3CCQS

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
b'SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ccqS00
1BY9A 2MKHA 2NLWA 3IWNC 5CA5A 3MI7X 3CC7S 3MUVP 1PO6A 2KG1A 3J7ZT 1JMTA 3J7YU 1Q82T 4YOEA 4QU6A 1VQPS 2J76E 1CVJA 2KU7A 3PIOQ 2EK1A 3CCUS 1SJRA 2CQPA 2CQ2A 2N82B 2MKJA 4LIRA 1FJCA 4P6QA 4C7QA 4YB1P 1VQOS 3MOJB 1VQMS 1YIJS 1K73T 2MQNA 3EGZA 1VBYA 5GADU 2ADBA 3DXBA 1KC8T 1N54B 1Q81T 1OO0B 1IQTA 5LXYA 3CCJS 2UP1A 3TO8A 1L3KA 2CQ3A 1H2TZ 3MD1A 2RNEA 1K8AT 3FEYB 3NNHA 3CCRS 3VAFA 2DHXA 2JVRA 1DHMA 2MGZB 3SMZA 1YITS 2M9KA 4WIIA 4ED5A 3UCGA 2A3JA 3G71S 2M52A 2CQBA 1FJEB 2DGSA 2LXIA 1WG4A 1Q7YT 3BO4A 2FY1A 1DRZA 2M2BA 1FT8A 1VQLS 4LMZA 2KRBA 1WTBA 2KN4A 2XB2D 1HA1A 2DNGA 3SXLA 4W92B 2DGOA 3UE2A 4W90B 3UCZP 1WEZA 2KFYA 2MSSA 1H2UX 2X1FA 2LYVA 1UW4A 4V19X 2VONA 4FXWA 4WCEQ 2WBRA 4IOCQ 2EVZA 4Y0FA 1WF0A 1YJNS 4CIOA 2CPIA 3R27A 2HVZA 1X4HA 1FHTA 1P1TA 2ZJRQ 4BS2A 5HO4A 3G4SS 1RK8A 3S6EA 2NZ4A 1YTYA 4PR6A 1R8HA 2V94A 2XSFA 2MQOA 3R1LA 2KRRA 1U1KA 2HGLA 1WI6A 4WFAQ 1VQ5S 2ZJQQ 1WHXA 2DIVA 3EX7B 5ITHA 2DNNA 4QPTA 5H1SV 2F3JA 3S7RA 2ERRA 5D78A 2DK2A 2YH1A 1U6BA 3THTA 1N8RT 1P27B 2RU3A 2HGNA 1RKJA 3U1LA 2CQ1A 2OSRA 1KOOA 5CYJA 2DGQA 3CC4S 2YWKA 2XS2A 1X5OA 1VQ8S 2VOPA 2LEBA 1FO1A 5IQQA 2MKCA 1X4GA 1URNA 2CPZA 2RQ4A 1U2FA 3MD3A 2MHNA 3SDEA 2CQHA 1VC5A 1ZH5A 2RS8A 2D9OA 2DNHA 3L3CA 1U1QA 2ADCA 2PE8A 2N7CA 1U1MA 1YJWS 5DM6Q 1WG5A 2KHCA 2DB1A 1Q86T 1WWHA 2FC8A 3BS9A 1AUDA 1OPIA 2I38A 2MZJA 2DH9A 1VQ4S 3S01A 2CJKA 4CH1A 2DNLA 5GAEU 2K8GA 2KXNB 3CCMS 2CQ4A 3VALA 3LPYA 1A7GE 4YUDA 5EN1A 3MURP 1WELA 3JB9k 5DETA 2DITA 1VC6A 2K3KA 3H2VE 2HYIB 1QVGR 2J0QD 2LCWA 2MQMA 1VQNS 2DO4A 3I55S 3B4DA 2DNZA 1M1KT 1S72S 1G2EA 1DZ5A 5MLCV 1SJ3P 5DDPC 1JJ4A 4UY8T 2DGTA 3MDFA 1D8ZA 1KOHA 2D9PA 1WEXA 2MKSA 1U1RA 4EGLA 2MZSA 2CPDA 1PGZA 2HZCA 2AD9A 1X0FA 2MZQA 1JJHA 2CPHA 1X4AA 5BJRA 2JX2A 1U1LA 2G4BA 1UAWA 2JRSA 2MPUA 4RU2A 1WHWA 1VQ6S 2DNYA 5GVQA 3LQVA 5LSOA 3NS6A 3V4MA 1QM9A 1KD1T 2PEHA 1JJ2R 1X5SA 2KM8C 2JVOA 2O3DA 1M5OC 1ZZFA 1VBXA 1H2VZ 2OTLS 1VC0A 2DH7A 2M70A 2DNMA 3I56S 2U1AA 2KT5A 2YTCA 3HHNB 3MUTP 1QVFR 3OW2R 2F9JA 3CTRA 3FEXB 2RVJA 1NO8A 4F02A 1D9AA 5IM0A 1YJ9S 4CH0S 2XNQA 3CCQS 2QA4S 2LKZA 1OIAA 2G1DA 3TYTA 1SJQA 3CMES 4TU8A 1U1PA 4WFBQ 3P3DA 1X4FA 2CPXA 4F26A 2J0SD 3CXCR 2KG0A 3ZZZA 3VF0B 3R1HA 2DNKA 5JVGQ 1FJ7A 2MY7A 1KQSR 3CCLS 2OSQA 3H2UB 2HGMA 1YI2S 2RRAA 1U1OA 4QU7A 2L08A 4UQTA 2MZTA 2MQLA 1F9FA 2LMIA 5LJ5Y 2DHSA 2MMYA 2MXYA 4WKRA 1WF2A 2N3OA 4U67Q 2CPJA 4TU7A 2KH9A 1M5KC 1M5VC 3CULA 5JVHQ 3VAMA 4IO9Q 1SJ4P 2SXLA 1FXLA 2M0GB 4OZ1A 1SJFA 3HI9A 2M7SA 2OJ3A 4QQBA 2MKKA 4C4WA 1U6FA 2G0CA 2KVIA 3SDEB 5D77A 2MB0B 2N3LA 3BEGB 2M8DB 2M8HA 5DDRC 1WI8A 2DISA 2RRBA 3PIPQ 3UCUP 2CPYA 2DHAA 4OZ0A 1WF1A 4CQ1A 2VOOA 2E5HA 3THPA 2E5GA 2U2FA 1M90T 2DNRA 2B0GA 3RW7A 2MZ1A 2MQQA 3VAIA 1X5TA 3VAJA 3EGNA 3Q2SC 3DLLQ 3TP2A 4C0OC 4TU9A 2CQIA 1X4EA 2E5JA 2EK6A 2RT3A 3B4MA 1VBZA 3P49B 1A9NB 3K0JA 2MJNA 5LJ3Y 4LJMA 4ZKAA 3MUMP 2XS5A 1K9MT 3RW6A 4PKDB 2LA6A 2CPEA 4Y00A 2MGZA 3VAGA 1ZZNA 2CPFA 4WF9Q 3CUNA 2DGUA 2DGXA 2DIUA 2CQ0A 2J8AA 2AYGA 2FPHX 3UD3P 2AYBA 2F9DA 2YKAA 1YWXA 2CQCA 2MY8A 4A8XA 2CQDA 2LECA 5DDQC 2QFJA 1X5PA 2L9WA 5LSLA 1HD0A 2M4MA 3VAHA 5DM7Q 2AYMA 1UP1A 5IFMA 2X1GA 1N88A 2D3OR 4F25A 2KXHA 2GHPA 2YH0A 2VODA 3P6YC 3Q2TC 1HD1A 2MSTA 2OIHA 2DHGA 1OWXA 3UWTA 3NMRA 3G9CA 2DGVA 2KI2A 3CD6S 2KM8B 1X4CA 3CF5Q 1W2BR 2RUGA 1O0PA 3G8SA 3NS5A 1B7FA 1WEYA 1X4BA 3CCES 1NJIT 2GO9A 5CXTA 5GAGU 4IOAQ 2CQGA 3ULHA 1YHQS 2MZRA 2MQPA 3D2WA 2E44A 1N52B 2FC9A 2JWNA 2X1BA 5IM0B 1WHVA 5HL7Q 2Q79A 3BO2A 4TLQA 1DBDA 1SXLA 1XN9A 1VQ9S 2MYFA 5FJ4A 1R8PA 3G6ES 4M5DB 2X1AA 2DO0A 4IUFA 4WFNQ 2ZJPQ 2RS2A 1VQ7S 4J5OA 2KYXA 3BO3A 1WHYA 3N9UC 2LEAA 3CMAS 1M5PC 3G8TA 2BZ2A 5DDOC 5LXRA 2QEXS 2XS7A 2DNOA 3NNCA 2E5IA 1FNXH 3G96A 2LXUA 1U1NA 2BOPA 2LA4A 1WG1A 3ZZYA 2RQCA 5GAHU 4Z2XA 1NU4A 5GMKa 3P5TL 2DNQA 3U1MA 2AYEA 2DH8A 1S79A 3US5A 1H6KX 2XNRA 1UFWA 1X4DA 3CC2S 2MKIA 2FHOB 3CPWR 3CCSS 2L41A 2MJUA 3MXHP 2OTJS 2LQ5A 2KXFA 1HL6A 3VAKA 3IRWP 4PRFA 3UD4P 2I2YA 2DGWA 4FXVA 1VQKS 2M88A 3NNAA 3CCVS 4ERDA 2DNPA 3S8SA
chains in the Genus database with same CATH superfamily
4FS2A 2V2VA 2RF2A 3DOLA 3MUVP 1HQEA 4NLDA 2H5JB 2EBGA 2IRYA 1CVJA 4G65A 2WVEA 1Q5YA 5BYQA 2ACMA 2MKJA 5L8RC 4A48A 3C6TA 3BSOA 2IRUA 5GADU 1FF2A 1FEEA 4CTAA 3LH2S 2F5GA 2RNEA 4F0HA 2HRYA 3FBBA 4FS1A 3EJMA 1CJUB 1SH3A 4QYZJ 4YB5A 1RWPB 2CRLA 4RW8A 1JLFB 2WONA 3I9ZA 4P52A 2IHR1 5E3CA 3TJ8A 3R5JB 2WBRA 1SCJB 3UW1A 1WUUA 3G4SS 4WK1A 5DRKA 2ZBCA 1HARA 3R2DJ 2XSFA 5HANA 5J2MB 1FKPA 3KLGB 3E3XA 3ZNJ1 2F3JA 3MPDA 1OY9A 1HNZJ 1NHKL 2XWYA 1ELOA 4CO3A 1M5SA 4A8SA 1V5IB 2K1RA 4KB7A 2YVSA 3OLBA 1YZ6A 2GJIA 2FC8A 1PJ7A 2B6AA 5HMXA 3ENQA 3CCTA 4O4RA 5DGAA 4HVZA 1MN7A 3GCXP 5KTQA 3ILLA 2BKPA 3NWRA 3MURP 2HNZB 2K3KA 3DLBA 2BEFA 4DR6J 1TL1B 1VQNS 4WWSA 1GAOA 5KFDA 1RT6A 1RTJB 5DDPC 1HBOB 4HEA9 2HBYB 3QMQA 1N32J 3H7HB 1SQEA 2VJVA 3MMCA 5A6WA 4XPCA 2QLXA 4Q44A 4EBCA 3PX6A 3BYPA 4Y2AA 1C2PA 5IT0A 3ETOA 4IYQA 3H98A 1TL5A 2CFXA 4CLYA 4GKKF 4KE5A 1X5SA 4KFBB 1MN9A 3I56S 1ZS6A 1C1CA 4JV0A 4PQUB 1URRA 5DQHA 3PDNA 2ZBRA 5IXUA 3KDOA 4DCOB 5I3PA 3BGLA 3LAKA 3HFVA 3MWBA 4CO4A 3D0GE 1N34J 2Z4PA 5E3AA 4C8NA 1R8AA 4NYPA 3UO0A 5JVGQ 5AJ3F 4RLEA 5K20B 2HNDA 1LWCB 2B5JA 2MZTA 4CZCA 3BF4A 4IRDA 3CVKA 3OD2A 4U67Q 2VG7B 1DQ9A 4LFAF 2SXLA 1MSWD 1XMQF 2JH3A 4PG6A 3F44A 3AHPA 2WOMA 3BEGB 4KGVB 1TKZA 1KS2A 4WIQA 1S6UA 2VOOA 1HHTP 2OLWA 2QZ8A 2ZE2A 5T41A 2IC3A 4IRKA 4QPXA 1NJWA 3I5BA 2HQCA 2YKOA 2GAGC 2WSFC 1F1BB 4FNIA 2G0IA 2FLPA 3ZTOA 3OXGA 3K5LA 3DI6A 5HQMA 4A47A 4C8OA 1Q0NA 5HVGA 3GILA 3MPUB 2ACYA 2FB0A 3F56A 2HQ3A 1X9WA 1Z4UA 4EYHB 2EC2A 1T9TA 2YX4A 2M4MA 3WZ0A 1UJ5A 1XMBA 4NA1A 4DL6A 2DPJA 1TL7A 5L1KA 4L75A 1VHIA 1KRPA 2PDAA 2VQFF 1RBOB 1X4CA 3W1YC 2GIQA 2HFZA 1VRTA 3G8SA 5IC4B 2V67A 3D6HB 3TRGA 3D7SB 1HYSB 2WRMA 4J9SA 1DTTA 4LSLB 4YR3A 1FWPA 1VYAA 5GAGI 2AJ4A 4I2QA 1XJWB 5ETRA 3MMAA 4YQWA 2GJ2A 5HL7Q 4NLYA 1XN9A 2ZOFA 3LP1A 4DFKA 5KFBA 3H5UA 2C2DA 4WFNQ 4J5OA 4JB8B 3EWGA 3VVTA 5CD4H 3C8YA 4NXNF 4MK7A 2YWFA 1NHUA 2IYIA 3N5BA 1ZETA 3G96A 1NK8A 3B6BA 5D4NA 3UNYA 4ANCA 3UD5A 4OI3A 1RI7A 4DV7J 1TUGB 4J9LA 2J7WA 2C2RA 2D41A 4C97A 3THVA 4KJIA 4DU7A 3IRWP 1S99A 4FXVA 5I42B 3IWNC 3W2WA 4OYXA 3V5RA 1I1GA 5HROB 1Q82T 1N5QA 1OQ6A 2P9GA 2PO4A 4PYAA 3HT0A 3SEOA 4EU0A 3DRYA 2W4CA 1P1LA 1OMSA 3FEYB 4DR4J 6FDRA 3I96A 2ZH6A 2A3JA 4X4PA 4OV6A 3MECA 1FJEB 3V6JA 3K8VA 3KKFA 4ALZA 2AJ1A 2OPQA 3M2UB 2KRBA 1WTBA 1LW0A 3M9MB 1NCLA 4Y6IA 3SXLA 1O8BA 2ROGA 4CLLA 1VMBA 4FXWA 4I4BA 3CGIA 4CIOA 3OSNA 3R27A 2ZVIA 1VIOA 1D8YA 2NZ4A 2FLLA 4B3MF 5B08A 3PR4A 4IG0A 4YHHF 3FSXA 1EQMA 3PW7A 5CABA 2ERRA 5D78A 4ECRA 4NCBA 1DQAA 3W9HA 2K3IA 1G3OA 2R7XA 1GXTA 3G8QA 4S0MA 2QMUB 3M2VB 2Q66A 1T02A 3M32A 3MM9B 3ENWA 3RBEA 4GMKA 2RQMA 3Q8VA 4FF2A 2FZGB 2XO7A 4USMA 1FDAA 1FO1A 3IG1A 4HH1A 2R7QA 4I6AA 2QLWA 4K2JA 4ZLJA 1HI0P 4LF7F 2HLTA 4RW4B 1ZTTA 3HULA 3BS9A 1RWUA 5KFEA 1IM6A 4N76A 5IS2A 4ZP6A 3CCMS 4W98A 2HYIB 4WYWA 1IKWB 4TXSA 4F4YA 4JI4F 2NPFA 2V6AA 2ZBQA 2DT9A 2YPZA 5D4OA 4C48A 2BUNA 4WP9A 1BQMA 3KHRA 1UA1A 3ZZ0A 3DRRA 1JJHA 4DLGA 2BE2A 2R8HA 1U1LA 3M2UA 2LQBA 3AD7C 4UOHA 2P2CB 4AXIA 2HRUA 3V4MA 2OEMA 4M5IA 2JVOA 4DSKA 2O3DA 4O3SA 2BJ7A 2OTLS 3SV4A 4YDXA 3OW2R 3HT3A 1HNVB 1M1HA 3HHDA 2QYGA 2WVDA 2QA4S 3KHHA 3VQTA 2G1DA 4Q0BB 2QLBB 1H72C 3QRRA 5KG6A 3AY0A 3ZZZA 1RWVB 2AX1A 3GFYA 1KQSR 3CCLS 4NA3A 3QAEA 2FJVA 2UXCJ 4QYZK 3EDRB 1SC4B 2HAIA 1YRUA 2CA9A 3D68A 1HFEL 4JI7J 4K4YA 1I94F 3QT5A 1AUSL 4NCAA 1HMVA 4RW4A 3NS7B 2M0GB 1S1TB 4C4WA 5E3QA 1OQ3A 1S6PB 3HJFA 1NH8A 1WI8A 4Q5VA 2N4CA 1IBCB 4CQ1A 1RCOB 3AD9C 3THPA 5J2QA 4QJVA 1P9YA 3VAJA 2Z2MA 2HQIA 1PJ5A 2YNGB 3DRPB 4ZIWA 3M6XA 3PRBA 2MJNA 4FKYA 3MEDB 2HS3A 2Z8QA 3GIKA 2EPIA 2IVMA 5A8RB 4J9OA 3C66A 1BC6A 1U2CA 1XR5A 4QWBA 1A6LA 2LQJA 1AW0A 2AMCB 4JYAF 3C2PA 2OD4A 1N5YA 3KYLA 3CJ2A 1TMMA 2FVCA 2DGVA 3BJYA 1SVDA 5I3QA 3ZZOA 3NWGA 3EZ5A 1MWZA 1RA7A 4AL5A 4KGZB 3MGJA 1X0PA 3UI3A 2MZRA 3HKZD 1R43A 3W60A 1TU0B 3HD1A 1VQ9S 2MYFA 3I4PA 3FBEA 4BWJA 3PRDA 4M5JA 1LW2B 5C42A 2RS2A 1NSPA 2V9WA 4IOBA 3W65A 4Z7YA 2LLZA 1K1QA 4NOHA 3FCHA 4ZIVA 2RQCA 2DNQA 3KLIA 1HPZB 3OR2A 3SSRA 4PG8A 1SL1A 1S6PA 1F60B 1T05A 4ETXA 4DV1J 3OTBA 2J9DA 3CDBA 5LL6d 4Y2MA 3SIPB 1D09B 4U95A 2VKRA 3EVMA 3DRPA 4A8MP 2RE1A 3MEGB 2VF3A 4JI6J 3MEDA 3QT8A 5K8OA 1S59A 2GJFA 3QPIA 1FKAF 3DXBA 2F40A 2CIMA 3W9IA 3QWPA 3PHTA 5IWAJ 1JLQB 3GP9A 3CIMA 3BGFA 3HM9A 3WC2A 4LMZA 2BANA 4LF6F 4H4MB 4Q8EA 4OYWA 1N36J 1RZMA 2AWZA 3KUHA 1R0AB 1ZPVA 1BE4A 3IRXB 2VC1A 3AB4B 3OTCA 4GVLA 3MAAB 3KLVA 1F6TA 2VG6A 4MK8A 1CS4B 4PR6A 4E0DA 3W5ZA 1GX5A 4FYXB 1U1KA 2V4QA 3D66A 2ZJQQ 4X4TA 3BGRB 5H1SV 3Q24A 3KJFB 2XI2A 1U6BA 4NLRA 3T3FA 5J1EB 4NMXA 2W24A 4P7TA 2OEJA 2CQ1A 3O6QA 4XTTA 1WOOA 1C0UB 4OHVA 4ZPTR 1TVRA 3M9NB 1X60A 2UXBF 1U2FA 3CE8A 1OS5A 1RHKB 4G1QA 3HFKA 3UVJB 5D4LA 5AE3A 1F9EB 3DN9A 3RRGA 1YJWS 1CBKA 2M5YA 2MZJA 1WD6A 2GGPB 2AKWB 4UOGA 4N41A 2HPUA 1R89A 3CNQP 2W9CB 3CB4A 3GYNA 1S10A 1WELA 3GFHA 2DITA 2ROPA 4ECUA 5KG1A 2J0QD 4HI2A 4KGXB 2WB4A 2VKZG 2W2QP 3Q8YA 4L3KA 3OR1A 1U26A 3WX8A 1RT3B 4PXBA 3DOMB 4DQIA 1VOMA 1JXEA 4DUZJ 1X4AA 1WHWA 2VPZB 3TZWA 3E2EA 3KDNA 2D69A 5DLGA 3ENAA 5KOXA 4X4NA 4HLBA 4PWDA 1SC1B 1UVJA 1F2GA 3C15B 5LSRA 1FD2A 5T7LA 2G2YA 2UVWA 2DNMA 4PXDA 3HSJA 2BJ8A 2F9JA 4ZPWR 2R8JA 4NLWA 1MMNA 2LXFA 4ER8A 5D4PA 1KTVA 3KUEA 4WTYA 3BN7A 2H4YB 1AXQA 4DSEA 1KQGB 1JLAB 3FEZA 4PG5A 3NGKA 2CXEA 4AE5A 3QLHB 3KNGA 1J5EF 4C3MA 1BQNA 3KLFB 2GFFA 4KQZA 3I6PA 3OT9A 5HQLA 1AYEA 4I69A 1RYRA 2HFVA 2GHWA 3VAMA 4GRSA 4IO9Q 2DCLA 2M7SA 1Y4ZB 2G0CA 4LFCF 5HSPA 4B9NA 5EGYA 4LF5F 2E5HA 2KO1A 2VG5B 3SFGA 4CO0A 4TU9A 2CQIA 2EK6A 2G2ZA 1VBZA 4OZLA 4B02A 3H8YA 4LSNA 5GMDA 3VZHA 3VAGA 1RLDA 2H5EA 4GO5X 2DIUA 2CQ0A 2J8AA 2CVEA 1U7LA 3UD3P 3Q89A 3BR9A 1Z2LA 4MIWA 5DDQC 4MYUA 1ZBTA 1AZSA 3OPKA 5B09A 5KFQA 2ILZA 1Y5IB 3DLKA 4MKBA 1N88A 5CZXA 5F0UA 3NMAA 2QN6B 2IBKA 3MM7B 4L3NA 3E51A 1HD1A 4MKAA 1PC5A 2D3ZA 3NKYA 1UMJA 1S57A 4UUWA 1NKCA 4CYUB 2EG2A 1SUQB 2B51A 4Q2LA 2IRXA 4IOAQ 5DLFA 2V8VA 3EZUA 2JWNA 1GEHA 1EHWA 4WFXA 2OMOA 3MTJA 5F3TA 3LP0A 3IS9A 4LF8J 1BGXT 3A3NB 1LXNA 3QLHA 1R8PA 1HNXJ 1B4SA 3J7A1 3LP2B 2W7OA 4WPAA 2E66A 1BUXA 2XS7A 3NNCA 1FVQA 2Q3PA 1EETB 2LXUA 2LA4A 2CG4A 1YLXA 1SC3B 2R42A 4X4RA 3PG9A 2FHOB 4DSFA 2KXFA 3QGHA 2VDHA 4G3IA 3TVKA 2CNOB 2C3MA 1IUJA 3DLGA 1X9MA 2EXUA 2F1FA 2KDOA 5G0RB 5EX0A 4M95A 1KN6A 1VQYA 1WC4A 3QGGA 2XLKA 1IR1A 1VQOS 2FYXA 1YIJS 1IKYA 4E2FB 4FZVA 2J0XA 3PFOA 4MTPA 4DJBA 4I6WA 1K8AT 4QWDA 3FSIA 3QFWA 2W9AA 2VH7A 2YNIB 2M52A 2JZ5A 2CQBA 4ZJLA 5CYMA 5B0CA 1DRZA 4W4MA 5LMNF 5ETNA 3R7SB 3HX9A 5F8LA 2YQ3A 3M8ZA 2CJ9A 1YVFA 1WSRA 5EWGA 3U27A 4V19X 1YJNS 1N32F 2AW0A 2W9BA 4IO1A 4WU2A 2DK2A 2YH1A 3ITHB 3THTA 1JB0C 2OSRA 2ZBPA 5CYJA 2DGQA 4U96A 3TAQA 3ELHA 1DJ0A 5IQQA 1URNA 4DV5J 3W8PA 3KUGA 3EDQB 1S1UB 4DMZA 1R6VA 1FVSA 1NLKL 3Q8UA 4F4KA 1NDPA 4YY3F 4DV6J 3IWLA 1N34F 3FMWA 4XPEA 3B82A 2CDRB 1M0SA 2DEJA 4UT4A 1OSCA 3R9LA 2CJQA 1RT1B 1GXUA 1NK4A 4DSLA 4DWIA 2LCWA 4P7VA 3F0NA 1CLFA 3I55S 1DZ5A 1HNIA 5L1IA 2E1AA 3MR2A 1FXRA 1FTRA 4XO0A 1C1BB 2AGOA 5K8PA 3QQCD 5KFPA 3H2LA 2OAUA 2ZOGA 2JRSA 1S12A 2KFNA 4ANDA 6FD1A 2FZCB 2JEIA 5C5JA 1VHFA 1C0TA 2FZKB 3CD0A 3HHLC 2H54B 4I1TA 4QIGA 3D67A 4GKJJ 1AFIA 2M70A 3WHIA 3X3UA 5A6PA 4JI8J 3R6LB 3PNIA 2R7TA 2HHVA 2HWHA 1P8GA 2XZTB 3CCQS 4OHZA 3MZIA 1RHMB 2QTWA 4U7CA 3VF0B 4P2SA 2BACA 3CSKA 3M8PA 4FBTA 3BKTA 4O4GA 2HGMA 2OFHX 5B7WA 2RRAA 5KFFA 4CT9A 3GG1A 1U1OA 2YKMA 2E7XA 5AE2A 4B3RJ 2R2RA 4TYBA 2I5JA 3TARA 5LJ5Y 2JEFA 1WTFA 3MM6A 4FPIA 1WKJA 2CJYB 3L95X 2PA3A 4Q7AA 1U6FA 2A2CA 3DOKA 1WORA 2GVDB 1OJ4A 2U2FA 4NYZA 1FD8A 2ZHAA 3C16B 4PUOA 2POKA 2HK2A 3P49B 1SL0A 2BM0A 4O0NA 2HIYA 3TUJC 1GT8A 3V4IB 1JKHA 4O3OA 3T1HJ 4A8XA 1S4EA 2FVPA 3GR1A 2WCXA 1B7YB 3H5YA 2F63A 1NMEB 2J5AA 4ED2A 1IBMJ 1EARA 3UN5A 5KFKA 3W2VA 4IH7A 4DR1F 3Q8SB 3KK3B 2KI2A 4URQU 4WP8A 1RU2A 2RUGA 4NI2B 5J1PA 1NJIT 1IKXA 1S6OA 1S1XA 2KT2A 1FCAA 3CDWA 2XLIA 3ISNC 4H4KA 2X1BA 4ZCIA 5IT9U 2P5VA 2BABA 2W1BA 1LWFB 3D54A 1FRJA 2DXEA 3BSCA 5B0GA 3CMAS 1KQFB 1QE1B 3J81Y 4QCLA 3L9ZA 1YRXA 1RAJA 1FNXH 2MKYA 2B3TB 2ZDPA 3ZZYA 3OLAA 5GAHU 3GJSB 3PY8A 1IKVB 4DR5J 1MMDA 3G6VA 1KEKA 2RSQA 4DHVA 3FCWA 2XYGB 1HI1A 1RISA 3MEKA 4PRFA 3AXKA 4NLTA 3SQGB 1HWUA 1S1VA 3SYZA 2Q6BA 4QU6A 5C2GA 4RBTA 4LRBA 5DG9A 2D74B 2UUCF 3BPDA 2CQ2A 5LMUJ 1IBLJ 4KH0B 4OI2A 4UZBA 5AXLA 2MQNA 1VBYA 4P75A 3OHBA 2UP1A 1SV5B 3AQPA 1NNDA 2PA8D 2J9DE 4C8MA 3GIJA 4C9DA 2FHMA 3C6UA 4U9RA 1VCTA 3BBBA 1WC3A 1H73A 2HURA 3M8QB 1Q95G 5C2CA 5KFCA 1WEZA 4URGA 1GTEA 1UW4A 3HXMA 1YZ7A 1D1UA 4CO2A 2RMLA 1AROP 1TKTB 3G2XA 3NP5A 2ZJRQ 4HKQA 1SIWB 2IJRA 4JP8A 4OZ3A 5D0EA 3MPVA 2PI5A 5ITHA 4WBFA 4LT6A 4JI3F 3S7RA 1BWVA 2BQUA 1VI7A 3HD2A 3D28A 3CW2C 3FZ2A 4MT1A 4B3TF 2FTRA 1QE1A 1HHSA 2NS1B 1PYTA 3RGIA 2L3MA 3DYAA 1EAYC 1ZPWX 3QIPB 3TA2A 1T9YA 3POTB 4OIXA 2FGCA 4J7CA 3D9BA 5DM6Q 1TL3A 4YB6A 3KK1A 1AUDA 2DR9A 2GW8A 3CJRA 3S1TA 5GAEU 3UDCA 4X4UA 2K8GA 2UXCF 3NXZA 1VFJA 1RU1A 2QYCA 1BD6A 3FNNA 4YUDA 2FHJA 1SKRA 4RNMA 4O23A 1Y3KA 4CM2A 4JI7F 2RD5C 1M1KT 5C25B 3NAIA 3T41A 4GKKJ 2LVWA 3IC1A 1UEUA 3GPAA 3DM2B 1T03A 3UPFA 1FA0A 1RAGB 2PD1A 1TKXA 4IR9A 1T9WA 5KFUA 1CJKA 5HLFA 1NSQA 2NXNA 2WSEC 1FFWB 3KHGA 3MAQA 3N5FA 3O5TB 5AJ3J 1FTCA 2BJ9A 1F5BA 3HHNB 2AZ3A 2C3UA 2FGOA 4OL8A 2IAJB 1YJ9S 1RWNB 4DR7F 4DEZA 3TYTA 5KFSA 3NBPA 1XMQJ 4WFBQ 1FK9A 3KG0A 2HVIA 4FF1A 1VIXA 3KLHB 4NA2A 3TEHB 1SKWA 3H2UB 1KBRA 2MQ8A 2FJXA 2PEBA 1XK8A 4PABA 2G9OA 2MXYA 4TY8B 2PFFB 3QIPA 2UU9J 2C3OA 3T6BA 5KG4A 3AJ1A 2RKIB 1P6TA 2OFGX 1U2RA 3ZZUA 2IJFA 2MB0B 5F8MA 2F8EX 4F3OA 1S6QB 2UUBJ 1NSAA 4ZCKA 4J37A 5ADZA 2RB7A 3M1VA 5C25A 4ZKAA 2IA0A 4PKDB 4RWWA 1M5HA 4TYAA 4WF9Q 3GFXA 4Z37A 2DGUA 1KHWA 1V3ZA 4NWBA 3MEEB 1RT7A 3AJ2A 5FLXU 2V8PA 4NXMF 2UUWA 2NXUA 4RX6A 3U02A 1FRIA 2O1PA 2ZD1B 2L9NA 4NLQA 2R7VA 2D3OR 3DDNA 3PV8A 1LOUA 3Q83A 4HDGA 4JI6F 1CJTA 3K17A 2RDDA 2EFGA 3PZPA 3HHLB 5ETOA 2A18A 1S7IA 4M5MA 1WEYA 5CYQB 1B70B 4NXNJ 5AXNA 1HI8A 3CJSA 3GYGA 3HVTA 4QYRA 4NZ7A 3NGDA 2Z2YB 1N36F 1D9DA 1SXLA 2KJWA 3M2RB 3GR0A 4ECYA 1I5OB 2XSJB 3PW5A 1CJVA 4Y34A 4DBQA 4K5RA 4TY8A 1JNRB 2QEXS 4WFYA 1NDKA 4B9UA 1NU4A 1TUVA 3U1MA 3W7BA 4P2FA 3M8RA 2V9KA 3UN3A 5A0YA 4KC5A 3QZ8A 3OVAA 1C4AA 5CA5A 2BV3A 4I56A 1H74A 3J7YU 3IN5A 3TX0A 3PIOQ 1FKOB 3AOCA 1YKWA 4RW6B 1S5ZA 2EEYA 3C14B 2R3VA 1NJXA 3BB5A 3CCJS 5K14A 1R8CA 2GS8A 2J6TA 4ZHRB 4O0IA 4ED8A 4M5LA 5KG3A 1VISA 4B3MJ 2BA9A 2F8HA 2YX7A 2RU9A 2VBWA 2B4VA 2O5DA 2L48A 3HCXA 2QA2A 5HJYA 3HHLA 2MSSA 2X1FA 4WXWA 3DFEA 3W63A 5CYQA 2CPIA 1S9EB 1NUEA 2OMLA 2A6OA 1Y5NB 3DMJA 4GVBB 2DIVA 4NRTA 1WC1A 1S0NA 3G87A 1N8RT 1APSA 3PYDA 1S9GB 3LGMA 3TA0A 3TAPA 3E8OA 4QIWD 1KOOA 2ZH1A 3WBZA 2BJDA 3N6LA 4ZITA 2YWKA 4ED7A 5EX3A 1J5OB 4USTA 1T9UA 3UDLA 3TUPA 2IJNA 4HTJA 5C24A 2E7WA 3BN4A 2ZC3A 3PJ9A 1HBUB 1WDTA 1I51B 5E33A 4DFPA 2IFXA 1CULB 2UVRA 4JI4J 3PACA 2NSBA 1J2VA 4HHUA 3AD8C 1VDHA 5ETTA 2RAQA 4NLXA 5KFTA 4HACA 3J81U 1UVLA 3PCOB 2ATCB 2ZOMA 2F7VA 3JB9k 5DETA 1O5JA 5KFLA 4XIUA 2C28A 3PJXA 4RW6A 2FIUA 4JBCA 4NE9C 1HBNA 4Y3CA 6AT1B 1HKAA 2CPDA 2ASJA 1X0FA 4KBIA 2XYHB 4YEAA 1GMWD 4MFBA 1HR0F 2EFVA 3K5OA 3AT1B 4MKVA 4DFMA 1H98A 5DG8A 2VJUA 1RWOB 5FDLA 1VBXA 2GA7A 2BJ1A 2VFUA 1DLOA 3MUTP 1H7WA 1L3TA 4QR2A 2RVJA 3BDEA 3ONQA 1D9AA 4RO0A 1KP6A 4IG3A 2ZM6F 3P4UB 4OYAA 7AT1B 1IN0A 2WBMA 3W62A 3V81B 1U1PA 3P3DA 1PC4A 3N6NA 2DNKA 4LRCA 1VRQC 5IQ6A 3MM5A 1F9FA 4M5GA 1BHNA 3W66A 4KYZA 3F73A 1M5KC 2YY3A 3GSIA 2LDIA 3KJQB 1HBUA 4JV5F 2G13A 4OZ1A 1RTIB 2GVZA 4CLWA 4ELUA 5D77A 1UCNA 4NZ6A 2YNHA 2VBXA 4PYDA 2OGUA 2YPYA 3D5MA 1V5VA 3N0VA 1MROB 3QGPA 1IXKA 4K4WA 2KFZA 4JYAJ 2QC3A 1K44A 4F4AA 1HWKA 1NJYA 3CUNA 4LQ3A 3TJAA 2BDPA 2YKAA 2FJDB 3ZO7A 1Q79A 4TQSA 2V4JA 3VAHA 2R7WA 4F4ZA 4NMLA 5KG2A 2OPPB 4EZ9A 3Q8QB 4USVA 3Q22A 4CLPA 1N33F 3RBZA 2OD6A 2ZH8A 1REVB 3SCKE 3I5CA 1W2BR 3BSAA 9RUBA 5KFNA 4J9NA 4MYTA 3D6MB 3QWUA 1JLGB 1UJ6A 4USIA 4JUZA 4H4OB 3ZZTA 1K0TA 2FC9A 5D3GA 3M6UA 4CLUA 1UPPA 3OSPA 4C8KA 4M5DB 1XR7A 5J2PB 5CD4A 4KSEB 4OX9J 4AQYJ 1LKZA 2UV8A 3AH6A 2DXFA 2J0WA 5BYRA 4DPUA 4C11A 4LF4F 1O6XA 1CG2A 3JSRA 1RTIA 2HAFA 4RNFA 5L9XA 1WOSA 3G82A 1FRLA 5KFVA 4YS2A 2DR8A 1UKUA 3HZGA 2LU1A 4K5SA 4OYIA 1F2HA 4NLPA 2BW7A 3CCVS 2HQDA 2Y0BB 2HHTA 2XMKA 3GJRB 3GIRA 3DRSB 5EUHA 1FRHA 4DZ6A 4YOEA 2J76E 2KU7A 4CLTA 4DV5F 2FY8A 1U49A 3RR7A 3BPSP 2ADBA 1EQ0A 1KC8T 1OO0B 4DV6F 1WC0A 2ZEJA 5ETVA 4ETZA 2DHXA 4B9MA 2ASLA 3G71S 1WOPA 5A8KA 4KHRA 2LXIA 3OFFA 3BO4A 2HNYA 1JLCA 3NAHA 3ZTRA 2BYCA 4F0KA 4K4TA 2HFUA 3MMBA 4DPWA 2DRAA 1YTYA 4U8VA 3DC2A 2HGLA 4DV4F 1S0VA 2IPOB 4F50A 4ZVSB 1QSSA 5CCLA 3CMQA 1VS3A 1VRUB 4R0JA 1XBWA 2C3YA 5M2RA 4IFVA 2JNJA 1G4CA 2MKCA 3IXQA 5IZHA 3PEJA 5T14A 4ED6A 4DSIA 4DR3F 1SQGA 2DRBA 2RS8A 1T3NA 3H4BA 1IJFB 1Q16B 1Z1ZA 1VK3A 2CJKA 2E1MC 3DRSA 3R5AA 2H5IB 1RTZA 3TANA 2C1EB 4ZP7A 2Q1LA 4B3RF 3DGPA 3EXYA 1R0CB 5EN1A 4RUAA 3V6HA 5H9FK 2RF2B 3DOLB 3H2VE 4MH8A 5HP1A 1ROFA 2VL1A 1QUPA 3HHKA 2WAQD 4EWTA 2ZH4A 3MDFA 4EGLA 3RB0A 4FYVB 2O66A 4CH7A 4M1KA 3ZXWA 1LQ9A 3J80U 1UAWA 3IWXA 4H54A 4RW8B 1DAXA 2WONB 1ZZFA 1TELA 2VU5A 4KPCA 1J5EJ 2IM0A 3CIZA 3Q23A 3V2UC 2WSCC 4F02A 3WQPA 3OL6A 3A12A 5E7OB 4CH0S 1RE1B 3U1NA 2NUHA 2BJ3A 3I0RA 3EE3A 4QW9A 1FKPB 4U6PA 3GSDA 3I82A 2MY7A 5E41A 4ES2A 4WP3A 2A2DA 1PG5B 3TR5A 3K57A 2L08A 4DCPB 3DRXA 2R8GA 4LF5J 4RPFA 4TU7A 3CULA 4OI6A 1UFKA 4IFYA 1T11A 4OZJA 1IWGA 3ZZRA 3I87A 3P45B 3EZOA 4N8OA 5CAAA 2K1RB 1N5SA 1R27B 2RRBA 1KSPA 1I3OB 2E5GA 4YB7A 4WXOA 5AT1B 4AFFA 4G1PA 1O51A 2J9CA 2PSZA 1HHQA 4DR2F 3D3CJ 3IBFB 4YR2A 4BWMA 4DR5F 4Y00A 3HHEA 4ZPBA 1KTQA 3ADAC 3KLEA 1RT6B 1OYEA 3A1YG 2APOA 2XBPA 5IV4A 5LSLA 2XCPA 3MMCB 4KH1B 3GMGA 1H38A 3OJUA 2PIIA 2B8QA 4HT7A 2HG4A 2MSTA 3K59A 2OIHA 5SZTA 5LMUF 1IBLF 4UZCA 2VHGA 2HHHF 2XMTA 3QT6A 1WC6A 3LGNA 1B7FA 2CJBA 3RBDA 2QMXA 1GMUA 3MCSA 4K7QA 1C1CB 3JTNA 1DY3A 1Q7LB 4KO0A 4C3LA 3ZFVA 2W7AA 3K5PA 4R5PA 2Q79A 4ZLNA 1CSJA 4F8RA 1HQUA 4ZVQB 2KB2A 5HBMA 5H9EJ 4RW9A 3HZEA 3G8TA 3KG1A 1ICEB 1AT1B 2E1CA 1IR2A 2WVFA 1U1NA 2HNDB 2B5JB 1Q53A 3D0HE 3P5TL 4DQQA 4CNZA 2XNRA 1H6KX 3CPWR 3H0PA 2OTJS 1U02A 1U25A 2WOMB 4ZPDA 3CJ4A 2DRDA 4DQRA 1TKZB 1GH8A 5F8HA 2DVIA 2ZE2B 3CCUS 5LMNJ 3IA0A 2IC3B 1Q8KA 5KFAA 3AXMA 3FRZA 2QE5A 3AA8A 4TNOA 1IQTA 3TO8A 4OLPA 5GADI 1FJGJ 3R3TA 2ALZA 3VAFA 2QIFA 3J7Z5 3DI6B 3UCGA 2GMLA 1U47A 4ELVA 2HQFA 2FY1A 3DGVA 1KHVA 3PJWA 3D1QA 5F9LA 3IO1A 4W92B 2DGOA 2VA3A 5L38A 2YX1A 2LYVA 3V6DB 1TL7B 1HWIA 2KKHA 2VONA 4CLZA 4CWBA 3GFZA 4Y0FA 3BDPA 1X4HA 2GMHA 2ZUAA 3MCMA 4A8WA 1VRTB 4LR7A 2ABYA 2NZCA 1U48A 3TUZC 3LOUA 1DTTB 3PEHA 2KHDA 1QDUB 4YY3J 4HHJA 5DQIA 4I2QB 2P6TA 3MMAB 4URSA 1R31A 4HYKA 3BQ1A 3LP1B 2VOPA 1ZM2A 1RSCA 3KTQA 3IM8A 2D9OA 2W4PA 1LK5A 5KT3A 2N7CA 3FVYA 2DR6A 3MR7A 2BR0A 3OXLA 4JV1A 1OPIA 2QMWA 2I38A 1Q78A 1U4BA 4X2BA 3TZYA 1UWBA 1B0VA 2CQ4A 1RQ0A 3T5LA 4QWCA 4IDKA 1WDDA 3WIVA 1KVKA 2CNLB 3W2WB 2PC6A 2GZOA 2UU9F 1PCAA 3B4DA 1KLMA 2VDIA 3H5XA 3M6WA 2DGTA 4DS5A 4J9KA 2CNNB 4OZNA 1QSLA 1QAIA 4GC6A 3RJMB 4TKTA 1B3TA 2UUBF 4ZJOA 1ZAXA 2RQKA 4NEYA 3MECB 3ET6A 2XI3A 3GB0A 3VGSA 3V6DA 2OPQB 2KM8C 1LW0B 2P9CA 1LEOA 4X66J 1HLWA 2B56A 1FDBA 2D3UA 5B0BA 1SB6A 4X84A 4N56A 1XWLA 3IBCB 1X4FA 4P9SA 4F26A 4GO7X 5CZVA 2KG0A 4ID5A 1JXVA 4IG0B 3WX4A 3OL8A 4UQTA 2O67A 2HHSA 1TK0A 2V63A 4M63A 3M32B 1Y7PA 1KFDA 1G7CB 5JJBA 2OPRB 4K50A 3D6TB 3HI9A 3IG1B 4DX5A 2N3LA 3C46A 4DN9A 3WIUA 3PIPQ 3FQLA 2CPYA 3PVXA 2OH2A 2DHAA 3RU0A 5ETPA 1S4FA 2DNRA 4RL1A 3VAIA 3DLLQ 3TP2A 4LFBF 1FEHA 4ECZA 3GIMA 1S7HA 3IP0A 1XNRJ 4IQMA 3RW6A 4DR1J 4R8UA 1ZZNA 1RUSA 1KR4A 2GX8A 1YWXA 2LFVA 2Y1IA 2XEXA 4B3OA 2AYMA 4NCGA 1BQMB 3MPYA 1JLEA 3QZ7A 2V2ZA 3DRRB 2W7PA 3Q2TC 2BE2B 3SFUA 3BZQA 3RZAA 4FDFA 4CM0A 2A6MA 1AB8A 3CF5Q 3NS5A 2KZMA 5KFHA 1TKDA 1X4BA 2CADA 3H40A 3ULHA 3OV7A 2UVVA 1K1SA 1N52B 2HS4A 2J6SA 2ZHOA 2MLXA 3HMJG 2WHOA 3DLJA 1DBDA 3KFWX 5FJ4A 1RBAA 2DO0A 2KYXA 3FBCA 1TQLA 2LEAA 5LXRA 3GQCA 2E5IA 2OPRA 3AQOA 1XNQF 2A10A 2UUCJ 4U7UK 4OX7A 1T9XA 2Z0GA 3CC2S 3CJQA 2MJUA 2R4FA 2LQ5A 3W64A 1HMVB 1HL6A 3OFGA 3UD4P 3ICLA 3EGWB 2H9ZA 4ERDA 4WJBA 1HNWJ 4KGMA 1RT2A 3IR5B 1EP4A 2NLWA 4LUBA 1BXNA 3JSMA 1IM4A 1GNKA 3PHEA 4HR2A 2PT0A 2KTQA 3GJTB 1JLBA 4ED3A 5J2QB 1NXIA 1QAXA 3Q8PB 2EK1A 2I1RA 4DF4A 2GMJA 1FJCA 4P6QA 1Y9OA 2QLJB 5E3PA 1N54B 2OUGA 2AGPA 4PXCA 1YITS 4JOUA 2M9KA 1MU2A 4HI1A 3Q8RB 3K58A 2KZZA 4O3NA 2DBBA 4FVMA 4JI3J 1NPKA 2Z58B 2XY6A 1U45A 2DR5A 2YWHA 3MTKA 4WCEQ 3ZC4A 4IOCQ 4JI1F 1N5YB 3V6KA 4CT8A 3TX8A 5I3UA 4B3TJ 1FHTA 4O44A 3ZZPA 2V94A 2NXJA 3AODA 2Z2LA 1WHXA 5EWFA 4NLUA 3CDUA 2GQQA 2AJQA 1UEKA 4ZPAA 3M30A 1RKJA 1UVNA 1SPBP 1FRKA 2JSXA 4EO6A 4LF9J 2VQEF 1QY7A 4DPXA 3HVAA 5L1LA 3BQ2A 5C42B 4ES1A 2RQ4A 3LGHA 1LXJA 2CQHA 3OQ2A 2DNHA 4DV3F 2PE8A 3FFIA 4A8KA 1QSYA 2BRLA 3KLIB 3OR2B 2DNLA 1T05B 2Y9HA 1N6QA 2EG1A 2BXJA 4ICLA 1Q8IA 4BCAA 3CJKA 2V34A 3T6JA 4V1Ak 3KMSA 1MWYA 3QIDA 4ZS6A 4AYBD 1KOHA 2D9PA 2MKSA 3SCLE 1UEVA 2XGQA 3L09A 3UDVA 4F3MA 2HZCA 1V9OA 1RT4B 4QWEA 1E6VA 4DR7J 2G0JA 1UW9A 2ZZTA 1RHQB 4KV8A 2YKQA 2XY5A 3QO9A 1OY6A 1YJRA 1R8BA 1RWXB 2BANB 4ILMA 3ZNUA 4USJC 1VC0A 3MFIA 1RKIA 4BBYA 1NK9A 4C8YA 1S97A 1WACA 2VG6B 3AFGA 2C42A 2NXEA 3CXCR 4K8RA 1JIHA 2W01A 2IVFB 2HSEB 1JJCB 1N0VC 3OBIA 4ILRA 2LMIA 1H7XA 2CWXA 2XMUA 4J90A 1C4CA 2D1CA 4NYOA 1TVRB 2MKKA 4M5NA 2NCKL 4G1QB 3PFEA 1B99A 2DISA 2ZH9A 4RKUC 2VFTA 4OX9F 4RUHA 4AQYF 2XMAA 4NXMJ 1W26A 2DYAA 2ATLA 2HK3A 4DUYF 4A8QA 4KKOA 4OHWA 4A8OA 2MGZA 1D3WA 2DGXA 2XWXA 1IVZA 4M8LA 3PO5A 1RT4A 5EWEA 4DF8A 4IH5A 2X1GA 3OR1B 4RUBA 2GHPA 4ECWA 4X64J 1TK8A 2FUG9 1NDCA 2HBZB 2KM8B 2XO6A 2YWGA 4PWDB 1TV6A 1RWMB 5T7LB 1Q1KA 2C2MB 1UL3A 3EGVA 3SV3A 1JK9B 4H4KC 1MLAA 1S76D 5F8GA 4TLQA 3HHLD 3K7RA 4J9VA 2X1AA 2ZWOA 4MAKA 1YDLA 4F0MA 2H65B 3BO3A 4DL4A 1RAEB 5DDOC 1BQNB 3P5BP 4B9TA 5HJXA 1RT5A 2Y3YA 1S79A 1CEZA 4PXEA 1FNOA 4HTIA 3G6XA 4PQAA 3MMJA 3VAKA 5JUMA 3N01A 4A46A 4ZOSA 2Z56B 2KG1A 3J7ZT 2CDQA 3QSIA 4Y2CA 1EJ7L 3M6VA 3MM8B 2LP4A 4WE1A 3MOJB 3BKUA 1F3FA 3T9ZA 1S1WA 1L3KA 4P2XA 2AEMA 2DCUB 1U8WA 3BR8A 4LSNB 1WKKA 4N7TA 2CZVC 1N5VA 3PXGa 2E5LF 1Q8BA 2HMIA 2W4DA 4TQRA 3TI0A 1AZSB 3H20A 3DLKB 4LBHA 5HMWA 2N7YA 3E01A 1H2UX 2JLGA 2C2KB 2CZ4A 4LR9A 1RK8A 5E3RA 3UFCX 2BBEA 3SSQA 4DX8H 1PJ6A 3DHWC 2V68A 1R6YA 3GWCA 2RU3A 2WVBA 3H25A 2JC0A 1ZM4A 3LP0B 3IS9B 3OJSA 2VB6A 2YQ0A 1Q4RA 4QR1A 2XS2A 3T9NA 2LEBA 2CPZA 5B0FA 3ISND 3SDEA 1VC5A 1ZH5A 1QAYA 4ZPVR 4RU9A 1U0HA 3P8BB 4DV2J 1LWXA 2M3DA 3QBCA 1RBLA 1IQZA 1HWJA 4PPZA 1A7GE 1LK7A 1HR0J 2VA2A 3DLGB 2UXDF 3O3LA 3M05A 3MM8A 1KDNA 1UZDA 4PCQA 4C2MA 1G2EA 3GJQB 1NK6A 1SJ3P 3SI8A 2IDLA 3EYZA 5KFGA 3GV7B 1IKYB 3I0SA 2IDEA 2XZDB 2VPXB 3JQMA 4G1IA 2JX2A 4UOCA 3GONA 3TAMA 2ZM6J 4DG1A 2QSWA 3C19A 5CYMB 3NGTA 3HDSA 3TNVA 2QL7B 1HBMA 5IM0A 1EIYB 3BBFA 2LKZA 4JV2A 3W5XA 3VR1A 1SJQA 4K0KF 4JV5J 4UUXA 2W9BB 2HW3A 1EB0A 1U09A 3HFZB 2OSQA 3O8WA 4QU7A 3VCDA 2MDAA 2F4VF 4KHMA 2XZWA 4B08A 4ECQA 1SIZA 2R2TA 3UCUP 4ZVGA 8ATCB 2HFNA 1WF1A 4JI2J 5E2QA 2AQ4A 3VZIA 1X5TA 4B9SA 3RG6A 3QYYA 2JHEA 5D6GA 2AU0A 2XS5A 3Q86A 1NHVA 4HHHA 4B3SJ 1N33J 1CJUA 4DQPA 4L6V3 5DS7A 3HSDA 3NOGA 1HNIB 1NK7A 1JNZB 3H4DA 2QFIA 4WYLA 4USKA 1RADB 3IR7B 2EFPA 1JLFA 3KG4A 3ILJA 2PN6A 1UP1A 4OYPA 4F25A 2X3GA 1RHJB 2R7RA 3A3OB 2B9XA 3JAMY 3UWTA 2GQCA 1PBAA 3FUYA 4QIEA 3R5DA 1TP7A 2HLUA 1C0TB 5J2MA 3KLGA 1FJGF 3CCES 2GO9A 2YQ1A 5F8NA 2ZHBA 3NGUA 1V3SA 5GAGU 5K9FA 4D3GA 3D2WA 2E44A 4LF4J 5ETMA 2GNKA 3I5AA 2LDYA 3CDAA 4DXLA 3H90A 1T94A 2CVIA 2BMBA 4L73A 2ZWPA 3FQKA 3UDEA 5B0EA 5U47A 3M8PB 4XAKA 2OI2A 4O4GB 3X1LB 3JQJA 3TOQA 2YKMB 5A76A 5KFWA 4X65F 4EYIB 3CCZA 2I5JB 3SQOP 2DPIA 3MM6B 4L74A 4ITSA 2ZNYA 2MKIA 2MTLA 5CHCB 3BQ0A 2M88A 1GFWB 4X4SA 1TTHB 2F4FA 1Q86T 2HNZA 3DOKB 1PO6A 1S77D 4TN2A 1TL1A 2QG9B 1YQHA 5K5MA 1GMVA 1XERA 1PAUB 1SJ1A 4XK8C 1RTJA 1B0TA 1HBOA 4YB1P 2YKPA 3LUYA 4PUOB 1ULRA 2AV5A 3JXOA 4OX6A 2YKNB 1DHMA 3SMZA 1TUWA 4OLOA 2UUAJ 1RHRB 1D0EA 2UVUA 1JKHB 2IM1A 4JI5F 4DUTA 1YGYA 4DX6A 4KFBA 4CCHA 4AL7A 4DV4J 4W90B 3NG8A 4ZVTB 1RTHB 4PQUA 4R25A 4KPYA 3W2VB 4RZRA 4RNOA 4P71A 3OTDA 4ZK7M 2F65A 3A8JA 2F8MA 4MK9A 3O1LA 1SKUB 1IKXB 4DR3J 1S1XB 1WJ9A 1N56A 2XQCA 2DNNA 2B43A 2XCAA 2HGNA 1LWCA 4KGKA 4Q8FA 1HW9A 1BMQB 2XULA 3UN2A 2VG7A 3N28A 3T19A 4X66F 2WVCA 2XGPA 1YJVA 3TW0A 3AA9A 5KFYA 4N47A 4IQXA 3GLJA 3PYGA 1U1QA 3QSYB 2ADCA 2VFVA 1WG5A 2KHCA 1ZOTA 4Q45A 2L9DA 3CT9A 2R7UA 2E9TA 1XMOF 1BLUA 1LWEB 3FGVA 3QT7A 2KXNB 1WSVA 3VALA 1IJEB 5CCMA 1S1VB 1KONA 1MMLA 2DXDA 2XY7A 4DX7A 1U0SA 5KT4A 2YKNA 2ZNZA 3IAM9 3DCAA 1PIEA 1Y3JA 2CPHA 4X62F 2B4UA 4QW8A 1KNZA 3N4WA 3VGVA 5D8HB 4A8FA 4I6YA 4UY85 3C6UB 3NS6A 1XNRF 1RTHA 3WDOA 4ZVRB 2C2OB 1HYSA 4LREA 2FJBB 4LSLA 3AOBA 2U1AA 4C8ZA 1ZM3A 3N79A 4YFUA 2AEJA 5KT7A 3TQ1A 4K4SA 1VLYA 3OTOF 2WW4A 3DLHA 3NEKA 2IA6A 4USWA 2EFQA 2EW9A 4AD6A 1RABB 2MQLA 3M7VA 2JC1A 2DHSA 4WKRA 2CPJA 3ETMA 2COLA 1SJFA 2X3DA 3DYAB 4JI0F 4DR2J 5I42A 5J2NB 4KTQA 2V2KA 2KVIA 2M8DB 3L4BC 4AT1B 5HVHA 5HROA 1LWEA 3TA1A 1TL3B 3KK1B 1D9FA 3FDSA 2B0GA 1L3VA 3RB3A 3EGNA 3Q2SC 4C0OC 5M2UA 4N77A 1X4EA 3HVWA 3K2YA 2HHWA 2I9SA 4C0BA 2HHHJ 2AYGA 2FPHX 2PMHA 3ILIA 4EI2A 1X5PA 3W9JA 1HNWF 3KOAA 5DM7Q 3CCWA 1T03B 2RJZA 1TKXB 3ZTSA 4CO1A 1TAQA 1CJKB 1OWXA 5HLFB 4IRCA 2HZAA 1RAHB 1ITPA 1BWEA 3RAMA 5HQ8A 1YHQS 5AXKA 4BC9A 5L39A 5D0HA 3M2VA 4BC7A 1WHVA 3MM9A 3SCIE 5D0GA 5HI7A 4FF4A 3NBPB 3KNAA 3KK2B 2R8KA 1FK9B 5KG0A 4P72A 2W2NP 3CD7A 1WKLA 3JQKA 4OX8A 5KG7A 2ZUGA 4ANEA 1X31C 2DY9A 3D1HA 2ZH7A 2IIHA 3KHLA 2H1YA 4FYDA 1WG1A 2IY5B 2E1RA 2AYEA 3OTEA 5GAHI 5J2NA 1X4DA 4CRJA 3G86A 3CCSS 2L41A 2H48B 5BYSA 3LAMA 3NNAA 2B7CB 1YBAA 2DY1A 3S8SA 1GMWA 4K59A 4LF9F 3LWMA 1G6BA 1JMTA 3GU0A 2JFKA 1IKWA 1FE4A 2VC0A 2VV5A 4DN0A 1QJHA 4EEYA 1B64A 5EDWA 2EI5A 4C7QA 3M1VB 4M5HA 3FMBA 5BR8F 3UR3C 3AAWB 4OI1A 5LXYA 2KYZA 3CCRS 4F2SA 2HHUA 1QUVA 1XTZA 5FIIA 3KXDA 2DGSA 1RT7B 2ZZNA 4LSZB 1F0XA 1V3RA 2Z2ZA 2MHEA 2KN4A 2KJVA 3LANA 4D3HA 1KVJA 1XQIA 2J9EA 2GAHC 1CJTB 1HNVA 1IWAA 4DQSA 7FD1A 4FN5A 2OPSB 2HVZA 4Q0BA 5F41A 1S49A 2R2UA 3ILOA 2X51A 1WI6A 3D1OA 3EX7B 2JL9A 1NZ8A 2KVQE 2I8EA 1FDDA 3RRHA 3JAMU 3KK2A 1AA1B 3HVTB 3JTOA 4LRFA 4ES3A 2DEIA 4NLVA 1QTNB 3T1YJ 1NBEB 3IFEA 1R7IA 3CC4S 1X5OA 1QAJA 4PWUA 2B4OA 1S1TA 4ZMMA 3PM9A 2BQRA 1CJVB 3TQEA 1RA6A 2VBZA 1V6HA 3H42A 4KHPJ 2VPWB 3CO0P 3VV2B 5A8WB 4YN3B 4LR8A 3JSYA 1NKBA 2YNGA 4BHQA 5A0YB 4I64A 5KFIA 1R0BG 5GAEI 2Y1LB 4ZCMA 4GC7A 4FF3A 4K4ZA 3M8SA 1REGX 5A8RA 3EPIA 2K2PA 3RBXA 3UR0A 2IM2A 2RUSA 1D8ZA 1WEXA 3B78A 1H0HB 4EBEA 2MZSA 2W8KA 3RR8A 5K14B 4TLRA 2AZ1A 5B0AA 2XYPB 4X4OA 5IV3A 3MF5A 5GVQA 5HN0A 4C8LA 3BV8A 1NDLA 3CJ5A 4OJ3A 3H59A 3PRVA 3IR6B 2OPSA 1RWKB 2OP5A 2HVDA 1GTHA 4IKAA 5K8MA 1MNEA 2V2QA 3PO4A 4TU8A 1LW2A 2BVZA 4X64F 5AE1A 3DMJB 4N8NA 3MCNA 1VBKA 4BDPA 4UF4A 2NQPA 4HL9A 4XDDA 1HPZA 4LFBJ 5HATA 2B9EA 1YX2A 3PKYA 1XIQA 3FK4A 5DG7A 4WK3A 5C24B 4UW2A 4OYOA 5A8WA 4ECSA 2XMVA 2QRRA 2Y1RI 2NYHA 1MWQA 3MEGA 5ETKA 1SH0A 1VJQA 2MQQA 2AJ0A 3HPOA 3TVZA 4FYWB 3LALA 1IBKJ 4KY3A 4HACB 2FLNA 1A9NB 2ZKUA 2AEFA 3W3SA 3QJJA 3R2CJ 1JLQA 2CPFA 3MPWA 3TWZA 1HBNB 1FFSB 4LVNP 2MY8A 3RB6A 1S0MA 4H4MA 3RUBL 3D3BJ 3G6YA 1R0AA 5IT9Y 2KXHA 2PFDA 3P6YC 3CJ8A 3MR6A 3OL9A 2C2ZB 1JWWA 4MFBB 3IRXA 2QGFB 2BQ3A 3FJ2A 4ID8A 2K06A 3R6GB 3NMRA 1W25A 3MAAA 3PR5B 1CS4A 3ZTPA 4OMFG 2HQGA 1O0PA 2IVYA 1T3OA 2WK4A 5FDLB 3BGRA 3CJ3A 3OVSA 4LRAA 1DLOB 1XNQJ 4F2RA 1UJ4A 4IH6A 4YMEA 4WZQA 5J1EA 4V19J 2DD8S 4J9RA 3HSZA 1C0UA 4IG3B 3BO2A 1NSKL 3SSSA 2RHSB 4NPOA 3N9UC 1PYOB 3UVJA 1YBTA 5CH7B 3MM5B 4Z2XA 3IAS9 1UVIA 5GMKa 3US5A 2GGPA 1KFSA 3MR5A 2GVZB 4DV0F 2W9CA 2VPYB 3VVUA 3MI7X 2YNHB 4CP5A 3VTIA 3NRBA 2B7BB 2YBVA 1VQPS 3J7YI 1KQKA 2EKYA 2QLFB 4LIRA 3ISZA 3A8EA 1VQMS 3J7AN 1RT3A 3DOMA 2FJWA 3MD1A 4JI1J 3NNHA 3W61A 4O3RA 4DV2F 1WNEA 1Y5LB 4WIIA 2PMWA 1Q8LA 1WG4A 2BJEA 2JEGA 4ZDNA 1PKUA 2C22A 1K47A 3BGOP 4F36A 2V4JB 3C15A 5F9NA 4QWAA 1CPZA 2XB2D 1YK9A 2DNGA 3EM1A 3QJPA 4KR0B 2HFSA 4L72B 5KFZA 2ASYA 4CLFA 4F04B 1WF0A 2VQEJ 1TR0A 1P1TA 4BS2A 3R7NB 2LQ9A 1UTAA 2XMJA 3S6EA 4Z7CA 5ETSA 1VQSA 3F41A 1FE0A 4WFAQ 4NRUA 5DJBA 1JLAA 2HBQB 3SBMA 4DV3J 5HVFA 3GIIA 1NEEA 3L7PA 3KLFA 3SCJE 1RAAB 5D3GB 5I4MA 3L7OA 4ZCLA 4NX9A 4DCJB 5KFRA 3K8WA 1CC8A 5DQGA 4U8YA 2EWHA 2RILA 2HFOA 4C11B 4FBUA 2EFNA 4K4XA 1VLOA 1WWHA 2G1HA 5THWA 4I7FB 3NCRA 3G82B 2VG5A 5C7PA 1HNZF 1VR6A 2NSCA 1F3VA 3A8KA 1ZTWA 5M2PA 3KJVB 1QVGR 1ZA1B 5MLCV 2N4DA 8AT1B 1JJ4A 2NR0A 2Y8WA 4UY8T 1RHUB 4FYYB 5A2QY 2G2OA 3TJ9A 2KT3A 3A3PB 4I2PB 3MM7A 4I67A 1NB7A 2VFRA 4OHYA 4C3KA 4JI2F 1UFLA 5SUHA 4DR6F 5A8KB 2FD2A 3LW5C 1QM9A 4PG4A 1RXOB 2HNYB 4CYUA 1JLCB 2RDIA 2OELA 1SUQA 1H2VZ 1DQ8A 4LBIA 2Q43A 4B3SF 2KL8A 2YTCA 2XMMA 1K0VA 3AB2B 1TZ0A 3MMBB 4NEZA 4QIFA 4Y28C 4RWXA 3SZ2A 4EMDA 3CMES 3FKBA 3PW0A 1U24A 3LP2A 1FJ7A 2EBEA 3GG0A 5DZ6A 4DL5A 3I4HX 1YI2S 5KG5A 1EETA 2DKOB 3HF5A 2D3O1 4J9UE 1SJ4P 1FXLA 4IFVB 4I0WA 4RBVA 4O3PA 2CUYA 4DUYJ 4I7FA 3T5KA 4CLKA 3T5JA 1FDNA 2V4RA 5FLXY 4K4VA 2BW2A 4OZ0A 4UTGA 5G0RA 2V8DA 2BE7D 4ZVEA 2HEKA 3K5NA 2MZ1A 3QATA 2PMZD 1NPPA 3KJVA 2RT3A 4RJVA 3U7JA 3DGPB 5DZ7A 4WZMA 3MUMP 1K9MT 2AX0A 4FXDA 2HVEA 2Q6CA 3GE9A 2YNIA 5HP1B 2RH3A 4I2PA 1XEZA 1HD0A 1PYSB 1S9FA 3J81j 2YH0A 3QGIA 3IGNA 1KVIA 2GIRA 2BKOA 3G9CA 1GQEA 4K2XA 4NZ0A 1UA0A 4EUVA 4ZP8A 2XHCA 5CXTA 1U6ZA 2HWIA 3ITHA 3FC9A 2UUAF 2JJ4D 3HP6A 3PX0A 3LTOA 2VIHA 4MIAA 1LNQA 3PX4A 3I0RB 2R7SA 3R5BA 2NXCA 1N5TA 1F5CA 1S1UA 3EICA 1LFPA 3TEGA 1FI4A 4EBDA 5GMEA 5G4DA 2QSFA 7FDRA 4EZ6A 2XC9A 4NASA 1UFWA 3NOCA 1RCXB 2D7SA 1GK8A 3DKDA 1B0PA 3DXSX 4LF2A 1SQFA 2P6SA 4J9MA 4IFYB 4N5SA 3GZ7A 2BKNA 1RT1A 4USHA 4CNYA 3CC7S 2BM1A 1EX8A 1T0TV 3B54A 4RW7B 3I9V9 1EKRA 2E5LJ 3K5MA 3MCOA 3OHAA 4AUKA 2X7IA 2CQPA 4DV7F 2N82B 4UOFA 1T95A 1XC9A 1K73T 3EGZA 1TMJA 2JEJA 1C1BA 3TZZA 4MJKA 1RAOA 9ATCB 1NK5A 4ED5A 3L7UA 2VZ9A 3KLEB 2E7VA 1EKSA 2GHVC 2GC8A 1VQLS 3EPGA 3FSYA 4RR5A 2A0FB 1NPRA 3LA0A 3UE2A 1CQMA 3I31A 1ZAVA 5AXMA 2YNFB 4Q43A 1Z2ZA 2GO8A 4J9PA 4DR4F 3VQSA 1SBRA 2YXLA 4KIAA 1F5AA 2HHXA 1P27B 3BH6B 4LVOP 3VGTA 2ILYA 4KO0B 1VGYA 4R5PB 4LQ9A 2Y1JA 1Y0HA 1VQ8S 1Y11A 3PYFA 1HQUB 3RRKA 3MD3A 1X7VA 5HBMB 4CI0B 4RW9B 2UXDJ 1RLCL 3FZBA 3HK2A 4FNHA 2GVDA 2DB1A 3RAQA 4PAAA 3NCPA 4DL7A 1X9SA 2DH9A 3C16A 3PKMA 2W8LA 4OYZA 3HVRA 4RW7A 3LPYA 4ZN1A 4LBPA 3DDIA 1YJUA 3TZXA 1T9VA 2IYGA 4FPRA 3FCVA 1A0OB 1JQGA 4Q2MA 3GV5B 2QL9B 4M5KA 3V4IA 1PSDA 1NJZA 1U1RA 4KRWA 3EUNA 4DL0C 2MZQA 5LT5A 4ELTA 3KWMA 4YDDB 5KFOA 1N4LA 1H3DA 4DFJA 2P8IA 3KK3A 2DNYA 4OJGA 1N0UA 4K0KJ 4NI2A 2YNFA 1KD1T 2W2MP 1NH7A 2DH7A 4ZA1A 2J7UA 1TL4A 3FEXB 1NO8A 4DU8A 2WZ1A 3NLCA 2XNQA 1LWFA 2HBRB 1CQNA 2UV8G 3GV8B 1FFGB 1OPZA 1RP5A 2F4VJ 1N48A 4DPTA 4J91A 2IM3A 5FD1A 1X8DA 1YJ7A 2XM3A 1NRKA 4C98A 5HMYA 1GX6A 1WF2A 1IKVA 5BXIA 2N3OA 1M5VC 3ZTQA 3HSGA 4Y65A 5L9NA 2OJ3A 2FDNA 3SQGA 2B9YA 2FJAB 4NLOA 1ZA2B 2M8HA 2DTJA 4P2MA 2GCFA 1ZYQA 3A8IA 1M90T 3OVBA 2AJFE 1KLNA 1HWLA 3DU5A 1RYSA 1LV5A 5ETQA 2CJXB 1UWBB 3WC0A 3NGSA 2JDJA 5EHHA 2E5JA 3B4MA 3K0JA 1SV5A 2V0NA 4IDKB 2CPEA 4PG7A 3EVOA 1RTDB 2XHWA 1FERA 2H51B 2AYBA 1KLMB 4PWWA 2LECA 4ZN3A 2QFJA 1FNMA 1VJWA 1WC5A 2L9WA 2JLEA 2ZC4A 2AHOB 3AOAA 3M8QA 5IFMA 5D0RA 1OSDA 3LO3A 2CWKA 3EXCX 4OZ5A 4C0HA 1TKTA 2GIFA 3BGUA 3ENVA 3ET6B 5KFXA 5A2QU 2WTFA 4P73A 4ED0A 1FRMA 4BLGA 2AF6A 1UETA 4ZP9A 3OFHA 4LFAJ 1JXLA 2CQGA 2PGCA 1SH2A 4X65J 4E8UA 4ATNA 2VBYA 1RB0A 5F3ZA 5L1JA 3KMQA 2CG8A 1E6YB 2C2EA 1S48A 3G6ES 4I68A 4IUFA 1FWLA 1HQ2A 4ID5B 3EVWA 1WHYA 4FP9A 1M5PC 3DU6A 3POTA 3EMTA 2BOPA 3MOZA 4IR1A 5D15A 1GXLA 1W2IA 2ZH5A 3MXHP 2QX0A 4QZVB 1YBUA 2IBOA 1VQKS 2E9ZA 4MMOA 3T1YF 5HAOA 1NKEA 2DNPA 1BY9A 5LOQA 2QL5B 3JTPA 4OI4A 3R8YA 2PI4A 3QRQA 1DARA 1Y10A 4JI5J 2OHDA 1FX4A 1SJRA 2V5HG 3JS9A 2VQFJ 1RTDA 4KHPF 1F9HA 4DV1F 3DM2A 2CQ3A 2IMOA 2R9LA 5DO2A 2VFSA 4PZVA 4R8UB 5F8JA 3DNCA 3HKWA 2BX6A 1G1XA 3CDEA 4J9QA 2GV1A 3NL0A 1EZZB 2M2BA 4L76A 4F4XA 4ZVOB 1FT8A 4EO8A 1P9QC 1TK5A 4X4QA 4RNNA 4B3OB 3N6MA 2WW8A 3M8YA 4NCGB 2J8SA 3UCZP 1JLEB 2IAJA 4A4JA 1ACMB 4CDIA 2V8HA 5IWAF 3RYLA 3TVYA 2ZFHA 4WTOB 2FJEB 5HO4A 3GYXB 2MLZA 5DGBA 4RNHA 4F7VA 2KRRA 1L3SA 3KLHA 1VQ5S 5H9FJ 2OEKA 3FBFA 1SI9A 1E6YA 3I32A 3R7BB 4OYMA 1UPMB 1YG0A 2ZH3A 3P96A 5KT6A 1XMOJ 4ZVUB 4G6VB 2RKIA 2ZVSA 2BE9B 1FRXA 2ZDOA 3W8GA 4EK2A 3BYRA 2K7KA 3L3CA 2LU2A 2I6WA 4A8YA 1U1MA 3AJDA 4LF1A 3H5SA 4F4WA 1S6QA 4F67A 2V69A 1VQ4S 3S01A 1RAFB 3R5GA 1QTMA 2NREA 4CH1A 3J80Y 1SL2A 5F0WA 1RAIB 2DHHA 2W25A 4X62J 5JXSA 1RT2B 1EP4B 1VC6A 4OZ2A 3JSMB 1TFYA 5E0OA 2MQMA 5KFJA 2HZVA 1JLBB 2DNZA 3MEEA 3VWSA 1PBUA 1ZM9A 5B0DA 4TY9A 1SC6A 2LEPA 3CD5A 1T7PA 3OL7A 2ZD1A 1IR0A 5KFMA 2AD9A 3HJVA 2CJAA 5BJRA 2C3PA 4U7UD 4YHHJ 1YRTA 2MPUA 4X4VA 4RU2A 2YWEA 1VQ6S 1IBKF 1MU2B 1FXDA 1UVMA 3LQVA 3OTOJ 2AGQA 2QV6A 5IT4A 1JJ2R 3NY0A 4B9LA 1M5OC 2RHQB 2KT5A 4FKXA 1W7WA 4DUZF 4ECTA 4LF7J 2AP6A 1HW8A 3QNWB 5I3UB 2AJ2A 1RJJA 1OIAA 1ZAWA 2E29A 3M2RA 4O44B 1JX4A 2V50A 3MFHA 2CPXA 4JI0J 2ALYB 2XSJA 5IC6B 2MEWA 2HS0A 1HIYA 1KWMA 2AT1B 3CWJA 3M30B 2MMYA 1SKSA 2HRTA 2P9EA 3RAXA 3M9OB 4RUCA 2A1BA 4TVAB 3BKFA 3QJLA 4F3QA 4QR0A 4ZLLA 2AIRB 3FFIB 3BBCA 4C6AA 4ED4A 4QIVA 3RW7A 2HHQA 1FKOA 2H3EB 4OJHA 2DR7A 1N6QB 5HMZA 3C14A 3RTVA 4LJMA 2EC0A 2XTJP 4ICLB 2QJ3A 3CJKB 4ZHRA 2LQ8A 3LF0A 4Y2KA 4OI0A 2HKEA 3NGRA 2Z30B 4DPYA 2FVRA 4DL3A 1XR6A 1Y00A 2FHJD 1E6VB 1S9EA 2DHGA 4KV8B 3CD6S 4HH0A 3QO9B 2H4WB 1DFDA 3KJNB 3W5YA 4GVBA 4PEOA 5ETLA 1I94J 1DTQB 2MQPA 1BQXA 5J1NA 1S9GA 3D4JA 4OFZA 2EFOA 2XMWA 2E9RX 3TUIC 2I0XA 3VHQA 3QAUA 2RRNA 2FQQB 1J5OA 2OO4A 3O2IA 1U8SA 3IMQJ 3PW4A 1YSJA 2Y0SD 4P74A 2QT7A 2ZJPQ 1VQ7S 2BZ2A 2DNOA 2HHPA 1CULA 2FVSA 1UZHA 3UQSA 4M94A 3VGUA 4LF8F 2O01C 2V8GA 4OJ1A 1VK8A 1QLNA 2HVHA 1HNXF 2W2OP 5BR8J 1YJTA 2B8PA 2QA4G 2MKHA 2C2NA 2NYIA 4LIWA 4ZLPA 3Q0AA 3M8WA 2VICA 4OYBA 1QD1A 1Q81T 4NLSA 4CO5A 3T1AA 1H2TZ 2QO3A 4KKOB 2JVRA 5H9EK 2K7JA 2MGZB 2VD3A 1Q7YT 4DI6A 3GTYX 3K89A 2J6UA 4KAIA 3CEDA 2BRKA 1S0OA 4DL2A 4NL5A 1HA1A 1CC7A 1L3UA 2KFYA 1AFJA 3R97A 4EFAC 2EVZA 2YWWA 5KT5A 4MKYA 3RB4A 4Y2IA 3FRYA 4ZVHA 1DTQA 3V81A 3MAHA 1R8HA 3DDKA 2MQOA 3R1LA 5RUBA 3OUYB 1TV6B 4DS4A 1L5UA 1RWWB 4ZVFA 4QPTA 2JOQA 5F8IA 3D0IE 2XLJA 2WB1D 4MIBA 3U1LA 4UQGA 2Y8YA 1UVKA 3CJ0A 1X4GA 2MHNA 4QOTA 2CNKB 1J27A 2FLOA 2HIQA 1NZAA 3MR3A 1RT5B 4O3QA 3T5HA 2CYYA 3PTWA 5JMNA 4WU3A 3IGVA 1MROA 4ZPCA 3UNGC 4HDHA 1MG7A 3QFHA 4OHXA 2R2SA 4LF6J 4ECXA 3PYEA 1FWKA 2CAJA 1DURA 2DJWA 2DO4A 4DDFA 1S72S 5HK4A 8RUCA 1NK0A 4WE1B 5L46A 3HLUA 4OQJA 1PGZA 4K4UA 1S1WB 2OPPA 2G4BA 1PILA 4DLEA 4ILLA 2VASA 3OFEA 2ZITA 2R7OA 3JYTB 1MW7A 4ZVPB 3B8HA 1REVA 2HMIB 5LSOA 4ECVA 2PEHA 3CJTA 4ED1A 4XDCA 5LM7E 1OY8A 4B17A 1JLGA 1LFWA 2NPIA 4RBUA 4R0EA 3A4TA 3CO9A 4H4OA 3E01B 1QVFR 2UXBJ 3MHYA 3CTRA 2CKWA 3OUYA 4WKYA 1FX2A 4DPOA 1UWAA 5MAOA 2R8IA 3IM9A 4M5DA 2J7KA 1KKHA 2J0SD 5J2PA 3R1HA 3A13A 2E1PA 4QBUA 2CZ9A 3DHXA 4E98A 1NAQA 4GKJF 1OYDA 2MLYA 3R5CA 4JI8F 3PW2A 3GCWP 1NB2A 2OKQA 2KH9A 3NCQA 2B4PA 5JVHQ 2ZBIA 2UUTA 2RIJA 3C3LA 3HO1A 4QQBA 4DSJA 3SDEB 2B9WA 1R3NA 2W2PP 2XG8A 3LPEA 3DLEB 5DDRC 1TFWA 2ROEA 1U0HB 1T8EA 2BOAA 1HQEB 4PPDA 1RACB 4AL6A 2QA1A 4DOZA 4NLGA 4KT0C 5LJ3Y 2HWTA 2LA6A 3LWLA 2FHKA 3C6TB 2GQ2A 3IBWA 4CTAB 5KOWA 2F9DA 2CQCA 4B9VA 4P10A 4YP3A 2CQDA 2ZH2A 2EKNA 1I6JA 1M1GA 3I0SB 3OXFA 3JYTA 4USUA 2ZKTA 1TAUA 2VODA 2VUGA 4ZJQA 4AXJA 1NM2A 3TAMB 4DG1B 4HT5A 4LRDA 3BSNA 1RDRA 3T1HF 1RGVA 3BREA 2ZZMA 3JSBA 1FESA 3BH7B 1HBMB 2Z57B 4WFZA 5E5NA 2IMWP 4OV1A 1IBMF 4CLSA 1Q5VA 5IM0B 1VRUA 4LFCJ 5K8NA 3QRPA 2JFDA 2FVQA 2ASDA 4DV0J 4DZDA 4FVCA 2UZAA 2JLFA 5KAKA 3D6FB 5IOLA 2DH8A 1PAEX 2NUUG 3BM7A 4YR0A 5CQGA 4ENOA 3DLEA 2I2YA 2DGWA 3O44A 2RDJA 2B6AB 5KT2A 3M4XA
chains in the Genus database with same CATH topology
1EP4A 2NLWA 4LUBA 3SYZA 2Q6BA 3JSMA 4FS2A 3MI7X 2RF2A 2YNHB 3DOLA 3MUVP 1IM4A 1GNKA 1HQEA 3PHEA 3VTIA 4NLDA 2PT0A 2KTQA 2EBGA 3NRBA 1JLBA 2B7BB 2IRYA 4ED3A 4QU6A 1VQPS 5J2QB 1CVJA 4RBTA 3J7YI 1QAXA 5DG9A 2EK1A 2D74B 3Q8PB 1KQKA 2I1RA 5BYQA 2UUCF 2CQ2A 4DF4A 2EKYA 2GMJA 2MKJA 4LIRA 3ISZA 3A8EA 4OI2A 5L8RC 1FJCA 4P6QA 4A48A 1VQMS 3C6TA 5AXLA 2IRUA 2MQNA 1Y9OA 3BSOA 1VBYA 5E3PA 5GADU 1N54B 3OHBA 1FF2A 1FEEA 1RT3A 4CTAA 2AGPA 3LH2S 1SV5B 3DOMA 2UP1A 2FJWA 3MD1A 2RNEA 4PXCA 2HRYA 3NNHA 3AQPA 1NNDA 4DV2F 4O3RA 1WNEA 2PA8D 1YITS 4JOUA 1Y5LB 2M9KA 4WIIA 2J9DE 4C8MA 4FS1A 3GIJA 1MU2A 1Q8LA 1SH3A 4C9DA 4QYZJ 4HI1A 4YB5A 2FHMA 1WG4A 3C6UA 2CRLA 2BJEA 4U9RA 2JEGA 3Q8RB 4RW8A 4ZDNA 3K58A 2KZZA 2C22A 4O3NA 2DBBA 1JLFB 2V4JB 4FVMA 2WONA 3I9ZA 5F9NA 4QWAA 1CPZA 3M8QB 2XB2D 2IHR1 5E3CA 5KFCA 2DNGA 1WEZA 4URGA 2XY6A 3QJPA 1GTEA 4KR0B 1U45A 4L72B 2YWHA 2DR5A 1UW4A 3MTKA 5KFZA 2ASYA 3HXMA 4WCEQ 3ZC4A 2WBRA 4IOCQ 4JI1F 1N5YB 1D1UA 4CO2A 2RMLA 1WF0A 3V6KA 4CT8A 1AROP 1TKTB 3TX8A 3UW1A 5I3UA 3NP5A 1TR0A 1FHTA 1P1TA 2ZJRQ 4BS2A 4HKQA 2LQ9A 1SIWB 3G4SS 2XMJA 3S6EA 4WK1A 5DRKA 2ZBCA 1HARA 4O44A 3ZZPA 2V94A 2XSFA 2Z2LA 1VQSA 3F41A 5J2MB 1FE0A 1FKPA 3KLGB 3E3XA 4WFAQ 3MPVA 2PI5A 1WHXA 4NRUA 5ITHA 5DJBA 1JLAA 5EWFA 4NLUA 3CDUA 4LT6A 4JI3F 2F3JA 3S7RA 2GQQA 2BQUA 2AJQA 1VI7A 4ZPAA 3GIIA 3D28A 1NEEA 3L7PA 3M30A 1RKJA 3KLFA 3SCJE 4ERDA 5D3GB 3FZ2A 5I4MA 1UVNA 1FRKA 2JSXA 4EO6A 3L7OA 2VQEF 1QY7A 4B3TF 4ZCLA 2FTRA 4NX9A 1QE1A 1HHSA 3HVAA 2NS1B 5L1LA 3BQ2A 5KFRA 3K8WA 1CC8A 2L3MA 3DYAA 5C42B 5DQGA 4ES1A 2RQ4A 2EWHA 2XWYA 1ZPWX 1ELOA 1LXJA 4CO3A 1M5SA 3QIPB 2CQHA 4A8SA 2RILA 3TA2A 2HFOA 2K1RA 3OQ2A 3POTB 4KB7A 2DNHA 4OIXA 2FGCA 4DV3F 2PE8A 2YVSA 3FFIA 4C11B 5DM6Q 3OLBA 2EFNA 4K4XA 4A8KA 1TL3A 1QSYA 4FBUA 2BRLA 4YB6A 2GJIA 3KK1A 1WWHA 2FC8A 1AUDA 5THWA 2DR9A 2GW8A 4I7FB 3NCRA 3KLIB 2B6AA 5HMXA 3OR2B 3ENQA 2VG5A 3CCTA 3S1TA 4O4RA 5DGAA 1HNZF 2DNLA 3UDCA 5GAEU 2K8GA 4HVZA 1T05B 1N6QA 2UXCF 2EG1A 4X4UA 2BXJA 2NSCA 1VFJA 5KTQA 2QYCA 1BD6A 3FNNA 4YUDA 4ICLA 3MURP 1Q8IA 5M2PA 1ZTWA 4BCAA 2FHJA 3CJKA 3KJVB 2HNZB 1SKRA 2K3KA 3T6JA 4RNMA 3DLBA 1QVGR 4O23A 1TL1B 1Y3KA 1VQNS 4JI7F 3KMSA 1MWYA 1GAOA 2RD5C 3QIDA 1M1KT 5C25B 5KFDA 1RT6A 5MLCV 4ZS6A 2N4DA 1RTJB 3NAIA 1HBOB 4AYBD 5DDPC 1JJ4A 2NR0A 4UY8T 4HEA9 1KOHA 2LVWA 2D9PA 3QMQA 5A2QY 2MKSA 3SCLE 1UEVA 2XGQA 1SQEA 3IC1A 3L09A 3MMCA 1UEUA 4F3MA 2HZCA 1V9OA 5A6WA 4XPCA 2KT3A 3DM2B 4I2PB 3MM7A 4I67A 1T03A 1NB7A 2QLXA 3UPFA 1FA0A 4Q44A 2VFRA 1RT4B 4EBCA 2PD1A 3PX6A 4OHYA 4Y2AA 4C3KA 4JI2F 1C2PA 1TKXA 4QWEA 4IR9A 5IT0A 1E6VA 3ETOA 5KFUA 1UFLA 4IYQA 5SUHA 4DR6F 4KV8A 5A8KB 5HLFA 2YKQA 2XY5A 3H98A 1TL5A 2FD2A 2CFXA 3QO9A 2WSEC 3LW5C 1YJRA 3KHGA 1R8BA 1QM9A 4PG4A 2BANB 4KE5A 1X5SA 2HNYB 4KFBB 3MAQA 3N5FA 4ILMA 1JLCB 4GKKF 2RDIA 3O5TB 1SUQA 1H2VZ 4USJC 1VC0A 1DQ8A 3MFIA 2Q43A 4B3SF 1FTCA 3I56S 2YTCA 1F5BA 3HHNB 1RKIA 1C1CA 2C3UA 4JV0A 4BBYA 2FGOA 2XMMA 1NK9A 2IAJB 1URRA 4PQUB 4OL8A 1K0VA 5DQHA 3AB2B 3PDNA 4C8YA 1YJ9S 5IXUA 4DR7F 1TZ0A 3MMBB 5I3PA 3BGLA 3LAKA 1S97A 1WACA 4DEZA 4QIFA 4Y28C 4RWXA 3TYTA 3SZ2A 5KFSA 3NBPA 2VG6B 3MWBA 3CMES 2C42A 4CO4A 3PW0A 4WFBQ 3D0GE 1FK9A 3KG0A 2Z4PA 3CXCR 2HVIA 1U24A 1JIHA 3LP2A 1VIXA 5E3AA 4C8NA 3KLHB 1R8AA 4NA2A 4NYPA 5JVGQ 2EBEA 1FJ7A 3GG0A 1SKWA 2IVFB 4DL5A 3I4HX 5AJ3F 3H2UB 1N0VC 1YI2S 4RLEA 5KG5A 3OBIA 1EETA 2FJXA 2HNDA 1LWCB 2B5JA 2MZTA 4CZCA 3BF4A 4IRDA 4ILRA 1XK8A 2LMIA 1H7XA 2G9OA 2XMUA 2MXYA 3CVKA 4U67Q 4TY8B 2PFFB 1C4CA 2D1CA 2VG7B 3HF5A 3QIPA 1DQ9A 4LFAF 2C3OA 3T6BA 4NYOA 5KG4A 2SXLA 1SJ4P 1MSWD 1XMQF 4IFVB 1FXLA 2JH3A 3AJ1A 2RKIB 1TVRB 4I0WA 4PG6A 1P6TA 4RBVA 4O3PA 2OFGX 3F44A 2MKKA 1U2RA 3AHPA 3ZZUA 2WOMA 4G1QB 2IJFA 4I7FA 2MB0B 3BEGB 3T5KA 3T5JA 1FDNA 3PFEA 5FLXY 2V4RA 1TKZA 1T3NA 1KS2A 2DISA 4K4VA 2BW2A 1S6UA 4OZ0A 2VOOA 5G0RA 1HHTP 2V8DA 2ZH9A 4RKUC 2OLWA 5F8MA 2F8EX 4F3OA 2VFTA 2QZ8A 4ZVEA 2ZE2A 3K5NA 1S6QB 2MZ1A 4OX9F 5T41A 4RUHA 2PMZD 4AQYF 2IC3A 4IRKA 3KJVA 4ZCKA 4QPXA 1NJWA 4J37A 5ADZA 2RB7A 3M1VA 3I5BA 2YKOA 2RT3A 2WSFC 3U7JA 4FNIA 2ATLA 2FLPA 5C25A 4ZKAA 4WZMA 3OXGA 3MUMP 2IA0A 1K9MT 2AX0A 4PKDB 4DUYF 4A8QA 4FXDA 4RWWA 2Q6CA 3GE9A 4KKOA 4OHWA 3K5LA 4A8OA 1M5HA 3DI6A 4TYAA 4A47A 2MGZA 2YNIA 4WF9Q 3GFXA 1D3WA 4Z37A 4C8OA 2DGUA 2DGXA 1KHWA 5HP1B 2XWXA 1V3ZA 3GILA 2RH3A 2ACYA 4NWBA 3MEEB 2FB0A 4I2PA 1XEZA 3F56A 1RT7A 2HQ3A 4M8LA 3AJ2A 3PO5A 1X9WA 1Z4UA 4EYHB 4NXMF 1RT4A 2UUWA 2NXUA 4RX6A 3U02A 2YX4A 5EWEA 4DF8A 1HD0A 1FRIA 2M4MA 2O1PA 4IH5A 3WZ0A 2ZD1B 2X1GA 3OR1B 2L9NA 4NLQA 1UJ5A 1S9FA 2D3OR 2R7VA 1XMBA 3DDNA 2GHPA 2YH0A 3PV8A 4NA1A 4ECWA 4DL6A 2DPJA 1LOUA 4HDGA 5L1KA 1TK8A 4JI6F 3QGIA 3IGNA 2FUG9 1KVIA 2GIRA 1KRPA 2PDAA 3G9CA 1GQEA 2VQFF