3F 3B4DA 4FXDA 3H40A 1FEEA 2HVZA 1R89A 3LAMA 4NLTA 1T02A 4Y2IA 5ETQA 3UO0A 3VF0B 3JXOA 4ZP9A 2AKWB 2ZM6F 3K2YA 4TQRA 2QEXS 2AX1A 4AXJA 1JLQA 4HTJA 1OPZA 4ZPDA 2V8HA 4IFYA 3CC4S 1KDNA 2DBBA 3GZ7A 4YN3B 1R0AA 4I4BA 2VBXA 4DDFA 3SSRA 1B99A 3DRSB 4UW2A 1DQAA 4IR9A 2ZITA 3J7YU 1RT3B 1S9GB 4XO0A 4DF8A 4ZVUB 3X1LB 4I64A 5HK4A 2PI5A 5D0GA 4LVNP 1QE1B 1RCOB 1DHMA 1YJ9S 1Q53A 1J27A 1DARA 2GHVC 5C24A 5GADI 4A8WA 1K8AT 1K0TA 3JSMA 5FJ4A 4A8QA 3MI7X 2H5JB 4Z7CA 1E6VA 3IO1A 1RT7A 2CNKB 4L75A 1G7CB 3KUGA 3CO0P 5LXYA 4R5PA 3M8YA 3MEEB 3VTIA 3PY8A 1H7WA 1QTMA 4NCAA 1APSA 2J76E 2KH9A 2Z2ZA 2HRUA 4F4ZA 2RKIB 3PHTA 2ZJQQ 1RTJB 1FE0A 2B6AA 2YKNA 4OI3A 3BQ1A 1YI2S 3F73A 4WCEQ 2DGVA 1WORA 1PIEA 1TKZB 2AYMA 4J9PA 3CCWA 2P9CA 4W92B 5IQQA 5AXNA 2YWGA 2CNNB 2R42A 1IKWA 1JJCB 4FN5A 4PKDB 4CI0B 2WVEA 4QWCA 2Y9HA 1JMTA 3PM9A 4CH1A 2DPJA 4HL9A 4NZ6A 1G2EA 3UDVA 4ECRA 1KSPA 2KXHA 4HDGA 4KFBB 3GYXB 3OPKA 4C9DA 2DISA 4KHPJ 4NXMJ 4OV6A 2R2UA 4ZVRB 3WIUA 2HHVA 1RT3A 1S9GA 1NLKL 1ZM9A 3ITHB 3Q8VA 1WC0A 2RMLA 4ZCKA 4AD6A 4WTYA 4F36A 3FBFA 2K8GA 4LUBA 5I3QA 1D9FA 4O3SA 3BSCA 2F65A 3ETOA 3GSIA 4WZQA 1UPPA 4EU0A 4E0DA 2W9AA 3EX7B 1WWHA 2LQ9A 4L73A 4YUDA 1EP4A 4CLUA 3VR1A 1SL1A 5HO4A 3DMJB 3E01B 2R2RA 1WEZA 3DXSX 5KG6A 2BX6A 3PRVA 1ZAXA 3BJYA 2LQ8A 4ED0A 4IRDA 1SKWA 1P1TA 3AQOA 4LMZA 4OZ3A 4RKUC 4OV1A 2PMWA 4ECYA 3X3UA 1XMOJ 5HN0A 3C66A 2NZCA 3D6TB 3BBBA 2F9JA 4DI6A 3UDLA 5L38A 1GXTA 4NI2B 3PX0A 1YJVA 2FJVA 4F2SA 2MKCA 1Y5NB 1LWEA 4WE1B 1VRTB 4OI6A 5HQMA 3RB0A 4NCBA 2XS2A 3HZGA 4LFBJ 2V4JA 3D1QA 3ILOA 3QGIA 1UW9A 1HNXJ 1WUUA 4RBTA 3T5KA 2BRLA 2M88A 4KO0A 8RUCA 4B3SJ 3IS9B 4DV6J 1H38A 1N5SA 2DGSA 4DSJA 1SC4B 2JH3A 3IWNC 2DO0A 4A47A 3NEKA 4X62F 5F8NA 3VAHA 5BR8J 5GAGI 3HVTA 1L3SA 1ZPVA 1HNZF 4RWWA 2HVIA 3UFCX 3TWZA 3DLKB 4LF4F 2J9CA 2EKNA 4DX8H 2KFYA 1JNRB 2D3O1 1U02A 5BXIA 2ATLA 1CSJA 2HQGA 3BPDA 3BS9A 3QT7A 2RJZA 2PA8D 3M8PB 1WNEA 2DB1A 5FIIA 2Z0GA 1PC4A 1RK8A 4WP9A 4FF1A 4NXNF 1U4BA 2BRKA 4ED8A 4CO0A 2XLIA 1NMEB 4X2BA 5JXSA 3R5CA 3OUYA 2LLZA 2WONB 5LJ3Y 5CD4A 1H7XA 3I31A 1OSDA 2RS8A 1RHQB 2MKHA 4Q2MA 1RXOB 4KGKA 4RW9A 4CZCA 4KKOB 2KRBA 3O8WA 3ONQA 3K5OA 3P8BB 5BYSA 3G4SS 4K4TA 4LF7J 3KLVA 4JI3F 4F02A 2ZD1A 2IJFA 4D3HA 1HBMB 3JTPA 2IRUA 4FF4A 3KLIB 3QO9A 5LMNJ 3E3XA 3N6LA 1FX4A 3DNCA 3MMAB 1NXIA 3QIPA 2R8KA 3BN4A 3KJQB 4OYWA 4IUFA 1FFSB 2C2EA 3DFEA 4F0MA 1LWFB 2DNNA 4L3KA 1X7VA 2BMBA 4N8OA 5F8MA 4UZBA 3JQMA 4PRFA 2EEYA 1J5OB 1HWJA 1N36J 1K1SA 2UXCJ 2H4YB 5IC6B 2VKZG 4DQRA 5F0UA 1QAIA 3DLKA 3H2VE 2M8HA 3NBPA 1KS2A 5KFDA 2BJ8A 5K8NA 1D09B 1VQSA 2NPIA 3CCRS 2R8JA 4BS2A 2WVBA 2XMAA 2GVDA 5D4NA 5F3TA 3TP2A 1R3NA 2QMUB 4JI6F 1RP5A 1LW0B 1H2VZ 4CT9A 5JVGQ 2RRNA 4ZVPB 3ZTOA 4NLOA 2PGCA 3IS9A 4ZN1A 3LUYA 3KLFB 3ILJA 1JQGA 2QC3A 3MEEA 3R3TA 2WBMA 3NL0A 4U7UK 1QJHA 5ETMA 3W7BA 1YJ7A 4QPXA 1LV5A 3IR5B 2XHWA 3RUBL 4MK7A 5L1JA 2IPOB 3CJ8A 4TLQA 1O5JA 3UNGC 3M2UA 3AODA 5KAKA 3J81Y 3HKZD 3BB5A 4NL5A 4ZIVA 3MM5B 2GX8A 3QYYA 2AV5A 2U1AA 2VFTA 3QMQA 4C3KA 3N6MA 1PGZA 1FCAA 1N56A 3OL8A 3AOBA 3QJLA 3L9ZA 2JVRA 2LXUA 5KFIA 3KLFA 4MIBA 2E9TA 2MGZB 1J5EJ 2UUWA 4DV5J 2IMWP 3RGIA 1VBKA 2BABA 2JC1A 3KLEB 2V67A 3I6PA 5A8RA 1RWVB 3JAMU 3BGOP 2YKQA 4PXDA 3MCOA 2KG1A 4DMZA 3R97A 1R8CA 8AT1B 1R6VA 3FBBA 2GVDB 3GFYA 2BZ2A 3DYAA 4DX5A 4JI5J 1KVJA 2CAJA 5KFSA 2G0IA 3R2DJ 4X66F 1I51B 2OD6A 1C0TA 2Z57B 2BJEA 5AT1B 2V9KA 2DY1A 3TJ8A 4Q45A 3JB9k 2W1BA 2DR5A 4ZJQA 4LSLA 1TUWA 4EYIB 3A12A 2B0GA 3AJ2A 1TVRB 4LFAF 2CJ9A 1YJRA 1NHKL 2JLFA 2VFSA 5EUHA 1S5ZA 4LF8J 2QLFB 4GKKF 1RAAB 2HWTA 4KPYA 1G4CA 4LREA 4PABA 3BM7A 3LGMA 4U8VA 3R5GA 1MWZA 4DOZA 1IBLJ 4B9SA 4X4QA 1MU2A 3KNAA 3CJKA 2VC1A 1U26A 1YG0A 3GJTB 5K14B 3QFHA 4GO5X 1ITPA 3N6NA 2RQKA 1HR0F 3POTA 4X64F 3MM8B 3M6VA 2E1MC 2JNJA 3V81B 1CEZA 3WZ0A 3BYPA 4GO7X 1MMDA 2CWXA 2N4CA 1IJFB 1TFWA 1FJGF 2A6MA 2FJDB 3FMWA 1HBNB 5D0RA 3W9IA 3EICA 1VQ9S 4OZ2A 4GRSA 5AE2A 3Q8QB 3AHPA 4CIOA 3I32A 1R6YA 1HYSB 1HMVB 1PJ7A 4ELUA 1SJQA 1RWPB 1FF2A 2V2KA 4OYPA 4P6QA 5E3CA 1KR4A 3UI3A 5C2GA 4EBEA 5I3UA 1ULRA 4C3MA 2H54B 3EPGA 2VUGA 2DHSA 3LALA 1H72C 1X4EA 1H0HB 3CXCR 1RAGB 4RUBA 3TX8A 3CJQA 5J2QA 4KGMA 2CG8A 4MYUA 4Q44A 1FD8A 4Q0BB 1P27B 4OYMA 2FIUA 4NWBA 5C42A 3M8ZA 2C3UA 3UCZP 2IDEA 3KDNA 4ED2A 2VA2A 3W62A 2R2SA 2XYGB 3PIOQ 3VAJA 1WC4A 4J9QA 2ZH3A 4E98A 4M5IA 4Y00A 3DRXA 3FEYB 1GTEA 5ETTA 1UVIA 2OD4A 3TVZA 2FJWA 2VOOA 1YBTA 9RUBA 2CPFA 1U49A 2MSSA 2ZWOA 4DLGA 2WBRA 3T6JA 2A6OA 2DR7A 1WC5A 3JSYA 1S72S 4LFAJ 4I2PB 3TANA 3NNHA 2WAQD 1U1MA 3VZIA 5HROB 3AXKA 4C11B 4UOFA 4QWBA 1FE4A 1HBNA 3JS9A 4I56A 2ACYA 4OI1A 4GMKA 3HLUA 1CJKB 2HHHF 1YHQS 2CA9A 4P75A 3TA2A 3MMCB 4IKAA 4N7TA 2V2VA 4I67A 3TVKA 2BE9B 1W7WA 3SSSA 2IDLA 2IM0A 4DX6A 2NXCA 3G6YA 4DR1J 4NZ0A 2BXJA 2YY3A 3GWCA 2QZ8A 1MU2B 2E5JA 2K06A 2MKIA 1HQUA 1T05A 1NJXA 5DETA 1YRXA 1HPZB 4ED5A 3TO8A 4CLKA 3SCLE 1UKUA 2IIHA 3LP0B 4PWWA 2XI3A 4OMFG 1S49A 4RWXA 3CWJA 2CPJA 3QIPB 4ZPVR 2MTLA 3RB4A 4IRKA 1BY9A 4RUCA 4RU2A 3FBEA 1VQMS 1B70B 2X3DA 2FVSA 4IG3A 4FF3A 5KOXA 1S79A 1C1CA 3BKFA 5KFRA 1UFKA 5KFYA 3HMJG 1RT6B 3QZ7A 4ZHRA 2KHDA 1FRMA 4MJKA 2B6AB 2YKNB 4GC6A 2FHKA 3ULHA 2G2YA 3OSNA 1S6UA 4KGVB 3CNQP 4R8UB 3N9UC 1LW2B 2DYAA 1WKKA 3T1HF 2GIRA 4HLBA 4DX7A 2FHJA 3RRKA 2DTJA 3NGRA 3P5TL 3I55S 3MFIA 4MK9A 4EBCA 2HHSA 1SH0A 5KFFA 2O66A 5LOQA 1T9WA 2I9SA 1OS5A 1QLNA 4QIFA 4A4JA 3JSMB 5DRKA 3FMBA 3BREA 2DPIA 5D77A 2DEJA 2OGUA 3MCSA 3L09A 1RT4B 2ATCB 2R3VA 4NLVA 2B7CB 1RYRA 1F2HA 2LEAA 5KG5A 5CD4H 1T05B 2BQ3A 1DTQB 2OEMA 2QN6B 2G2ZA 3MM6B 1X9SA 2FZGB 3OW2R 4H4OB 4WYLA 4LBHA 5ADZA 3AT1B 3PHEA 3HF5A 2AGOA 1CJVB 5DQHA 3S7RA 1N34J 2WB4A 5IT9U 4LSZB 4DSEA 2CJKA 3CMES 1WSRA 5J1PA 2YXLA 3HHKA 2UV8G 4H4OA 2D41A 3GP9A 4O23A 4C2MA 3GIJA 1K1QA 4GKJJ 3CJRA 4ID5A 2GO9A 1N52B 2HIQA 5LMUJ 1S4EA 2B5JA 3LF0A 1RTZA 2K1RB 2ZM6J 2VODA 1WC1A 4F4AA 4Y34A 4RJVA 2FC8A 4LF9J 5L46A 4RUHA 5HVHA 4ZP8A 2DKOB 4USIA 2HW3A 1O0PA 3GE9A 4FBTA 3CJ2A 4QPTA 2W2QP 2C42A 2X1BA 3D7SB 1U6ZA 1NK6A 1RT2B 3MEKA 2XMJA 3AFGA 3T1HJ 2UVRA 4B9MA 2OPRB 5B0BA 1VQ8S 1ZBTA 4J5OA 3HX9A 3JQJA 1Q8IA 1S99A 2RB7A 3MF5A 1RAJA 4UOHA 5U47A 2JZ5A 2M7SA 3OTOF 2UXBJ 1M5VC 2FJAB 3DMJA 2I1RA 1PBUA 3E01A 3NKYA 4IQMA 3CD5A 4BHQA 3E8OA 3GJRB 5KT5A 2G9OA 3C14A 4QYRA 5CCLA 4RW9B 3UE2A 3MR6A 4AQYJ 3O3LA 2ZE2B 4RW4B 4CNZA 2OI2A 3QATA 5ITHA 1VMBA 2DNOA 2Z30B 3FBCA 3K89A 4AL5A 4ILMA 3MEGB 4OYIA 4CLZA 2B9XA 4N76A 2E1AA 1U25A 3R27A 3CDBA 2B9EA 1AT1B 4NEYA 3VZHA 1Z1ZA 2XO6A 3R5AA 3IBFB 4OYBA 1PAEX 4ELTA 2A10A 3NS7B 1FWKA 4ZVTB 4N47A 2DH9A 2Y3YA 2APOA 4LF1A 3TEHB 2WVCA 3NS6A 2D7SA 2LEBA 4NYOA 2UV8A 4X4RA 4J91A 4P2MA 5KFNA 2CJXB 2DXFA 3ADAC 3FKBA 5A8WA 4DSIA 1NH7A 3THPA 2E5GA 1QAXA 4DUZF 2E66A 2VDIA 3GR1A 3R5DA 4N41A 1FKPA 2C1EB 2ZH4A 1WACA 1OO0B 2BE2B 2I38A 5IXUA 1UMJA 1VI7A 4XPCA 1FRJA 3IMQJ 4DV1J 1SBRA 2WSEC 2P5VA 2F40A 3CJTA 4PQAA 3PR5B 1NKCA 3M4XA 1WDTA 3T1AA 4BBYA 3KK1A 2F1FA 2R7SA 2BE2A 3IAM9 4G65A 4LRBA 3TNVA 5EN1A 1MROA 5DDOC 2XS5A 2QA4G 1VQKS 1B0TA 4EI2A 4DPUA 3J80Y 1VBYA 2CPIA 5GAGU 2V0NA 4A8OA 2A3JA 3PW5A 3EZUA 3KKFA 4CO4A 3D3CJ 4CTAA 3KNGA 4G6VB 2X51A 4J7CA 4OX7A 3ZZRA 4U7CA 5HLFB 3DLLQ 3K0JA 4ZA1A 1L3KA 1Y0HA 1UVMA 2DRAA 1P9QC 2ROGA 3RJMB 4C11A 3NMAA 5KTQA 2B8QA 1N32J 2DGTA 2P8IA 1C1BB 2XO7A 1JKHA 1N8RT 1KOHA 1I94F 1UVJA 2ASLA 2BM1A 2QSFA 2XLKA 2H3EB 1Z2ZA 2R9LA 4FYYB 2RDJA 5L1LA 3DM2B 3OLAA 1VLOA 2PMHA 3PZPA 4PPDA 3FQLA 4FS2A 2QA1A 4RBVA 4CH0S 4J9NA 3OFEA 4FZVA 3LH2S 5F9LA 4YP3A
chains in the Genus database with same CATH topology
3DYAB 3PX6A 4ZCMA 4KB7A 4UY8T 4G3IA 3QZ8A 2KXNB 2RU9A 1N5YB 3CC7S 4WFAQ 4B3RF 2CJQA 4HH1A 1PC5A 2XULA 3UD4P 4PWDA 1M5PC 4OHVA 5DLGA 2CQBA 3H5SA 2YWFA 2MYFA 1VK3A 4UUWA 1HNVB 1XTZA 3TQ1A 1PILA 2AJ4A 4OI0A 4WFNQ 3CE8A 4FNIA 2DK2A 2FGOA 1NAQA 1X8DA 3ITHA 3QWUA 1U1NA 1F5AA 2JOQA 2FLOA 2BVZA 3JYTA 1FKPB 3OVBA 4HVZA 4RBUA 5A8KB 1UA0A 1T8EA 3IG1A 1VBZA 1SC6A 4PQUA 3V2UC 3MR5A 2HHWA 3FRYA 3CEDA 4ED7A 5KG2A 3US5A 3N01A 2IC3A 2WTFA 2RKIA 4IOBA 3MWBA 5AE3A 2EK1A 1NB7A 2YX4A 2JEFA 3OFHA 2W4DA 1PO6A 1FXLA 1N0UA 4IDKB 5F41A 1UW4A 4C97A 1S1UB 1T3NA 5B0EA 3SDEA 3LAKA 2J0SD 2POKA 1SXLA 1GX5A 4DV1F 1ZTWA 4V19J 1TQLA 2CQ1A 3LO3A 4I6YA 4RNMA 4I69A 1TK8A 4G1IA 1V3SA 2GQCA 1M5OC 4NLPA 2YKPA 3ENQA 2DNKA 3AJ1A 5KFWA 1JLFB 4X65F 3HPOA 2J0XA 3DU5A 4MFBA 5DG8A 4NYPA 4KKOA 5I4MA 2D1CA 3MM9B 5SZTA 2XSJA 3IBWA 1X4AA 2WK4A 3HJFA 1DZ5A 3NWGA 3HDSA 1RT2A 2QIFA 5D8HB 4HYKA 5KG3A 2L41A 3PXGa 3LQVA 4V19X 1WF2A 3IN5A 1HQEA 3I0SB 2WOMA 1B0VA 2F7VA 3GYNA 3G8QA 2EWHA 2YNGA 4IOAQ 1K0VA 2EI5A 2OLWA 5T14A 4YR0A 2IVFB 5LJ5Y 5LL6d 3J7A1 2XSJB 1IKYB 2E9ZA 4G1QB 1TZ0A 4CCHA 5IT9Y 4IFVA 2ILYA 4Z2XA 2MGZA 3OTDA 3GILA 4ZOSA 3D1HA 1WHWA 4KR0B 1Q78A 1ZAVA 4ZVHA 2OMOA 3Q22A 3M32B 4PG4A 2M8DB 3KMSA 3HVAA 4J9MA 1PSDA 1U6FA 5DS7A 2XCPA 1HA1A 5FDLB 3JSRA 4B9LA 2AX0A 4C0BA 3HKWA 1C2PA 2D9PA 1QUVA 2W8LA 2KKHA 5DM7Q 1JLEA 2FB0A 3RR7A 4ES2A 2LECA 2M9KA 2ALZA 1WTBA 5J1NA 1AXQA 2UVVA 1VQ4S 3I82A 4TU7A 3UW1A 1ROFA 3I96A 4RU9A 2M2BA 4B02A 1WHXA 2E44A 2V5HG 5AXKA 2HHUA 2YNIA 2O67A 4OIXA 2ZDPA 1RT5B 2ZHAA 2ASJA 4X4VA 4OL8A 1HBOA 1DQ9A 5KFAA 5K8OA 4WZMA 2C3OA 5HQ8A 1U2FA 4K0KF 2IVYA 3G6XA 3RR8A 1Y3KA 4DV7F 5A6WA 3AA8A 1CC7A 2GHWA 1UWBA 4TYAA 5BYQA 5IQ6A 4FBUA 4B08A 3OXLA 1KEKA 2YKAA 4K59A 1XEZA 1SB6A 3WX4A 1HNVA 2PEHA 1REVA 4ALZA 5HMWA 2DNQA 4A8KA 4Y3CA 1KLMA 1FTCA 1FDDA 2R7UA 4OJ1A 4NLUA 5KG7A 3FZ2A 4DUYF 4BC7A 2F8MA 1J5EF 2VKRA 4J9RA 3DRSA 5HL7Q 3CCJS 4A46A 5D4OA 4EYHB 5A8KA 1TK5A 4ICLB 1N54B 1EP4B 4DR7F 3KJVB 3KLEA 4NX9A 4LFBF 3I5CA 1SKSA 3QGGA 4DSFA 3GMGA 4ZVEA 1BQMA 1VFJA 2DHXA 5L39A 2FHJD 4Y0FA 5A2QY 1V3ZA 3JAMY 4TU8A 2P6TA 5H9FJ 3UQSA 3WC2A 2KJWA 1TL4A 2MMYA 3M2UB 2HNZB 3I0SA 4JOUA 4U67Q 2LKZA 4LVOP 1HNIB 2ROPA 1DFDA 3FNNA 3QJPA 1TL3A 4IQXA 3SSQA 4XIUA 2K7JA 2XWXA 3FFIA 3I9V9 3MAQA 2Y1JA 4I7FA 3I87A 3DDKA 3NLCA 5DDPC 3CCSS 4AL7A 4OZ1A 4C8YA 2V94A 1Q16B 2MKSA 3MPWA 5B09A 4URQU 5K5MA 5E41A 2KZMA 4K4ZA 4WU3A 2RRAA 4KIAA 4OLOA 3Q24A 1NO8A 1C0UB 1QVGR 4KRWA 4WFBQ 1L3TA 4ED3A 1FRKA 4KSEB 4ERDA 2L48A 3QGHA 5KT6A 3NGDA 3BGRA 1JLAB 1YQHA 2HS4A 4M5DA 2K1RA 2BYCA 1P8GA 3KJVA 4OLPA 1UWBB 1N33F 2DGUA 3NCQA 1S6OA 1DTTA 2R7OA 5CYMB 2OPPB 4Z37A 2CJAA 4B9UA 3RZAA 3V4IA 4B3OB 4LF7F 4OJGA 3PW7A 4R0JA 4FF2A 1SUQB 3MMAA 3P96A 4MYTA 4OZ0A 4YDDB 4YQWA 4QW9A 3RRHA 4B3MF 2ZZNA 1D9AA 2ZVSA 1R27B 1IR0A 1RT5A 1FTRA 2Q79A 3HVRA 1CPZA 1IKXB 2RU3A 2DNRA 3LP1A 1XERA 2R7TA 1F0XA 4KHRA 2ZH1A 3V6DA 1N0VC 5H9EJ 2UVUA 2A2CA 2W25A 5B0CA 2XEXA 2DJWA 5E2QA 4HEA9 5T7LA 1YIJS 5KT4A 4J37A 4ZS6A 1SL0A 4GC7A 4WYWA 3MMJA 5FD1A 4DQSA 1J2VA 1TP7A 3G8TA 2J5AA 3N28A 3HHLA 1R0AB 4CO2A 1R43A 2OO4A 4ECUA 1N5QA 4KHPF 2ZNYA 3MMCA 3BGFA 4G1QA 4DFPA 2OTJS 2OPPA 3VWSA 3GV8B 4LF9F 4YR2A 2O3DA 2D3OR 1FHTA 1N48A 3M1VB 2FHOB 3AY0A 2IAJB 3TR5A 4X4UA 5BJRA 3V5RA 3M9OB 1FT8A 3R5BA 3SQGB 2HFOA 1S0VA 5DJBA 2HPUA 2BV3A 4DR6F 2L9DA 5DG7A 4AL6A 4PXBA 1QVFR 1FEHA 1JJ4A 3T9ZA 3MMBB 5EHHA 4DFKA 2BANA 2GFFA 2IBOA 1Y9OA 1QAJA 3NMRA 3OL9A 3WDOA 2ZH8A 4OX6A 1NK0A 2ADCA 4U6PA 1H98A 2QE5A 2MKJA 2MQLA 1FXRA 4HT7A 2VBYA 3CD0A 5JVHQ 1VC5A 3BO4A 2BACA 2VPZB 2M70A 3LP1B 2ERRA 3O6QA 3LWMA 1YRUA 2G13A 1V3RA 2QYCA 3EGWB 3MUVP 3RAQA 1RYSA 3KG1A 3LGNA 2ZH7A 4M8LA 2HWIA 2ZOMA 2Q6BA 4KAIA 5KG1A 3MGJA 4IH7A 1F5CA 4TYBA 2F8EX 1P6TA 2MJNA 1N6QB 3IGVA 3C6UB 2LXFA 3CGIA 1FVQA 1YJTA 3T1YF 5J2PB 2ZC3A 3Q23A 5K14A 3PACA 5EX0A 1KQGB 1XR5A 2ZZMA 1JX4A 4QR0A 1GXUA 3D2WA 4ED6A 2HQIA 4ZP7A 3TAMB 5GAHU 3V6HA 4DL0C 2HVIA 2CZVC 2JRSA 3D28A 2FJXA 1XK8A 2MQQA 2MZQA 1WHVA 5IT0A 4X4OA 2YH0A 4QR2A 1HWLA 2HLUA 5DO2A 1L5UA 2KZZA 4A48A 3OVAA 2HGMA 2V8VA 1AW0A 2VOPA 1CQNA 2LU1A 2OMLA 3HVTB 4CH7A 4YMEA 4ZCIA 4IOCQ 4LF8F 2ZBIA 3POTB 1HWKA 1JLCA 2B43A 5CQGA 2IHR1 3CJ0A 4ITSA 1HNIA 4DQQA 3RAXA 2F3JA 2OPRA 3MM7B 1TAQA 2COLA 1H3DA 3MECB 1HNWF 3OXFA 3BGUA 2J7KA 1IUJA 1FKOB 1HW8A 3HFKA 1U2RA 3M2RB 4O0IA 1FRXA 3IFEA 4JI2F 1LQ9A 5EX3A 4X4TA 3HHLC 1UJ5A 3FZBA 3H5UA 4RNNA 2OFGX 5DDQC 2BDPA 1HBUB 1A6LA 3MEGA 2XY5A 2LMIA 3U02A 2KYXA 1HL6A 2HWHA 4K4VA 3WBZA 1M1KT 5KFEA 1F9FA 3VCDA 1TUVA 1GT8A 1ZM2A 4ATNA 1ZAWA 4Q2LA 1U09A 4WFXA 1L3UA 1S77D 4IFVB 3TAQA 4K4UA 1LWCB 1V9OA 3FCHA 3UDCA 1HWUA 5HMZA 2CQ2A 2R7RA 4OI4A 2C22A 3OXGA 1YJNS 1WELA 3T5LA 4ZDNA 2J6TA 2NUUG 2AF6A 1VIOA 2VG7A