3CCQS

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 18
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ccqS00
2DNNA 3G8SA 2X1AA 3CUNA 1ZZNA 4QU6A 2KXNB 2DNQA 2DHAA 1FT8A 2MKCA 1VBXA 2XB2D 3Q2TC 2EK1A 1R8HA 2MKHA 3DLLQ 1YHQS 1HD1A 2HVZA 2LMIA 3G6ES 3IWNC 2M0GB 2CQ0A 2XNQA 2ZJRQ 4LIRA 1U6BA 1DZ5A 2CQBA 2EK6A 1U6FA 2MZSA 5LXYA 3EGZA 2XNRA 1U1PA 1JJ2R 2CQPA 3CCRS 1VQ9S 3EX7B 2LQ5A 1PO6A 3NNHA 1VQ7S 1WTBA 2DNRA 1VQ8S 1WHXA 3BEGB 2KN4A 5IFMA 3R1LA 1VBZA 2D3OR 2YKAA 2CPXA 1VC0A 3RW6A 2MQLA 3MUTP 2NZ4A 1SJ3P 1ZZFA 2YH0A 2LXUA 2YH1A 3CCJS 1YWXA 2DGSA 5CYJA 5LJ3Y 2XS5A 3NMRA 1UFWA 2YTCA 1YTYA 1NJIT 1X4HA 1R8PA 5JVHQ 3PIPQ 3H2UB 1U1KA 2CQ2A 3JB9k 2EVZA 3TP2A 5HL7Q 3NS6A 1A7GE 4WFNQ 1X4BA 1WHWA 5DM7Q 2MY8A 1WF1A 1M5PC 1K9MT 2DNKA 2D9PA 2RQ4A 2DGXA 2MPUA 5JVGQ 1NO8A 4QQBA 4RU2A 2G4BA 4UY8T 3VAMA 2DIVA 4W92B 2M52A 2FY1A 1HD0A 2DNZA 2CPDA 3SDEB 3BO4A 2MB0B 3MUMP 1X5TA 5GAHU 3J7YU 1HA1A 2HYIB 1WG5A 2CPEA 2RRBA 3BS9A 2CQHA 4IO9Q 2L08A 2CQCA 5GVQA 3IRWP 1FJ7A 1WF2A 1G2EA 4M5DB 3HHNB 4FXWA 2DNHA 4V19X 3MD3A 3CMAS 3CCSS 1M90T 2KXFA 1X5PA 5IQQA 4W90B 1K73T 1JMTA 2OSRA 2DHSA 2DISA 1RKJA 1YJ9S 1PGZA 1B7FA 2K3KA 1M5KC 3DXBA 4PKDB 1VQ4S 1N52B 2M70A 2OSQA 2SXLA 2MGZB 2RQCA 3N9UC 2D9OA 1QVGR 3J7ZT 1H2VZ 2X1GA 4Y0FA 2MY7A 2DHGA 1KOOA 4CIOA 2E5HA 3H2VE 2LA6A 2M4MA 2KU7A 4PRFA 2AYEA 1DHMA 3SMZA 2AYBA 4C0OC 5D78A 1S79A 2DIUA 2LEAA 3MURP 4CH0S 1VQLS 2XS2A 2B0GA 2MZ1A 2DH7A 4IOCQ 1WEYA 2KT5A 5DDQC 2MQPA 1X4EA 5DDPC 2DH8A 2ZJQQ 2J76E 2I38A 2KM8B 4UQTA 1N8RT 1KOHA 2WBRA 1O0PA 1XN9A 1M5VC 2AYMA 2M7SA 3LQVA 1DBDA 2LEBA 2VOPA 1K8AT 2YWKA 3UWTA 2LCWA 2NLWA 5DDOC 2KRBA 2KG0A 4CQ1A 1VQOS 3R1HA 3FEXB 2V94A 1VQ5S 2RVJA 2N3OA 1U1NA 1P27B 1W2BR 2KI2A 2U1AA 2CPFA 3UD3P 2F9DA 2DHXA 2KRRA 5CXTA 2BZ2A 3VAGA 1WHVA 1WEXA 2N3LA 5LJ5Y 3U1MA 1SJQA 4ED5A 2DNYA 2KVIA 2DITA 3VF0B 2BOPA 3K0JA 1SXLA 2DNGA 2PE8A 3VAIA 5GAGU 3VAFA 3B4DA 2CPYA 2RS2A 1ZH5A 1S72S 3CMES 2HGNA 3HI9A 1WEZA 4OZ0A 3G4SS 2ZJPQ 2DNLA 2MZJA 3EGNA 3I55S 1H2UX 3CXCR 2N7CA 1WI6A 1FJCA 2X1BA 2MXYA 2CJKA 3UCUP 1OWXA 1VQPS 2VOOA 3ZZZA 2HZCA 4TU7A 4IOAQ 4BS2A 2UP1A 3VAJA 2X1FA 4YOEA 2KHCA 3US5A 1QM9A 5DDRC 5GAEU 2VONA 1A9NB 1OPIA 2E44A 3L3CA 1SJFA 2G0CA 2QEXS 2ERRA 2CPJA 5HO4A 1X4DA 2I2YA 3PIOQ 3CCVS 1UAWA 1VBYA 1N54B 4LMZA 2DK2A 2LA4A 2DO0A 3FEYB 1U2FA 1U1OA 3S01A 3THTA 3NNCA 3VAKA 2MZTA 1X5OA 4TU8A 3CCUS 1QVFR 2DGQA 2DB1A 3TO8A 4WKRA 2ADCA 4LJMA 3LPYA 2CQGA 2RUGA 1OIAA 2HGLA 2M9KA 2MJUA 1DRZA 3CC2S 1X4AA 1YJNS 4A8XA 2MHNA 1FO1A 2F9JA 2HGMA 1VC5A 1UW4A 3Q2SC 2MQNA 2M88A 2MKJA 4FXVA 2M8DB 3S8SA 1U1RA 1UP1A 3V4MA 2MSTA 2LKZA 5GADU 2DGWA 3R27A 5FJ4A 1Q82T 4CH1A 3SXLA 3G8TA 3CPWR 1X0FA 3TYTA 1N88A 3UE2A 3CF5Q 5DM6Q 4YB1P 1YJWS 1KD1T 4WCEQ 1X4FA 2DGVA 5BJRA 2FC8A 1VQNS 3OW2R 3NNAA 2CPIA 2Q79A 5H1SV 2MGZA 1Q81T 1X4CA 1FHTA 2QA4S 2M8HA 1F9FA 3ULHA 2KH9A 1YITS 1D9AA 3VALA 2LYVA 2OJ3A 3NS5A 4QU7A 5IM0A 1WHYA 1FXLA 1WF0A 2DH9A 1OO0B 2AYGA 1SJRA 3D2WA 5EN1A 4EGLA 2RNEA 2MZRA 2FPHX 1HL6A 4OZ1A 2MKSA 1VQ6S 4J5OA 4QPTA 4YUDA 2CPZA 2G1DA 4F26A 2JRSA 2E5IA 3P6YC 2OTJS 2GO9A 2KM8C 3UD4P 2CQ1A 1RK8A 3S6EA 2GHPA 2DO4A 2JWNA 1YI2S 4Y00A 1VC6A 2JVOA 3MDFA 2F3JA 2DGUA 3UCGA 2LECA 2ADBA 2MYFA 2MZQA 4ERDA 4Z2XA 2E5GA 1VQKS 1Q86T 1VQMS 2XS7A 3I56S 2O3DA 2N82B 1YIJS 3MOJB 2MQOA 3CC7S 3CULA 3G9CA 2RS8A 3ZZYA 3BO2A 1WELA 3CC4S 2KG1A 5MLCV 1JJ4A 2KXHA 3SDEA 2MSSA 2MKIA 3UCZP 1FNXH 1KQSR 2MQQA 3S7RA 4TU9A 2J0QD 1SJ4P 3CCQS 3G96A 5LSOA 1IQTA 1KC8T 1X4GA 1P1TA 2OIHA 3CD6S 5LSLA 1JJHA 2A3JA 2DGTA 1M1KT 1H2TZ 2JX2A 4TLQA 2VODA 2DNOA 4PR6A 1M5OC 2OTLS 4C7QA 2AD9A 4C4WA 3CCMS 1Q7YT 4ZKAA 1U1LA 3THPA 3CTRA 2PEHA 1BY9A 3U1LA 4P6QA 4F25A 3BO3A 4WFAQ 3VAHA 3P49B 2FC9A 3MI7X 2J8AA 1U1QA 2MKKA 2MQMA 2QFJA 2KFYA 3CCES 3CCLS 2CQ4A 2J0SD 1WG1A 3P3DA 2CQIA 2L41A 2CPHA 4F02A 1URNA 1WWHA 2KYXA 3G71S 4U67Q 1WG4A 2DGOA 1NU4A 2U2FA 2L9WA 1CVJA 2K8GA 3RW7A 2MMYA 4WFBQ 2LXIA 5LXRA 2JVRA 1AUDA 3MUVP 2M2BA 2RRAA 5GMKa 1L3KA 2FHOB 2DNPA 4WIIA 2RT3A 2XSFA 1WI8A 5DETA 3MXHP 2MJNA 3B4MA 1FJEB 4WF9Q 5D77A 3P5TL 1U1MA 2RU3A 5ITHA 5IM0B 3MD1A 1X5SA 2CQ3A 4IUFA 1H6KX 2DNMA 1D8ZA 2CQDA 5CA5A 2E5JA
chains in the Genus database with same CATH superfamily
1BMQB 5E5NA 1NBEB 2GFFA 3BKFA 3HXMA 3NMAA 1NJZA 3MMJA 2NCKL 2Z2LA 3UI3A 2YQ1A 1FE4A 2AMCB 2VF3A 4WTOB 1SVDA 3M6WA 1VGYA 2MKHA 3LWLA 1D8YA 1NSAA 2HVZA 2WVDA 4YR0A 4USWA 4CLWA 3IWNC 4B08A 1ZPVA 2DXDA 2ZDOA 3GSIA 2RSQA 3CW2C 2HHXA 1HNZJ 5LSRA 1JLFA 1DZ5A 3CB4A 4RNHA 4UT4A 1U6FA 2MZSA 1S77D 2BEFA 2RMLA 2IBOA 3CO0P 5LXYA 5GMEA 5GADI 3TAQA 1HR0J 1U1PA 1YBTA 5D0RA 2RAQA 1JJ2R 2WW4A 2WVCA 3CO9A 2LQ5A 2VG7B 5KFAA 4DDFA 2Z2YB 4OI6A 2CNOB 2OO4A 4IQXA 2UZAA 3EGVA 2DNRA 3LAMA 4KFBA 1JLBB 5E3PA 1VQ7S 1DTQA 1PKUA 2HFOA 2R7QA 2C3YA 4NLYA 1K0VA 3K57A 2YKAA 2ZKUA 4YUDA 1UEUA 1VC0A 4JI7F 1VRTA 1EP4A 4NXNJ 3NKYA 2IIHA 4YR2A 4OLOA 5GAGI 4NLDA 2YH1A 1AA1B 2MDAA 2VU5A 2XSJA 5J2MB 1YWXA 2KJVA 3DHXA 5LJ3Y 3CE8A 1RAJA 3I5CA 3MOZA 1Q8IA 1WD6A 2CA9A 1T02A 1X4HA 1R3NA 1T9UA 4DU7A 1XMOF 3HK2A 4K4SA 2LVWA 3M8QA 1XBWA 2JLFA 4R0JA 3ENVA 4ZHRA 3JB9k 1U1KA 2HQDA 3AOBA 3DRSA 1FE0A 5E33A 4O3QA 3TP2A 3DKDA 1PBUA 1FESA 2LQBA 3ZTSA 1QAIA 2JEJA 3GB0A 1NPRA 1RTIB 3GV7B 3FSYA 1CQMA 3SCJE 2JSXA 5EUHA 4F4KA 1YDLA 2V2QA 2HS0A 3LP1B 4QOTA 1LWCA 3X1LB 4CO0A 5A0YB 3DLEB 1B70B 4U7CA 2DGXA 3FEZA 1WOPA 3GR0A 1TFYA 4CLYA 1FRMA 5HVFA 1ACMB 3DI6A 1RCOB 3KLHB 4QQBA 2HVHA 2H4WB 4RW4B 4Y2AA 6FD1A 1CJUB 3OFGA 2N4CA 4LRAA 1CJUA 3VAMA 5D3GA 1N36F 2DIVA 2YQ0A 3V6HA 3AJ1A 3NAHA 4USHA 3IAS9 2RDJA 1MSWD 3SDEB 1AFIA 2V2KA 4IKAA 2DR5A 1BHNA 3MPYA 1B64A 4OJ1A 4WFZA 4FYVB 5GAHU 3U02A 1FCAA 1KQGB 4JI3J 2VKRA 2ZH7A 1HA1A 4YS2A 2IRXA 2GW8A 3QT8A 1GNKA 3TARA 3AD9C 4LF6J 3G82A 2L08A 2N4DA 2RU9A 2ZBPA 3IRWP 4UUWA 3M05A 4N5SA 2VG7A 5IC4B 1YJTA 1G2EA 3M9NB 3HHNB 3K5LA 4FXWA 2DNHA 3K58A 2HAFA 4GC6A 3HFVA 1M90T 2HRUA 2KXFA 3H5SA 5KFIA 1QAJA 3LP2A 5IQQA 4W90B 3OR2B 4YY3F 2BJEA 3H4DA 1BQXA 2P9CA 1KTVA 4DSIA 3MECA 4K8RA 4NCGA 5HAOA 3HLUA 1NRKA 3ZZOA 3M8RA 1CLFA 4YFUA 2CJYB 2Y3YA 4WP8A 4I64A 4M5GA 1VQ4S 3GYNA 2DXFA 4CLSA 2APOA 1VRTB 2M70A 3PHTA 2EFQA 5ETVA 4X64F 3DXSX 1YKWA 2FY8A 1RAEB 2D9OA 5HQ8A 3PJ9A 2X1GA 2QA4G 1O6XA 1UVJA 3LUYA 1Y0HA 1JK9B 5LMUF 4OV1A 4ANEA 3GTYX 2AYEA 1DAXA 1PYTA 5L39A 2C42A 4UUXA 3RR8A 1XNQF 2AYBA 2VDIA 1TL5A 3BH6B 4KBIA 2B3TB 9ATCB 3QSYB 2BQ3A 5J2PB 1V3ZA 5I3UA 2IMWP 4ZCIA 3NWRA 4G3IA 1F2GA 2XS2A 3OXGA 1TP7A 1O8BA 1GXTA 2IM1A 4B9UA 4NCAA 4KV8B 3HCXA 3UN3A 1LK7A 2MQPA 5F0WA 2NUHA 2KTQA 4TY8B 2ZJQQ 5KFMA 2BDPA 2F65A 5B0GA 2IM2A 2J5AA 4I2QA 4RNMA 4OHZA 4EO6A 2UVUA 1APSA 1KVJA 2D69A 4GVLA 4NRUA 5KG5A 5EWFA 3KK1A 1JLEA 2WBRA 3TNVA 4Q0BB 3JQJA 3ILLA 4ZDNA 1S0VA 4G1PA 4P75A 4ANCA 1XN9A 2GAGC 4BC9A 2C2MB 2HVEA 1D3WA 2AW0A 2QJ3A 2CDRB 2VD3A 6FDRA 1T9XA 4RNNA 2IA6A 3OXFA 2XO6A 3PFEA 1J27A 5K8MA 1K8AT 1UVKA 1BD6A 1UKUA 3CJRA 4LBPA 1R27B 5KOXA 1J2VA 4B3OB 1KNZA 1LKZA 4NZ6A 1S1VB 2FVRA 1QUVA 2EC0A 2CZ4A 1QAXA 2V8GA 4CQ1A 4DR5F 3PM9A 3FEXB 2HHHF 2HQFA 1Y7PA 1V5VA 2BRKA 2Y1IA 2C2EA 3EUNA 1L3SA 2K2PA 4QWDA 1ELOA 3IA0A 3GMGA 2VBZA 4TY8A 4G6VB 5IOLA 1A0OB 2E66A 1CS4A 1G4CA 3NP5A 3QLHA 3WHIA 3CDWA 4JB8B 1XNRJ 4ZCMA 2ACMA 5CXTA 1FJGJ 2B9EA 4MMOA 2E1PA 3DLHA 1VQSA 2HIYA 1PSDA 1F6TA 4F67A 1WEXA 5J1EA 2VB6A 3IWXA 2ZWPA 5HJYA 3KK2B 4DV6J 5FD1A 1NSQA 4GO5X 5LJ5Y 1UEKA 2NYIA 2DNYA 3LP0A 3QGHA 3VF0B 2DRAA 1B0TA 3WBZA 4JI4J 1SUQB 3K0JA 1SXLA 4F50A 1NSPA 3VAFA 1NK9A 4N47A 3IC1A 4JI0J 1ZTTA 3RRGA 2GJIA 3G4SS 3FQKA 2FHKA 3G82B 3BDEA 3ZC4A 3I55S 3TJAA 4LREA 2C22A 4UOCA 3CCZA 1BC6A 2D7SA 2X1BA 2XC9A 4DR1J 2HHPA 1FRXA 3GPAA 1OWXA 4F2RA 2XLIA 2HZCA 2J9DE 2EFGA 3QZ7A 5KG7A 4IOAQ 4MKYA 5BR8J 2IYIA 3X3UA 4NCGB 1Q8LA 1RAOA 2X1FA 3GU0A 4H4KC 2KHCA 4NLGA 1QM9A 5ETQA 1NXIA 2E44A 3NLCA 3M4XA 4IDKB 2AEMA 2IM3A 4OMFG 2YPYA 5HMXA 3KG1A 4D3HA 4KRWA 4ECYA 4KHPF 4R8UA 2ALYB 4X4PA 1WJ9A 2ERRA 1RU1A 3PJXA 1D09B 1B7YB 1RBAA 4Q8FA 2EWHA 4JV5F 3OSPA 3FSIA 1UAWA 2VQFJ 1VBYA 1KFSA 1N54B 4LMZA 2DK2A 2IJFA 4WJBA 4TQSA 3OVAA 3FEYB 2WB1D 2DRDA 4J9QA 3HHDA 2HQCA 3H20A 4OJHA 2ZUGA 2OPPB 2BRLA 5F3TA 2IDEA 3CCUS 2DB1A 3E8OA 4WKRA 2MKYA 1IKWA 1UVIA 2CJ9A 4LJMA 5AE1A 1M1HA 2CQGA 2RUGA 1JXLA 1OIAA 4PABA 3TW0A 3CC2S 2CXEA 2HHWA 2XMAA 1X4AA 2A2CA 3KLHA 4H4OB 3SFGA 2MHNA 3I87A 5KG3A 2XHCA 3JTPA 4W98A 3I5AA 1FFWB 4EYIB 1X0PA 4PXBA 3RU0A 4DBQA 3ADAC 2J9CA 3VCDA 5HBMA 3Q8YA 4HH0A 4EZ6A 4ILMA 1ULRA 4Z37A 2M8DB 3DNCA 5IS2A 1UP1A 4I56A 4WP3A 3POTB 5K9FA 1IBCB 3IGVA 5F8GA 4DR4J 4Q2LA 4QPXA 3O6QA 3MR6A 3BQ0A 1RTZA 3CSKA 3VGTA 3VGUA 1IBMJ 3ZTOA 1H38A 4NCBA 4R0EA 1B0VA 5GADU 3AFGA 3AB2B 2FJBB 3R27A 5FJ4A 1TL7B 1W26A 2GVDA 4CH1A 3QRQA 3DC2A 2J7KA 1NJWA 1FKPB 4DMZA 3MR3A 2ZHBA 1J5EF 4A8YA 2A2DA 3TYTA 2JEFA 5J2MA 3VR1A 4CO4A 4DZ6A 3BGRA 4KGZB 3OFFA 3M8WA 1CS4B 1RDRA 2LU2A 4WCEQ 4MKBA 2R7VA 5F41A 2ZFHA 2KB2A 5DLFA 4UW2A 3BGOP 2P9GA 2YQ3A 3RG6A 2CPIA 4PXEA 2JNJA 2MGZA 1UETA 1TV6A 1X4CA 2B56A 2NZCA 2RQMA 3J7YI 1B3TA 3C15B 2M8HA 4DSJA 1YITS 1D9AA 4ZVQB 3BKTA 2R8HA 3HF5A 2YWFA 4C8LA 4LF9F 4ZP9A 1YJVA 3NS5A 4LSZB 1FXLA 1WF0A 4J7CA 5D15A 4F4AA 2XMWA 4F8RA 4JV1A 1VK3A 2NS1B 3EVOA 2GIFA 2VPYB 3CDAA 3PVXA 4NX9A 4PQUB 3O8WA 1YSJA 3CJSA 1FF2A 2YKQA 1IBLJ 1N32F 4C0BA 4IR9A 5HROB 1LOUA 1SV5A 4M94A 5EN1A 2XYGB 4OYWA 1Q79A 4LFCF 3LALA 4C2MA 5JUMA 1FKAF 4I2QB 3NCQA 5EHHA 2NPFA 3PR5B 3QZ8A 1VQ6S 2HHTA 4Y34A 3IWLA 1VCTA 4J5OA 3SSQA 4CT9A 2EBGA 1IBKJ 4WZMA 1S10A 4L75A 2IVFB 2JRSA 3QBCA 5EX0A 4X4OA 1RAHB 1H98A 3AJDA 2OTJS 4ECVA 3UD4P 1RK8A 4MH8A 5ETRA 1YI2S 1GT8A 2CYYA 2JVOA 4FNIA 5CYMB 5KFPA 2DGUA 3DRPA 1SQEA 3DHWC 4LRFA 3UCGA 3T9NA 1SKUB 3UDVA 4Q43A 3R9LA 4Q2MA 4B3TF 2I0XA 1C1BB 4O3OA 2Q1LA 4FN5A 2JLEA 4Z2XA 3CDUA 1VQKS 5ETKA 5EWEA 2E1MC 3FDSA 4HDHA 3JSRA 2UUAF 4E8UA 1VQMS 4ZJQA 2KHDA 2XS7A 2DPIA 4ZCLA 3TVYA 5IQ6A 4DSKA 2VH7A 1IXKA 3GWCA 3LF0A 1IWAA 4USJC 2MQ8A 1Y10A 2AJFE 3BYPA 3GJQB 1WELA 2HLTA 2K7JA 2YXLA 3BO2A 4C98A 3PW2A 3PX0A 1Z1ZA 4DQPA 1OJ4A 3KMSA 2GGPA 3H5UA 4LSNA 3MECB 2MSSA 1T8EA 2QMXA 1HW9A 3FMWA 2FYXA 3QSIA 4MKVA 2V2VA 3DN9A 2QLFB 2XGPA 1FA0A 4NXMF 2B51A 4XTTA 2X3DA 1VDHA 3H40A 2OPQA 3HVWA 3BDPA 2GO8A 2J0QD 4CLTA 1JXEA 3OTOF 1QE1B 2Z0GA 5LSOA 4JV2A 4JOUA 1FFSB 1WC6A 1YGYA 3OR1A 1VS3A 1GEHA 4CO5A 1TKTB 3CD6S 2M3DA 1EJ7L 1JJHA 2DBBA 4B9TA 3IS9B 1H2TZ 1M1KT 3PCOB 2VODA 1S6QA 2DNOA 1JXVA 3GJTB 4A47A 1TR0A 3EYZA 4OHVA 2NYHA 3CEDA 1VISA 2W2PP 1R8AA 5KFZA 4K4YA 4E98A 4ED3A 3Q24A 2ATLA 3EMTA 1FX4A 1MMDA 3KJNB 4OYBA 1Q95G 4F36A 5CABA 4X62F 5A2QY 4DSLA 3ENQA 4U96A 3P4UB 4ZKAA 3QGGA 2AIRB 4PAAA 2CNKB 4DX7A 2OGUA 4H4OA 2WSFC 2ASJA 4X4VA 2PEHA 1CJKB 5B0CA 3U1LA 3R2DJ 2EPIA 4NYOA 3DOMA 4RW4A 2FVSA 1EQ0A 3NCRA 3DI6B 1X31C 3V5RA 2Z8QA 3IN5A 3RRHA 1HNVB 4A48A 4ZN1A 2FC9A 1UA0A 3TUJC 2VFTA 3KDNA 5U47A 4JUZA 1RWMB 3SZ2A 1NZ8A 2CG8A 1OYDA 2CVIA 3DOLB 3R5CA 4IFYB 1HBOA 2PMHA 2MQMA 3W62A 4F3MA 4QBUA 4DFMA 2F4VJ 1X8DA 3DMJA 2B8QA 4Y6IA 4JI1J 3HP6A 4F2SA 3OTEA 2W4CA 4FVMA 4LBHA 3CCLS 2CQ4A 3ZZRA 4CO2A 3IAM9 3OLBA 1TU0B 4EWTA 2L41A 2CQIA 4LF7F 4OYIA 2QN6B 2V0NA 3JSBA 1FDBA 2CPHA 3CD0A 3MEEA 4GRSA 1R6VA 3DRSB 4DPYA 1URNA 4F02A 1WWHA 4DLEA 1JLQA 3C19A 1TL1B 4AT1B 4DV2J 4QIGA 2JHEA 1NKEA 1N5YA 1WG4A 3D6MB 4UOFA 2KL8A 2UUCF 3A13A 3UPFA 4DQQA 2DRBA 5KFUA 4O3RA 1CJKA 3KOAA 1HWUA 1SKSA 2ZHOA 2ZH2A 5C5JA 4HHUA 4IFVB 2XSJB 1K1QA 1T9YA 2C1EB 3W7BA 4TQRA 4DV5F 4DL4A 2V4RA 1QTMA 2VBYA 3BPDA 2Y1LB 3EPIA 1EP4B 5C24B 3KLFA 2MMYA 3AXKA 2YKPA 4ID5A 2JVRA 5LXRA 4PWDA 3M32A 5H9FK 2A0FB 2H48B 2HFUA 5FDLA 1RAAB 2YWWA 4WPAA 2C2KB 3KUHA 3ETMA 2IAJA 2DNPA 2GJFA 3IS9A 3MXHP 1R7IA 3JSMA 1RYRA 4M5JA 2HMIB 1S1UB 4DR2J 3TJ8A 1S99A 1SL1A 2JC0A 3AQPA 3PFOA 3KLIA 5CD4A 3MM8B 4DV3J 1R43A 3OT9A 4MIBA 2BX6A 2VUGA 1JLFB 5IWAJ 3K8VA 5IM0B 2WTFA 4ITSA 2XMTA 3MD1A 4Y2KA 4B3SF 1X5SA 4EI2A 3D28A 4A8WA 1BQMB 3LO3A 4C9DA 5IT9U 1P9QC 1GXLA 3ISNC 5C42A 3KHRA 5FIIA 3BSOA 1FXDA 1HYSA 2CQDA 3DDNA 1Y5IB 4NLTA 3T5LA 4DF8A 1PYOB 1LWXA 1NPPA 1SC1B 4RUAA 3BF4A 5KFBA 4MK8A 2QMWA 4JI6F 2R2UA 1L5UA 3IBFB 1U7LA 5J1PA 1REVB 4CT8A 1KWMA 2YX7A 2DHAA 2PO4A 2H3EB 2OAUA 3K2YA 2HFZA 4I2PA 2ZD1A 1KLMA 4W4MA 4MYUA 1T11A 3G6ES 3CWJA 2UUWA 4OL8A 3AXMA 4DR3F 1REGX 1MMNA 3DRPB 3VGVA 4CI0B 4YP3A 2CQBA 3QWPA 3NGTA 3TANA 3H8YA 3Q83A 1XMQJ 3EGZA 3W2WB 1UVLA 3C16B 3E01B 2CQPA 3I96A 5ETOA 5K14A 1SC3B 2CNNB 4ID8A 3LGNA 1RBOB 2FVCA 4M8LA 4ZIWA 3OHBA 3MM5B 3GE9A 1WHXA 4LFBF 3BEGB 4G65A 3R1LA 3TR5A 1TMMA 5F8IA 1NDPA 4QIVA 2D3OR 2GIRA 4KPYA 1UJ6A 3MM5A 1G7CB 2YKNA 3RW6A 4YHHJ 2RB7A 1RP5A 5KG2A 4K7QA 4DSEA 4O23A 5D0EA 1NK4A 4WU3A 2NZ4A 2YH0A 3R7BB 3CCJS 1K44A 2HK3A 2N7YA 2DGSA 3NWGA 5CYJA 3KTQA 2KVQE 1Y00A 2XMKA 3FBFA 3SCIE 4ZLNA 5KOWA 5IZHA 1NK5A 1Q8KA 2WK4A 1NJIT 4FF1A 1T9WA 3SQGB 2QLJB 4CNYA 3NOGA 1RE1B 5L1JA 3Q86A 3QJLA 2J7WA 2UXBJ 4DUZJ 4M63A 4RUBA 4XDDA 2UXDJ 1HNXF 1X4BA 3EXYA 3M8PA 1HBMA 2W9CA 3KLEB 3OXLA 4Z7YA 2AWZA 5I42B 1FK9A 2XY6A 2D3UA 2XMMA 1I94J 1WF1A 1K9MT 1HMVB 2HFSA 2GIQA 1L3UA 4CP5A 2RQKA 5JXSA 3V4IA 1RABB 1I6JA 2V8VA 1U0HB 2R9LA 2ZKTA 2HVIA 5JVGQ 1NO8A 2EW9A 1BQMA 1NB2A 1P9YA 4ES3A 1RT2B 1H74A 3HVTA 4OZ2A 2CNLB 2ZE2B 2M52A 2FY1A 1MU2B 3R97A 4RW8A 1HHSA 2I8EA 4USMA 1SQFA 4CLKA 1QSYA 1RGVA 2P9EA 1ICEB 3A8IA 3GCXP 4OZ5A 2HMIA 1V6HA 1X5TA 3Q22A 5HATA 3PRVA 1NM2A 2ILZA 3J7YU 1IN0A 4DV0J 1H7WA 1FDNA 2YX4A 2KT3A 3OBIA 4LBIA 3ZZ0A 4UZCA 2P6SA 3TI0A 2NREA 3FSXA 4B3RF 3T1HJ 2RRBA 1IJEB 3DOKA 4X84A 3TEGA 3DGVA 4J9OA 4IO9Q 4PUOA 3W8PA 5KFXA 5AJ3F 2XWYA 3AA9A 4M5HA 1QSLA 2HHVA 4Z7CA 1XERA 4NLWA 5THWA 3V6JA 1JIHA 2YNGA 4FF3A 3DM2A 3RBEA 4YMEA 3A3OB 4ECZA 2XLKA 1RWOB 4KY3A 3BKUA 4LF4J 1K73T 2FQQB 2YKMA 4QCLA 3BBCA 2DHSA 1VHFA 4LVNP 1ZS6A 5GAEI 3MPWA 2UUBJ 3P5BP 5KFWA 1B7FA 2NUUG 4ZK7M 3DXBA 3CT9A 4DL7A 2E9RX 4J37A 4I67A 2A6OA 1N52B 2F5GA 3GONA 2YNIA 4M5NA 1NDCA 2G2OA 2SXLA 3UVJA 2BE9B 3M6VA 2ZM6F 1AXQA 1H2VZ 2QIFA 2RH3A 5C25B 4Y0FA 1N33J 1Z2LA 4RW9A 1KOOA 3HHLD 2BXJA 2IRUA 4EMDA 3RR7A 3EVWA 3H2VE 2LA6A 4NWBA 4PRFA 1QD1A 3KHHA 3T5KA 1HHQA 1XR7A 4DPWA 1XR6A 1DHMA 4X4RA 4F4WA 2B9YA 2EG2A 4C11B 5L9NA 2DEIA 2DIUA 3QMQA 4NA1A 3MURP 2OP5A 5DLGA 4CH0S 1C0TA 1BGXT 1Y3JA 2B0GA 4LF2A 3U7JA 1U0HA 4IOCQ 2AV5A 1VMBA 4KO0B 3SFUA 4K4VA 1WEYA 1Y3KA 5HVGA 2KT5A 4RWXA 1U48A 4JI8F 2IMOA 2BJDA 4FDFA 2Q3PA 1X4EA 4P7VA 2BE2B 4FYDA 2DH8A 3EGWB 2J76E 4AL7A 2OPRA 1RXOB 4Y2CA 1D1UA 4RWWA 5A8KB 3QNWB 1CSJA 3GFZA 4NLRA 2BW7A 4EYHB 3FK4A 5F8NA 1VYAA 5KFHA 1TKTA 1RTJA 2ASYA 2RHSB 2XZDB 3A8KA 3NAIA 1SJ1A 1MG7A 4RW8B 1M5VC 2AYMA 2F7VA 3F44A 1RUSA 2HG4A 4J90A 2BANB 5LMNJ 2M7SA 1N34F 1DBDA 4PG7A 2IHR1 2NQPA 3UDLA 4DQRA 1ZAWA 3G2XA 3MPVA 3CVKA 4N7TA 3RAXA 2YWKA 4QYZJ 2VIHA 2ZOMA 4OX9F 3G87A 1KQFB 1IWGA 1GAOA 1F1BB 2GQ2A 3FJ2A 1R89A 4NLVA 1VFJA 5A8WB 1F5AA 4HT7A 1HWLA 3R6LB 4L76A 4ZVRB 2PMZD 2KG0A 1VQOS 2VFUA 5ETPA 1UZDA 3GJRB 3R1HA 4V19J 1VQ5S 2GMLA 3W9IA 2PFFB 1AUSL 4GKJF 1ZAVA 2R2SA 2BJ1A 4R5PA 2XM3A 1RKIA 4AFFA 1W2BR 2UU9F 1Y5LB 3WZ0A 2CPFA 4LRDA 2F9DA 4LT6A 3BM7A 2DHXA 4DR7J 3MAAA 4J9UE 4DN9A 3D0IE 3VAGA 3R5GA 4XDCA 1WHVA 5ADZA 2H1YA 1C1CA 5BYSA 3T6BA 4F0MA 2BW2A 4U7UK 4NASA 3WC0A 1SJQA 4WZQA 2KVIA 2VICA 4DCPB 2R8JA 5IC6B 2V4QA 4ZMMA 4BDPA 2HFNA 4ZVFA 3L7OA 1RBLA 3VAIA 2YNFB 2EFOA 3B4DA 3TAPA 2CPYA 2RS2A 2J6TA 1BQNA 4GKKF 4KE5A 1CJVA 2I5JA 1WEZA 4OZ0A 2R7XA 3DLKB 2DNLA 2HVDA 4Q5VA 4OI2A 2W9BB 1RHQB 1RT1A 5KT7A 4RO0A 2HNDA 3SBMA 1RT1B 4RR5A 4ER8A 1NHVA 2H51B 1ZETA 3W5ZA 2MXYA 1RT4A 2K1RB 3CCTA 4Q7AA 4WFYA 5EWGA 2W7PA 1VQPS 2CJKA 1T95A 4TU7A 2V68A 1LQ9A 1FRHA 2GQCA 1GTEA 1OYEA 1R6YA 1RADB 1U2RA 5B0BA 5F3ZA 2HQIA 3KYLA 3VAJA 2WCXA 4KH1B 5HK4A 3WX4A 4YOEA 2ROPA 4HVZA 3H59A 1HHTP 4RKUC 1UWAA 1FD2A 1HNIB 4QR0A 4I6WA 4ZJLA 5KT3A 5D4OA 1OY9A 1HI0P 3NCPA 4KB7A 4AD6A 1RTJB 3PIOQ 1S0OA 5DG9A 3CCVS 2PC6A 3K17A 4E0DA 4J9LA 1FEEA 2W2MP 2R4FA 1FX2A 1IKVB 2G0IA 2W4PA 4AXJA 2VJVA 3CMQA 1JNRB 3EVMA 3FBCA 1LW2A 4NEZA 2HWHA 2DO0A 4G1QB 4DEZA 4ECXA 2GX8A 1U2FA 4HT5A 2IVYA 3T3FA 3THTA 3Q8QB 2KT2A 5GAHI 5EDWA 4CRJA 2V9KA 2FJVA 1XQIA 3H2LA 2XI2A 1TVRA 4KO0A 4DL6A 2XBPA 3P8BB 3IG1A 4DV4J 5L46A 4F4ZA 4IR1A 3KUEA 1FDDA 3MM7B 3TOQA 2ZH9A 2M9KA 2MJUA 1DRZA 2UXCJ 2CJBA 3LP2B 2RHQB 4ALZA 1EETB 4AQYF 1OMSA 2VKZG 1DURA 3GYXB 5E3RA 3TVKA 1NHKL 4A8XA 3K5MA 1RU2A 3DYAA 3PW5A 3EDQB 3V2UC 5T14A 1S6UA 3L9ZA 4RW9B 3ILOA 1FVSA 3VZIA 4AXIA 2P8IA 5A8KA 2FJDB 1OSDA 4CYUA 5C25A 3R8YA 4MJKA 3S8SA 2ASLA 4J9SA 2GQQA 2CZ9A 4LUBA 4IO1A 2CIMA 1HBOB 2FLPA 1FJCA 3V4MA 1VRQC 2EC2A 1S5ZA 5KFOA 2W2NP 3D66A 1XNRF 5C7PA 5KFNA 3J81U 5J2NA 2XO7A 2B5JA 1C0TB 4DLGA 2R8KA 1N6QA 3BPSP 3PO5A 2WW8A 4WIQA 1HNWJ 3Q8UA 1SPBP 4C8ZA 1VQ9S 2R7TA 1N5VA 2QL9B 1X0FA 3LTOA 3MR7A 1KP6A 4WU2A 5DQGA 4YEAA 5DM6Q 1YZ7A 1TK0A 2WOMA 1CULB 1S1WA 4EK2A 4XO0A 3DLBA 4PG5A 1HBNA 1S57A 4HLBA 4RUHA 3KK3B 5L1IA 5BXIA 1AZSA 2XZTB 1SIZA 2VG5B 2WVEA 4CYUB 2Q79A 4P73A 5H1SV 4USTA 1UCNA 3BBBA 3DLGB 2GNKA 3EM1A 8AT1B 3V6KA 2HNZB 3PKYA 1Q81T 4FYWB 4X4SA 3HPOA 2ATCB 1P6TA 3HULA 1UVNA 3BN4A 1ZBTA 2A6MA 4ECQA 1MN9A 3VALA 2WONB 3KG4A 1FRJA 2LQJA 4IOBA 1W2IA 2YBVA 3J81j 2OJ3A 4URSA 4QU7A 2W2OP 4AL5A 1IM4A 3CGIA 4PYAA 1YG0A 4JI5J 3I0RB 1O5JA 4P7TA 1S9FA 2WAQD 2AYGA 3IG1B 4J9RA 3L7PA 2A18A 4LRBA 1SJRA 3T1YF 1ZAXA 3OL7A 2IRYA 4C8KA 2RNEA 2WRMA 1TUWA 4DPOA 2MZRA 4OJGA 2W8LA 3BREA 1HL6A 3WIVA 4ED0A 3V6DA 4JI2F 4M5MA 2MKSA 4LF8J 2XMJA 3FFIB 5IT9Y 1F3FA 1PAUB 2OFHX 3N0VA 3PRDA 4QPTA 1WSRA 2G1DA 4XAKA 4ZVSB 1QJHA 3MMAA 3A8JA 3HSZA 2EFVA 4B3MJ 3P6YC 1NH7A 2QYGA 2GO9A 2KM8C 1MU2A 1I3OB 5HQMA 1R0BG 4LF1A 3S6EA 2DO4A 1V3RA 2JWNA 3DCAA 1HNIA 3FKBA 4Y00A 1UJ4A 4DJBA 2F3JA 3OL8A 2DEJA 2OEJA 2VQEJ 4DI6A 2IYGA 4CM0A 3L7UA 3EE3A 3MTJA 4DQSA 2LECA 2AJ0A 3MEDB 1F60B 3QFHA 4C3MA 1S0MA 1RT5A 4F3QA 1ZOTA 4K4ZA 4MYTA 1LW0B 4CLZA 5KTQA 2HZVA 4I7FB 2E5GA 3CJ3A 4DV1F 3I32A 2G2ZA 3C6TB 4NMXA 4WE1B 5KT2A 4ED2A 1L3VA 3MCNA 4BBYA 3I56S 1YIJS 2N82B 2MQOA 1GMVA 3CULA 3ZZUA 2VA2A 2FVQA 2RKIB 3ZZYA 2IDLA 4BHQA 5DGBA 4LFAF 1TKXA 3D7SB 4P10A 3AT1B 3TA1A 1UFLA 3HX9A 1SL0A 1NH8A 1BLUA 2HEKA 5J1NA 4KPCA 3WDOA 4RW6A 4DX5A 1RTDA 1FWLA 4K4UA 5M2RA 2UVRA 3BSCA 2PI5A 3AY0A 1SBRA 5CYMA 5L8RC 3B54A 3EZUA 4ZPDA 4NRTA 1KEKA 3BH7B 2MQQA 3WC2A 3T9ZA 3CCQS 1SJ4P 2KZMA 1UFKA 2PI4A 3CD5A 4PZVA 4RBUA 1YRUA 1HQEA 2OIHA 5LSLA 2A3JA 1LNQA 1G6BA 3UN2A 3W9HA 4DV7F 4B9SA 2JX2A 2QG9B 1HBUB 3EWGA 1FI4A 2VG6A 5DQHA 1M5OC 4C7QA 2WVBA 3ETOA 3Q89A 3VV2B 2Z58B 1R8CA 2KJWA 5E2QA 1JX4A 3LPEA 3CIMA 5LM7E 1FFGB 3TZWA 3CCMS 3QT6A 4C4WA 1HYSB 1SV5B 1TMJA 3M7VA 3BGRB 4PWUA 2F8EX 2R42A 2PDAA 3N28A 4WP9A 4PPDA 5E3CA 1NHUA 2NR0A 1PG5B 3N79A 3THPA 1F5BA 1HIYA 1KBRA 5B0AA 4J9MA 4NL5A 4M1KA 4K0KJ 3JQKA 1HNZF 1WKJA 1WOSA 1URRA 3BJYA 2ZOGA 3LOUA 4NLOA 3VAHA 2FD2A 4ED7A 2AJQA 3BV8A 1KLMB 1S1UA 3HKWA 2J8AA 3KG0A 1U1QA 2MKKA 3C15A 5B08A 3JSMB 2KFNA 4C3LA 2IAJB 1MW7A 4K4XA 1VIXA 3D0HE 3POTA 2C2DA 2IA0A 1NEEA 1RT3B 1FNMA 1V3SA 2UV8A 3GLJA 2PA8D 5HBMB 3I82A 3KJFB 4JI7J 4RUCA 2R8IA 3P3DA 2R2TA 4KH0B 4NXNF 2D1CA 3SCLE 4HYKA 1QLNA 3ZTPA 2WZ1A 4IG3B 4DUYJ 2JFKA 2L3MA 2VFVA 2E7WA 2ZZMA 3QJPA 3P96A 3G71S 4ZVGA 1RTHB 3ET6B 1XC9A 4MIAA 5M2PA 2QA2A 1K0TA 1VLYA 5KFKA 3PO4A 3KWMA 2G2YA 3BYRA 3MCMA 2BA9A 5D0HA 4DCOB 4J9VA 2K8GA 3IMQJ 2IFXA 4U6PA 4PG4A 2F4FA 2OEKA 3H42A 4ELVA 1XWLA 1VRUA 2HNZA 2H4YB 2OKQA 4LSLB 2LXIA 1EX8A 1GX6A 1S48A 1UZHA 1RCXB 1JKHA 1WC1A 3QGPA 4ZPBA 2VG5A 3MUVP 2EFNA 4P2XA 5F9NA 3M9MB 4UQGA 1D9DA 4C8OA 3DMJB 1FEHA 2V8PA 2W9AA 2BE7D 4X66J 1WI8A 3D5MA 2XHWA 4PCQA 3B4MA 4IRDA 3CNQP 1HI1A 1RAIB 3E3XA 4FYXB 3OSNA 1RLDA 5K8OA 3C2PA 4ZCKA 2E5LJ 2O1PA 1VLOA 5D77A 4WF9Q 2FZGB 4FVCA 2WVFA 2WSCC 2ZEJA 5E3AA 4OJ3A 4LRCA 2RU3A 3IXQA 3G6YA 2YPZA 4WYWA 1U09A 4L73A 1F2HA 3DM2B 2CQ3A 2FGOA 2J0WA 2YNGB 4LR7A 1AYEA 1H6KX 4I6YA 5HJXA 2DXEA 1RWNB 2XULA 4BC7A 1KONA 3ENAA 1E6YB 2DNMA 3B82A 2AP6A 3PYDA 2DJWA 5F8JA 2GVZA 2OEMA 4JP8A 1R8BA 3G8SA 2G9OA 1RWKB 3NRBA 2X1AA 3CUNA 4LF6F 4QU6A 4PWWA 2KXNB 1K47A 2BM0A 1WC0A 1SH3A 1FT8A 2DNQA 4AYBD 4C48A 4LVOP 4ZN3A 1VBXA 2XB2D 4FNHA 3DLLQ 1HD1A 4ZVPB 4PYDA 3OR1B 1AT1B 4USUA 1BUXA 3D3BJ 5G4DA 4LR8A 2IBKA 2EKNA 2M0GB 3FCWA 4GMKA 1SUQA 4QIEA 1QE1A 3T19A 2CQ0A 4UOGA 2XNQA 5KFFA 4LIRA 4PXCA 2ZJRQ 1EIYB 3W8GA 1U6BA 3LP0B 4JYAF 5ETTA 1S1TA 2EK6A 2BV3A 2OPSA 2ZC4A 2E7XA 4MT1A 3O1LA 2FTRA 7AT1B 1JLCB 2QL5B 3H90A 3M1VB 4K5SA 1S1XB 4DR6J 3HDSA 1RB0A 3KFWX 2GAHC 4NI2B 1TVRB 4X65F 2R7WA 3N6NA 3CCRS 3MCSA 2GHVC 1HMVA 3D1HA 4X64J 1VQ8S 3EZOA 4DSFA 4RLEA 5DO2A 4B02A 2ILYA 1R0AA 2I9SA 1VBZA 1XTZA 2ZWOA 3MEGA 1NKCA 1CJTA 3OQ2A 3MUTP 2YNHA 5LOQA 3UD3P 1T03B 5KFVA 2XWXA 1O51A 1F3VA 1ZZFA 2BJ9A 2LXUA 2ZITA 1SJ3P 2V67A 2V9WA 2XS5A 1RA7A 2W8KA 2EBEA 1XNQJ 3SQGA 2YTCA 2ZUAA 3ICLA 1EKRA 3QO9A 4CO1A 2GC8A 3MR2A 5D0GA 3MAQA 4F4XA 3NY0A 4FKXA 1SKWA 1R8PA 2W24A 1YLXA 4KR0B 4RW7B 5JVHQ 1IKYA 1FRLA 1ZPWX 3PIPQ 2CQ2A 2D41A 2J9DA 3DLJA 3NS7B 3H25A 4CO3A 2FLOA 4TXSA 1GX5A 4C6AA 5HL7Q 2DTJA 3NS6A 3RBDA 1A7GE 4ZLLA 1RISA 2GCFA 4C8NA 1B4SA 5HLFA 1PAEX 1WHWA 2VG6B 2ZH5A 4QZVB 4KQZA 3F41A 2E1AA 1RI7A 2MY8A 2VC0A 2D3ZA 3FRYA 5HSPA 2AGQA 2B4VA 5BYRA 2D9PA 4FP9A 2RQ4A 4ECRA 3ISZA 5HROA 1TKZA 4P2FA 4Y65A 1NJYA 1WORA 2A10A 2HS4A 2MPUA 3ITHB 4AUKA 4K4TA 2Y1JA 2F8MA 4ZP8A 1JLGB 4AE5A 2ZH3A 2IC3A 3H0PA 4HACB 4RU2A 4MAKA 5CYQA 2G4BA 2PA3A 3A8EA 4UY8T 2EI5A 3PZPA 3PDNA 3QO9B 3D6FB 2YWEA 4QWAA 2VFRA 1NDLA 2GS8A 4RL1A 3LANA 4N77A 1FERA 4W92B 1GMWD 1C1CB 1HD0A 1RWWB 1ZM3A 1T3OA 2B8PA 4HI1A 3BO4A 4ZPTR 2BQUA 1KD1T 2MB0B 2ZD1B 2VA3A 4NEYA 1FWKA 3MUMP 4USIA 4DR5J 5LL6d 1TV6B 3PYFA 1UMJA 2HHHJ 4TYBA 4C0HA 3M2UA 2HYIB 1HI8A 3Q23A 3NGRA 4K4WA 1Q0NA 4ZITA 3PRBA 2R7OA 2KZZA 2CQCA 3SIPB 3BB5A 3C6TA 3PEHA 2LU1A 3UD5A 2ZH8A 1OPZA 1S4EA 3ZNUA 4OQJA 2ASDA 1FJ7A 1FJGF 4KV8A 5C42B 3HVRA 3NGKA 1GH8A 4A8FA 2Z2ZA 1RHRB 1YBAA 2DY1A 3MD3A 3U27A 3CMAS 4WK3A 3TEHB 1HKAA 2FHMA 3RAMA 3PYEA 5D6GA 5I3UB 4DV6F 5J2PA 1HPZB 2V4JA 3VVUA 3WX8A 4YR3A 1JMTA 3HSJA 4K2JA 2DISA 1T05A 5A2QU 4JI4F 3M2RA 1HFEL 3LGHA 4P74A 1R31A 1VR6A 3CJKB 4JI0F 2C28A 3PYGA 4PKDB 1UA1A 1TZ0A 4HEA9 1M5KC 5AXKA 2AZ3A 2RE1A 2YNHB 4YN3B 2YKOA 1X7VA 2OSQA 4NYZA 2MGZB 2KFZA 3N9UC 2LLZA 1QVGR 1RWUA 3J7ZT 4NLPA 3R5AA 3NG8A 3QIPB 3QYYA 3OUYB 2KO1A 2YX1A 4RBTA 2K7KA 2Y1RI 1OQ6A 1PJ6A 3PG9A 3RTVA 2E5HA 3O5TB 4IH7A 2ZOFA 2CJAA 2M4MA 2O66A 2KU7A 2VL1A 3AQOA 4NI2A 3IP0A 4U8YA 4CH7A 5BR8F 1S1XA 2G1HA 2BKOA 4EEYA 4F0HA 3LWMA 2EXUA 2NXNA 1PC4A 4ZPWR 3UNYA 3SMZA 1LEOA 1Z4UA 3RYLA 4C11A 4DX8H 3G6VA 1S12A 5DZ6A 4ANDA 1XMOJ 2LEAA 2DPJA 2EKYA 2C3PA 1VQLS 5CZXA 4D3GA 2Z57B 2YWHA 2MZ1A 4FBUA 3AD8C 2BOAA 4ICLB 3Q8RB 1FD8A 1VIOA 4JV5J 5A0YA 3C46A 2RF2B 3DRRA 2RIJA 5ETSA 2JJ4D 4G1IA 5DDPC 3DLGA 2VQFF 4TKTA 4HI2A 2KM8B 4UQTA 4DWIA 1N8RT 5CCLA 1W25A 1WDTA 5E3QA 2H5EA 3BN7A 3UVJB 2MHEA 5I3QA 3OTBA 4LSLA 4KHMA 4ZLPA 3UR3C 2ZBIA 4ZPAA 1O0PA 4EUVA 3J80U 2JDJA 1DY3A 4RNFA 1FDAA 1HNVA 1Y5NB 4DG1B 3TUPA 1KN6A 3BSNA 3H5XA 3HJFA 2G13A 3LQVA 4PPZA 3B6BA 3D1OA 3FZ2A 1FRIA 2LEBA 3V81B 2VOPA 1N36J 4FYYB 2BVZA 1RTHA 3ET6A 3UWTA 2NLWA 5M2UA 2CAJA 1B0PA 5J2NB 4X4TA 4URGA 3EXCX 4N76A 2KRBA 1Y9OA 4JI3F 2CDQA 3QATA 1U02A 2V94A 1T94A 4USVA 2MLYA 4BWMA 2D74B 2WB4A 2B4PA 4WXOA 2RVJA 1N5QA 2JOQA 1JLBA 4HHHA 2C2RA 2KI2A 2U1AA 3PXGa 3CJ4A 2Q6CA 2ZZTA 2KRRA 3FNNA 3QIDA 4DOZA 4ED4A 3M9OB 3ZZPA 3W9JA 2ROEA 3VWSA 1HQ2A 4QR2A 4P72A 1IBMF 1N48A 3RJMB 2ZBCA 3M8QB 2N3LA 3TUIC 1FKOA 2QLXA 2EFPA 4YY3J 1SC4B 2DITA 3Q0AA 4WTYA 2BOPA 4PQAA 3MFHA 3SV3A 2XY7A 3N6MA 2DNGA 2PE8A 3P45B 5DRKA 3EZ5A 5GAGU 4QYZK 4IG3A 3IGNA 1MROA 2B9XA 2FB0A 4OYXA 3TX8A 1NCLA 2HGNA 3HI9A 1WTBA 2ZJPQ 2QE5A 2MZJA 3EGNA 4QR1A 5B0FA 3RB3A 3TZYA 3I4PA 2C2ZB 1H2UX 3CXCR 1LW2B 3HM9A 3MZIA 3GFYA 2CFXA 4UTGA 4P71A 3RB6A 2DVIA 1DTQB 3M8PB 2AJ1A 1S7IA 1Q8BA 1LV5A 2VOOA 3C6UB 2PSZA 3ZZZA 5LMUJ 2KYZA 3R2CJ 2O5DA 2HPUA 4BS2A 3QAEA 2ZNYA 3GYGA 3IRXB 2OFGX 1TFWA 2VASA 3TX0A 3US5A 1HLWA 5DDRC 2BABA 2J9EA 1WC5A 3HZGA 1YK9A 2QFIA 3EICA 1A9NB 1CC8A 1WC3A 3L3CA 2QSFA 2HIQA 1SJFA 2G0CA 1G1XA 2QEXS 1C0UB 4XPCA 4DL5A 1N5SA 1N32J 3T6JA 1QY7A 3BZQA 4WFXA 1NK6A 1PBAA 2CG4A 5J2QB 2ZZNA 4LFCJ 4TYAA 4KC5A 3AB4B 4PEOA 1HQUA 3AJ2A 1S9EB 1OQ3A 2HNDB 2LA4A 1HQUB 2NSBA 3CJ5A 3FMBA 4WXWA 3W61A 5HQLA 5K8NA 3PR4A 4FS1A 4X2BA 3UNGC 1PCAA 4WE1A 2V8DA 2MZTA 1QVFR 4I7FA 1BQNB 5MAOA 2H5JB 1TK5A 3TO8A 4J9PA 2VPZB 4NLSA 4UF4A 4B3OA 4PXDA 4H4KA 5HN0A 3OV7A 1MWYA 1HWKA 1RSCA 2NXJA 2V8HA 5B7WA 1YJRA 4ED6A 2HGLA 5C2GA 1Y4ZB 1NMEB 3RBXA 3C14A 2FGCA 3M2VA 1FWPA 2E1CA 1I1GA 2RUSA 4YDDB 2HLUA 1YJNS 3DGPA 4KAIA 3ENWA 4CWBA 5KG4A 2DKOB 1FO1A 1ZTWA 4B3TJ 3R5JB 2F40A 2F9JA 1Q78A 3R6GB 1IUJA 4ZOSA 3MAAB 5E0OA 3MMCB 5KT5A 3OVSA 1U4BA 2HGMA 4Q8EA 3GCWP 5L9XA 2XCAA 4QYRA 4Q0BA 2UUAJ 3Q2SC 2LQ8A 3D4JA 2W1BA 4LF5J 2M88A 1YRTA 2CZVC 1RJJA 1S9EA 4ATNA 2F1FA 3O44A 3KNGA 1AB8A 1N0VC 4OI4A 2ZVIA 3G86A 5HLFB 1Q1KA 2FJEB 4WWSA 2QC3A 5K20B 2HHQA 2XYHB 3CD7A 2HBZB 3QRRA 3R5DA 3UR0A 4OIXA 2CWKA 5A8WA 5HANA 4ZVHA 2LKZA 1X9MA 1FKPA 3OJUA 2QLBB 4IRCA 1Q82T 4F7VA 3A3PB 2CADA 3OR2A 3SXLA 3TQEA 5KFJA 4EZ9A 3G8TA 2IM0A 3OTOJ 5K8PA 4LQ3A 3NBPB 3TZXA 1Q7LB 1XEZA 1N88A 3UE2A 1NK8A 1T3NA 1F0XA 3L09A 1OY8A 3TAMA 1W7WA 2GV1A 4OX6A 5DGAA 1N56A 2QRRA 1JB0C 1T03A 3OFEA 3NGUA 5BJRA 2QX0A 2G0JA 2LDYA 2PN6A 3IBCB 1AZSB 2NXCA 3O3LA 2A1BA 1YJ7A 4NA2A 3NNAA 4DUTA 4DR1F 1FHTA 1WACA 5KFTA 3KLFB 4X62J 2IPOB 3BQ2A 4KKOB 2KH9A 2I1RA 3IM8A 2XY5A 2H54B 4Y28C 2LYVA 2ABYA 1JLCA 1XMBA 4JBCA 1WHYA 3V81A 1KHWA 1MMLA 1HARA 1EZZB 4KHPJ 3DU5A 4P52A 3T1AA 1OO0B 3AD7C 3GG1A 1BWEA 4NZ7A 5G0RB 1IKWB 3GJSB 1Y11A 3DRYA 4I1TA 4HDGA 2H9ZA 4QW9A 4R25A 4H54A 3DLEA 2AX1A 5F8MA 4O3NA 1RACB 4MTPA 1J5OB 2HFVA 2DR8A 2GA7A 1VI7A 2FPHX 2XEXA 4IG0B 3N4WA 2BACA 2ZDPA 1RWVB 3NEKA 3W2VA 2QA1A 3J80Y 1JKHB 1WUUA 3DDKA 1HBNB 2RDIA 5AXNA 1T0TV 4IFYA 2QLWA 3KK3A 1CULA 4QWCA 4M95A 4EU0A 1QTNB 2QYCA 3DYAB 1GXUA 4NE9C 4FZVA 3SV4A 4ZHRB 2HK2A 2OUGA 4CLUA 3W5YA 1JWWA 3MPUB 4R8UB 3J81Y 2FJWA 3PW7A 3FUYA 4O0NA 1VC6A 2B6AA 6AT1B 2Y0SD 3CJ2A 4K2XA 4DFKA 2ADBA 2MYFA 4OLPA 2JH3A 2LQ9A 4ERDA 4DG1A 1OY6A 1MWQA 3OD2A 1ZA2B 2CKWA 3M6UA 4DV5J 1CC7A 4I0WA 3SSSA 1DQ8A 3RBZA 4WBFA 3GILA 4ES1A 2DD8S 1ROFA 1VJWA 1RAFB 2FHJA 3K7RA 3AOCA 4MIWA 2ZH4A 5HP1A 3CC7S 3PNIA 1LWFB 3QWUA 2RS8A 1OSCA 1VRUB 2RF2A 3ZNJ1 2QT7A 4DR4F 4OHXA 2C3OA 2KG1A 3BGUA 5MLCV 3A4TA 3PJWA 1JJ4A 2KXHA 2I6WA 1XK8A 2V2ZA 4U95A 4ETZA 1T05B 1T9VA 2AEFA 2H5IB 2VC1A 4YB6A 3I0SA 4B17A 4GVBB 4KGKA 1J5EJ 2JFDA 1DLOB 3G96A 1F9EB 3MTKA 3GIMA 1NK0A 2BJ3A 8RUCA 2HAIA 2OH2A 1P1TA 3W63A 2C2OB 3KUGA 2DGTA 1S9GB 3OHAA 4TLQA 1I51B 3QFWA 4NLXA 5AE2A 1U8SA 4JI6J 1JJCB 3HD1A 4N56A 2AD9A 1HBMB 1IKVA 4K50A 2W7AA 1YQHA 1H0HB 4MK9A 1CPZA 3FQLA 3ZFVA 5DZ7A 1U1LA 4YB7A 4H4MB 4TN2A 4CTAB 5DG8A 3DGPB 3M2RB 4LF9J 3MM9A 3CTRA 1NKBA 3VHQA 2WHOA 4ILRA 1BY9A 3M2VB 2V4JB 3M30A 2OELA 4P6QA 2AHOB 4ZLJA 2R7SA 4DPXA 4F25A 3BO3A 5CYQB 1V9OA 1C4CA 3MFIA 3HFZB 4WYLA 1XMQF 4DS4A 5L1KA 1IBLF 1EB0A 5I4MA 2OD4A 3NOCA 2FHJD 2BKNA 2FZKB 2NSCA 3MI7X 5DG7A 4DQIA 3KDOA 2AF6A 4L3NA 1U49A 4LFBJ 2NXUA 2NPIA 2OD6A 4UOHA 2KFYA 2QFJA 3CCES 2QO3A 1B99A 3M2UB 4ZVUB 2PFDA 5L38A 3HHLC 1HBUA 3IBWA 2GJ2A 2J0SD 5LT5A 1IBKF 4MK7A 2P2CB 2WSEC 4DCJB 1WG1A 3DLKA 5KFQA 4EBEA 3WIUA 1RWPB 4U7UD 2QL7B 4IQMA 1LW0A 3VVTA 3E01A 4ENOA 3TQ1A 1GMWA 3F0NA 4A46A 2DGOA 3I6PA 4OZJA 1VK8A 1X60A 2LDIA 2PT0A 3M30B 3JAMU 3MR5A 2R2RA 2OMLA 3I9ZA 4HACA 4J91A 4FXDA 3FBBA 3KJQB 3H7HB 1IR1A 3IRXA 4H4MA 4RW6B 3E51A 3VTIA 1RTDB 2B7CB 5A76A 3GIIA 3MMAB 3QQCD 4J9KA 4PG6A 3C6UA 3RW7A 1JNZB 1NNDA 1QAYA 5GMDA 2RKIA 2UXDF 3HMJG 1HNXJ 3FFIA 1SQGA 1N0UA 4WFBQ 3CJ0A 2ACYA 1JLAA 2AEJA 2L9DA 2Z56B 4DX6A 2V34A 5KFCA 1JQGA 2RRAA 1ITPA 1RWXB 1X9SA 4HR2A 1L3KA 1UPPA 5AXMA 2AGPA 1K1SA 2XSFA 1I94F 2RT3A 4WIIA 1S9GA 2GHWA 4CZCA 4OX7A 1H73A 3M8YA 3KLVA 4B3SJ 3W66A 1MROB 4HHJA 5KAKA 3QT5A 1VQYA 3MHYA 1RT5B 3K59A 1RYSA 1S76D 3GQCA 3CDEA 3I0RA 1S4FA 1TUGB 3IFEA 4C3KA 4A8SA 1U1MA 5ITHA 4NXMJ 2GVDB 3JXOA 3NGSA 1MN7A 3GIJA 4UY85 9RUBA 3LAKA 1S97A 3D67A 1IQZA 1KKHA 2AKWB 4ECWA 1LK5A 4N8NA 3HHLB 1RT6A 4J9NA 3B8HA 4P9SA 1P1LA 4OHWA 4DL2A 4O44A 3K8WA 5CA5A 4DV0F 2IY5B 1BWVA 3MEGB 2DNNA 1VBKA 1Z2ZA 4X4UA 2B7BB 2BKPA 5FDLB 4ZVOB 2OPRB 3RUBL 7FD1A 1KTQA 4DS5A 3M32B 3T1HF 1ZZNA 2GVZB 1TKDA 4YB5A 2MKCA 5RUBA 2GMJA 5AJ3J 3Q2TC 2EK1A 1R8HA 2UUTA 5IV4A 1YHQS 3QJJA 2LMIA 3RB0A 1HW8A 4HTJA 1S6PB 1MNEA 2E9TA 1SL2A 1GK8A 3D6HB 1LFPA 3OTDA 2GZOA 1S1TB 2PGCA 5CHCB 3JYTA 3JQMA 4LF4F 2W4DA 4ILLA 2VJUA 4KHRA 1N6QB 7FDRA 2UUBF 4EBCA 1BXNA 2XNRA 1FNXH 2ZNZA 1GTHA 1NZAA 4KYZA 4I6AA 3EX7B 3ILIA 2ZH1A 4ZVEA 5ETMA 3PW4A 1IKXB 2OPPA 1PO6A 3TAMB 4OYPA 3VGSA 3HHKA 5T7LB 4DXLA 1WSVA 2F4VF 2UV8G 3CJQA 4ZP6A 3NNHA 2HQGA 3BBFA 3OLAA 1DQAA 4OHYA 2KN4A 2BYCA 3SEOA 5IFMA 3UN5A 4RPFA 2OHDA 2Z2MA 3BQ1A 4JI1F 3KMQA 3KLGA 2J7UA 1KSPA 2CPXA 3PTWA 1KVKA 4URQU 2YNIB 1QUPA 2MQLA 3K5NA 4LF7J 2RILA 2WOMB 1E6YA 1M0SA 2Q6BA 5HMYA 2NXEA 4ICLA 3MGJA 2ALZA 3OW2R 3JS9A 1EKSA 3MCOA 5KT6A 4DV2F 2ZE2A 1UFWA 1EETA 2DR6A 4OX8A 3NMRA 2AT1B 3VQSA 3DOMB 2DR7A 2UUCJ 4OYAA 1VOMA 1YTYA 1A6LA 4FBTA 5ETNA 3KNAA 3G6XA 4IYQA 2X7IA 3TA2A 3PKMA 1FVQA 3MMBA 3H2UB 3PACA 4OFZA 3OL6A 2Y0BB 2EVZA 2V69A 1WNEA 4ELUA 3R5BA 2JL9A 2LEPA 4WFNQ 4I4BA 2DHHA 4O0IA 2DCLA 1FK9B 1YBUA 4RBVA 5DM7Q 4DZDA 3BR9A 4LR9A 1Q16B 1RZMA 1VHIA 2MLXA 1M5PC 5B0DA 1KFDA 4O44B 2DNKA 5D8HB 1YVFA 4DR2F 4B9LA 3HHLA 3OJSA 3CJKA 3SCKE 4Y2MA 3MPDA 3R3TA 1N34J 2VBXA 3KLGB 4DV3F 3HSGA 1HPZA 5IWAF 4F4YA 4HKQA 4XPEA 4X4QA 2W25A 4ZP7A 3KK2A 2DT9A 4OX9J 4C8YA 1LWEA 1SKRA 4PQUA 5J1EB 2DNZA 2GGPB 2CPDA 2X3GA 4QIWD 4JV0A 4ZIVA 4NA3A 2J6SA 1SCJB 1WKLA 3W3SA 1HWJA 1DARA 5CH7B 4XIUA 4HL9A 4ZS6A 4G1QA 5KFYA 5CD4H 4DF4A 2W2QP 1Q53A 1WG5A 2CPEA 3I9V9 2W9BA 3KLEA 2HHUA 1NDKA 3BS9A 2CQHA 3TZZA 2HWTA 4OYOA 5GVQA 3BR8A 4EFAC 1QDUB 5A6PA 1WF2A 1RHKB 3J7AN 4M5DB 4YDXA 4QW8A 1F9HA 3C16A 5SZTA 3CJTA 3ZTRA 3MEKA 4V19X 3CCSS 4O3SA 1X5PA 1UJ5A 1M5SA 2QGFB 4DR3J 1TELA 4DL3A 3EPGA 5K5MA 1U47A 3ZZTA 2OSRA 1RKJA 4XK8C 2IC3B 1YJ9S 1U6ZA 1PGZA 2QTWA 2LFVA 5KFGA 2K3KA 4NOHA 3DFEA 1RHUB 1SC6A 3CJ8A 3UW1A 1TK8A 4I2PB 5D4NA 4GKKJ 1AFJA 1TTHB 3ZTQA 4OZLA 4CLFA 1DTTB 5ETLA 2HQ3A 3TA0A 2HNYA 5A8RA 2K06A 3KK1B 2RQCA 3FC9A 4RX6A 4OZNA 3ILJA 3IO1A 1RT7A 2MY7A 3C3LA 5CAAA 2DHGA 4DFPA 4YHHF 3DDIA 3SSRA 5JMNA 3D54A 4CIOA 1RQ0A 3T5JA 2BBEA 5K14B 2YNFA 3W2WA 4PG8A 1IKYB 2EG1A 2RDDA 1X9WA 4KTQA 1IM6A 3S1TA 2XTJP 4C0OC 5D78A 1S79A 2Z4PA 2C3UA 2DH7A 1PJ7A 2UXBF 3FCHA 3ELHA 5I3PA 3H5YA 2O67A 4DUZF 2LP4A 5CQGA 3W1YC 5DDQC 5B09A 2P6TA 3GIKA 4L6V3 1CJTB 4OI1A 4CCHA 1M5HA 3W5XA 5L1LA 1REVA 4FF4A 2I38A 3Q8VA 3R7NB 4V1Ak 4PWDB 1XR5A 4LQ9A 2ZH6A 4FPRA 1KOHA 2OMOA 4QWBA 3OFHA 3HO1A 2Y8WA 4KGXB 3A1YG 4CM2A 4CNZA 5F9LA 3KJVB 1EAYC 3ZO7A 1D0EA 2R7UA 3MMBB 3N5BA 1AW0A 1LWEB 3M1VA 3F73A 1DLOA 2PMWA 1U26A 2ZBQA 3I31A 1RHJB 3PW0A 3FCVA 4TVAB 1HWIA 1TL7A 3VQTA 1AROP 5IV3A 2BANA 1IVZA 4AQYJ 2YY3A 2LCWA 4B9MA 5KG6A 1JLQB 3L95X 1ZM4A 2EEYA 4NMLA 1TL3A 4EO8A 1N5YB 5DDOC 2Q43A 1H7XA 3MEEB 2AU0A 2Y8YA 4I69A 1EQMA 1XJWB 5DQIA 3O2IA 1Q5YA 2COLA 3F56A 4KJIA 3KXDA 1UL3A 2V6AA 2W01A 3AAWB 1NSKL 1ZM2A 3LA0A 1Q4RA 2AX0A 3HHEA 2N3OA 3J7Z5 4M5KA 1P27B 1UPMB 1U1NA 3V6DB 4FS2A 4B3RJ 2BE2A 2VPXB 3FBEA 3W60A 4TLRA 1S1WB 3DOLA 2XMVA 5EGYA 3UO0A 2BZ2A 4S0MA 3DU6A 2DYAA 4IFVA 3CDBA 4WKYA 2Y9HA 2PEBA 2HW3A 5KFRA 1U24A 3AH6A 5D3GB 4NPOA 1HNWF 1UWBA 3U1MA 5KFEA 3JYTB 2FLNA 3QRPA 4ED5A 2P5VA 2B5JB 1S49A 2FZCB 2JZ5A 2YWGA 2WONA 1UVMA 4NLUA 1T7PA 1ZH5A 1S72S 1M1GA 3CMES 1YJUA 1EHWA 4P2MA 4AL6A 2CUYA 1U2CA 2E7VA 1LWCB 1NLKL 3HD2A 5H9EJ 2Q66A 4MFBA 4ECUA 4KIAA 5HMZA 4Q44A 2N7CA 1WI6A 4ES2A 5A6WA 3FRZA 3TWZA 4BLGA 1OS5A 4IG0A 4ZVTB 5DJBA 3BGLA 5KFSA 3W2VB 2AGOA 1J5OA 1N33F 3DRRB 3UCUP 1N4LA 1SIWB 4GO7X 4OI0A 2RJZA 3GZ7A 4FKYA 1PYSB 3D1QA 3FGVA 3MF5A 5BYQA 5FLXY 1L3TA 2UP1A 1CBKA 5DS7A 2IJRA 2IJNA 3W64A 5AE3A 5GAEU 3HVTB 2VONA 2OPQB 1MLAA 1OPIA 1KHVA 4OYZA 1NB7A 3RB4A 3RAQA 1GQEA 1WDDA 2CWXA 2CPJA 5IT0A 5HO4A 2IVMA 1LXJA 1X4DA 2E1RA 1UW9A 3KKFA 3QT7A 4IH5A 4L3KA 4ZJOA 3T1YJ 3THVA 2I2YA 4KKOA 3OPKA 4JI8J 4OZ3A 2FLLA 3HVAA 1Q5VA 3TJ9A 3NL0A 3HJVA 1WKKA 3DOKB 5AT1B 3H98A 1N5TA 1RT3A 5I42A 1U45A 4B9NA 2MEWA 3M6XA 2W9CB 1S6QB 1U1OA 4KFBB 4L72B 1SB6A 3QPIA 4QJVA 4O4GB 2VPWB 2MLZA 1KQKA 3S01A 3VAKA 3NNCA 1X5OA 4TU8A 3D68A 2DGQA 5KFLA 3HFKA 4K59A 1RT6B 4Q45A 1TL3B 1LXNA 2VV5A 3L4BC 4E2FB 2ADCA 1QSSA 3LPYA 2B9WA 2L48A 5LMNF 1RT2A 1PC5A 1R0CB 1SH0A 1IJFB 4N41A 1F5CA 2BMBA 3MM7A 4A8QA 4IH6A 4LIWA 1TQLA 2XLJA 2HZAA 2BUNA 2LXFA 4OI3A 2ZC3A 4IRKA 3GFHA 3HT3A 2VBWA 3KJVA 2HBRB 2BJ7A 2F8HA 2JEIA 3SYZA 3BGFA 5IT4A 1UW4A 1VC5A 2C2NA 1PJ5A 1KVIA 1WOOA 2MQNA 2QZ8A 2MKJA 2AZ1A 1IR0A 1GFWB 4FXVA 1U1RA 4GKJJ 3SI8A 1JLAB 1PILA 3OL9A 4A8OA 3KHLA 2GMHA 2HNYB 5A8RB 2UU9J 4DR7F 3ONQA 5D4LA 3CCWA 4LFAJ 1CJVB 1UTAA 2I5JB 3PV8A 1S1VA 3MWBA 2KDOA 5F8LA 1C1BA 2MSTA 2ZBRA 1NUEA 4KGMA 4QIFA 2JLGA 5H9EK 2BQRA 2VHGA 1ZA1B 2DGWA 3UDCA 4ELTA 2R8GA 2HHSA 1KDNA 1TUVA 3C14B 2JEGA 2HWIA 3D9BA 3CPWR 2H65B 3MM9B 4RJVA 3N5FA 2R7RA 2QV6A 3U1NA 1YZ6A 4ZPCA 2C3MA 3CF5Q 2X51A 1TKZB 2FJAB 4YB1P 4ED1A 1YJWS 1TKXB 1RLCL 4DV7J 4Y2IA 1RT4B 1JLEB 1X4FA 2DGVA 2K1RA 2YKNB 3IM9A 3JTOA 3LH2S 4KSEB 4X4NA 4R5PB 2FC8A 4RNOA 2ZVSA 1VQNS 3NGDA 5D4PA 3VZHA 5JJBA 2PIIA 4Y3CA 3T41A 2XCPA 3GV5B 1C4AA 1DTTA 2XQCA 4C8MA 3AOAA 2QA4S 5J2QA 2CRLA 3CIZA 3MAHA 1F9FA 1MWZA 3ULHA 3QAUA 2VFSA 3AA8A 2FUG9 1C0UA 3W65A 3MEDA 4RW7A 4USKA 2BR0A 1FTCA 1V5IB 3Q8PB 4K0KF 2R3VA 2CJQA 5AXLA 5IM0A 5E41A 1NK7A 4GC7A 2BM1A 2DH9A 2QMUB 2Z30B 3KLIB 1SH2A 1EARA 1CEZA 1S59A 4RZRA 3D2WA 2HURA 2K3IA 4U8VA 4EGLA 2FVPA 2L9NA 4O4GA 2XG8A 2HRTA 1RA6A 1KRPA 1R0AB 3I5BA 4OZ1A 2V63A 2J0XA 1TAUA 5IXUA 2XGQA 3HSDA 2JC1A 4ID5B 4A8MP 1KLNA 1BE4A 3JTNA 1D9FA 2CPZA 3MM6A 4DPTA 4F26A 1T9TA 1I5OB 3AODA 4KGVB 3GG0A 2E5IA 4DUYF 1UEVA 3GV8B 2CVEA 2RD5C 2HBYB 1TAQA 2CQ1A 1U25A 4NYPA 4C97A 4DV4F 2GHPA 1WTFA 1NJXA 4GVBA 3FZBA 2OPSB 2OI2A 3MDFA 3ZXWA 3I0SB 2UXCF 2B6AB 2FJXA 5SUHA 1FKOB 1P8GA 1LFWA 2MZQA 3MM8A 1TL1A 5KG0A 2CJXB 1C2PA 2F63A 3LW5C 3QGIA 4KT0C 4FF2A 4DFJA 1G3OA 3JAMY 2MTLA 3I4HX 2HBQB 5HI7A 5CZVA 1H72C 4I68A 1NAQA 3B78A 1HR0F 4CDIA 3GIRA 1Q86T 1LWFA 3J7A1 3UDEA 2ZM6J 5HP1B 2AJ2A 2O3DA 3MOJB 1CG2A 4MFBB 4ETXA 1FNOA 1KR4A 3G9CA 3DRXA 5C24A 4X66F 3C8YA 4TY9A 4RU9A 1RHMB 3GP9A 3WQPA 3CC4S 4B9VA 1U8WA 4F3OA 4CLLA 1S0NA 2M5YA 3GFXA 5E7OB 3UFCX 3SDEA 3ISND 1FTRA 3K89A 2E5LF 2MKIA 3UCZP 1KQSR 5KT4A 4DN0A 3AHPA 3RRKA 4UZBA 1FRKA 4IDKA 4M5IA 1UWBB 2HS3A 3S7RA 4TU9A 3M8SA 1IQTA 1KC8T 1X4GA 2FIUA 1GMUA 2RRNA 3OVBA 2DCUB 3PX6A 4HH1A 3T5HA 1H3DA 3RZAA 2BJ8A 4F0KA 5C2CA 2J6UA 3LP1A 1YRXA 5F8HA 4BCAA 4PR6A 1ZM9A 3H4BA 1XIQA 3SQOP 2OTLS 2UVWA 4ED8A 3N01A 3G8QA 3HZEA 1RTIA 5T7LA 1TL4A 2V50A 1IKXA 2AQ4A 1Q7YT 3A12A 4M5LA 3UQSA 4OYMA 5G0RA 2B4OA 2YVSA 3IR7B 5EX3A 1DJ0A 2ZHAA 3E2EA 4JYAJ 1RAGB 2YKMB 4JI5F 4WFAQ 1DFDA 4TNOA 1S6PA 4DR6F 4LSNB 3P49B 5KFDA 4X65J 2ROGA 1VJQA 3FVYA 3MM6B 3Q8SB 1S6OA 3N6LA 4CLPA 4DL0C 1KS2A 4PUOB 4NLQA 3QIPA 5H9FJ 5KG1A 3OUYA 3PHEA 4JI2J 2XMUA 3LGMA 3TUZC 3D6TB 3GR1A 3PEJA 1SI9A 4ZPVR 4LF8F 1YX2A 2E29A 5HVHA 1CQNA 2QSWA 2VZ9A 3TVZA 2DR9A 3OTCA 4DHVA 4B3MF 3NXZA 2KYXA 3NBPA 3R7SB 5B0EA 4U67Q 2WBMA 3GSDA 4F04B 2HKEA 4DU8A 1NU4A 2U2FA 3D3CJ 3HT0A 5T41A 2VQEF 2POKA 2V5HG 4LF5F 2HRYA 2L9WA 2UVVA 1IR2A 2KKHA 4ECSA 3IR5B 3K5OA 1CVJA 3BSAA 3V4IB 4U9RA 4MKAA 3TRGA 4DV1J 2XI3A 3QLHB 1WC4A 1AUDA 2XZWA 2FDNA 2O01C 3KHGA 2XYPB 1RT7B 2M2BA 4N8OA 4K5RA 5GMKa 2W7OA 1DQ9A 4NZ0A 4A8KA 4ECTA 4HTIA 2FHOB 2J8SA 4P2SA 3K5PA 5DETA 4WK1A 1S7HA 3D0GE 2MJNA 3MMCA 4YQWA 1ZYQA 3HKZD 1FJEB 4FPIA 3PY8A 1HQEB 5F0UA 4O3PA 5CCMA 3RGIA 4EBDA 3IR6B 3P5TL 1FXRA 2VDHA 1E6VA 1NPKA 1U0SA 4BWJA 3JSYA 4A4JA 3C66A 5FLXU 4OV6A 2OLWA 2DY9A 3EDRB 2PD1A 1E6VB 4QWEA 2E9ZA 3EJMA 3M8ZA 1JLGA 4CTAA 2AJ4A 8ATCB 3ITHA 4IUFA 4M5DA 3PX4A 4O4RA 3A3NB 4L74A 2D3O1 2HSEB 2B4UA 1D8ZA 4ZA1A 4DPUA 5HMWA 2B43A 1PIEA 2E5JA
chains in the Genus database with same CATH topology
5E5NA 2GFFA 3HXMA 3NMAA 1NJZA 3MMJA 2Z2LA 3UI3A 1FE4A 3M6WA 1VGYA 2MKHA 3LWLA 1D8YA 2HVZA 4YR0A 3IWNC 4B08A 1ZPVA 2ZDOA 2RSQA 2HHXA 5LSRA 1JLFA 1DZ5A 3CB4A 4RNHA 1U6FA 2MZSA 1S77D 5LXYA 2RMLA 2IBOA 5GADI 3TAQA 4FF1A 1U1PA 1JJ2R 3CO9A 2LQ5A 2VG7B 5KFAA 4DDFA 4OI6A 2OO4A 4IQXA 2UZAA 3LAMA 2DNRA 1VQ7S 4KFBA 1JLBB 5E3PA 1WTBA 1DTQA 2HFOA 2R7QA 2C3YA 4NLYA 1K0VA 3K57A 2YKAA 2ZKUA 1UEUA 1VC0A 4JI7F 1VRTA 1EP4A 3NKYA 4YR2A 4OLOA 5GAGI 4NLDA 2YH1A 2XSJA 2MDAA 5J2MB 1YWXA 2KJVA 3DHXA 5LJ3Y 3CE8A 1RAJA 3I5CA 3MOZA 1Q8IA 1WD6A 1T02A 1X4HA 1R3NA 1XMOF 3HK2A 4K4SA 2LVWA 3M8QA 1XBWA 2JLFA 4R0JA 3ENVA 4ZHRA 3JB9k 1U1KA 3DRSA 5E33A 3TP2A 1FE0A 4O3QA 2LQBA 1FESA 1QAIA 2JEJA 3GB0A 1RTIB 3GV7B 3FSYA 1CQMA 3SCJE 2JSXA 5EUHA 4F4KA 3LP1B 2HS0A 4QOTA 1LWCA 3X1LB 4CO0A 5A0YB 3DLEB 4U7CA 2DGXA 3FEZA 3GR0A 1TFYA 1FRMA 3DI6A 3KLHB 4QQBA 2HVHA 4RW4B 4Y2AA 6FD1A 3OFGA 2N4CA 3VAMA 5D3GA 1N36F 2DIVA 3V6HA 3AJ1A 3NAHA 4USHA 3IAS9 2RDJA 1MSWD 3SDEB 1AFIA 2V2KA 4IKAA 2DR5A 3MPYA 4OJ1A 4WFZA 5GAHU 3U02A 1FCAA 1KQGB 2VKRA 2ZH7A 1HA1A 2IRXA 2GW8A 1GNKA 3TARA 2L08A 2N4DA 2RU9A 3IRWP 4UUWA 3M05A 4N5SA 2VG7A 1YJTA 1G2EA 3M9NB 3HHNB 3K5LA 4FXWA 2DNHA 3K58A 4GC6A 1M90T 2HRUA 2KXFA 3H5SA 5KFIA 1QAJA 3LP2A 5IQQA 4W90B 3OR2B 4YY3F 2BJEA 3H4DA 1BQXA 2P9CA 1KTVA 4DSIA 3MECA 4NCGA 3ZZOA 3M8RA 3HLUA 1NRKA 1CLFA 4YFUA 4I64A 1VQ4S 3GYNA 2APOA 1VRTB 2M70A 2EFQA 4X64F 3DXSX 5HQ8A 2D9OA 2X1GA 2QA4G 1UVJA 3LUYA 1Y0HA 1JK9B 5LMUF 4OV1A 2AYEA 1DAXA 5L39A 2C42A 4UUXA 3RR8A 1XNQF 2AYBA 1TL5A 4KBIA 2B3TB 2BQ3A 1F2GA 5J2PB 1V3ZA 5I3UA 2IMWP 4ZCIA 4G3IA 2XS2A 3OXGA 1TP7A 1O8BA 1GXTA 2IM1A 4B9UA 4NCAA 4KV8B 1LK7A 2MQPA 5F0WA 2NUHA 4TY8B 2ZJQQ 5KFMA 2BDPA 5B0GA 2IM2A 2J5AA 4I2QA 4RNMA 4OHZA 4EO6A 2UVUA 1APSA 1KVJA 4NRUA 5KG5A 5EWFA 3KK1A 4Q0BB 1JLEA 2WBRA 3TNVA 4ZDNA 1S0VA 4G1PA 1XN9A 4BC9A 1D3WA 2AW0A 6FDRA 2IA6A 2VD3A 4RNNA 3OXFA 3PFEA 5K8MA 1K8AT 1UVKA 1BD6A 1UKUA 1R27B 5KOXA 1J2VA 4B3OB 1KNZA 1LKZA 4NZ6A 1S1VB 2FVRA 1QUVA 2EC0A 2CZ4A 1QAXA 2V8GA 4CQ1A 4DR5F 3PM9A 3FEXB 2HHHF 1Y7PA 2BRKA 2Y1IA 3EUNA 1L3SA 2K2PA 4QWDA 1ELOA 3IA0A 3GMGA 2VBZA 4TY8A 4G6VB 3KLVA 3UD3P 2E66A 3QLHA 3NP5A 3CDWA 4ZCMA 5CXTA 3DLHA 4MMOA 1VQSA 4F67A 1PSDA 1WEXA 5J1EA 2VB6A 3IWXA 3KK2B 5FD1A 5LJ5Y 4GO5X 2NYIA 3LP0A 2DNYA 3QGHA 3VF0B 2DRAA 1B0TA 3WBZA 1SUQB 3K0JA 1SXLA 4F50A 3VAFA 1NK9A 4N47A 3IC1A 1ZTTA 3RRGA 2GJIA 3G4SS 3FQKA 2FHKA 3ZC4A 3BDEA 3I55S 2C22A 4UOCA 3CCZA 1BC6A 2D7SA 2X1BA 2XC9A 2HHPA 1FRXA 1OWXA 4F2RA 2XLIA 2HZCA 2J9DE 2EFGA 3QZ7A 5KG7A 4IOAQ 4MKYA 2IYIA 3X3UA 4NCGB 1Q8LA 2X1FA 4H4KC 2KHCA 4NLGA 1QM9A 7FD1A 3NLCA 2E44A 4OMFG 3M4XA 4IDKB 5HMXA 2IM3A 3KG1A 4D3HA 4KRWA 4ECYA 4KHPF 4R8UA 4X4PA 2ERRA 3PJXA 4Q8FA 2EWHA 4JV5F 3OSPA 3FSIA 1UAWA 1VBYA 1KFSA 1N54B 4LMZA 2DK2A 2IJFA 4WJBA 4TQSA 3OVAA 3FEYB 2WB1D 4J9QA 3HHDA 3H20A 4OJHA 2ZUGA 2OPPB 2BRLA 5F3TA 3CCUS 2DB1A 3E8OA 4WKRA 1IKWA 1UVIA 2CJ9A 4LJMA 5AE1A 2CQGA 2RUGA 1JXLA 1OIAA 3TW0A 3CC2S 2HHWA 1X4AA 2A2CA 3KLHA 4H4OB 3SFGA 2MHNA 3I87A 5KG3A 4EYIB 3JTPA 3I5AA 1X0PA 4PXBA 3RU0A 4DBQA 2J9CA 3VCDA 5HBMA 4EZ6A 4HH0A 4ILMA 1ULRA 4Z37A 2M8DB 3DNCA 5IS2A 1UP1A 4I56A 5K9FA 3POTB 5F8GA 3IGVA 4Q2LA 4QPXA 3O6QA 3MR6A 3BQ0A 3CSKA 4NCBA 4R0EA 1B0VA 5GADU 3AB2B 2FJBB 3R27A 5FJ4A 4CH1A 3DC2A 2J7KA 1FKPB 4DMZA 3MR3A 2ZHBA 1J5EF 4A8YA 2A2DA 3TYTA 2JEFA 5J2MA 3VR1A 4CO4A 3BGRA 3OFFA 2R7VA 1RDRA 2LU2A 4WCEQ 4MKBA 5F41A 2ZFHA 2KB2A 5DLFA 4UW2A 2P9GA 2YQ3A 2CPIA 4PXEA 2MGZA 1UETA 1TV6A 1X4CA 2B56A 2RQMA 3J7YI 2M8HA 4DSJA 1YITS 1D9AA 2R8HA 3HF5A 2YWFA 4C8LA 4LF9F 4ZP9A 1YJVA 3NS5A 1FXLA 1WF0A 4F8RA 2XMWA 4JV1A 1VK3A 2NS1B 2VPYB 3CDAA 3PVXA 4NX9A 3O8WA 1YSJA 1N32F 1FF2A 2YKQA 4C0BA 4IR9A 5HROB 1LOUA 1SV5A 4M94A 5EN1A 1Q79A 4LFCF 3LALA 4C2MA 5JUMA 1FKAF 4I2QB 3NCQA 5EHHA 2NPFA 3PR5B 3QZ8A 1VQ6S 2HHTA 4Y34A 3IWLA 4J5OA 3SSQA 4WZMA 4CT9A 2EBGA 1S10A 2IVFB 2JRSA 5EX0A 4X4OA 1H98A 2OTJS 4ECVA 3UD4P 1RK8A 4MH8A 1YI2S 1GT8A 2CYYA 2JVOA 4FNIA 5CYMB 5KFPA 2DGUA 3DRPA 1SQEA 3DHWC 3UCGA 3T9NA 4Q43A 4B3TF 4Q2MA 2I0XA 1C1BB 4O3OA 2Q1LA 4FN5A 2JLEA 4Z2XA 3CDUA 1VQKS 5EWEA 2E1MC 3FDSA 4HDHA 3JSRA 2UUAF 4E8UA 1VQMS 2KHDA 2XS7A 2DPIA 4ZCLA 3TVYA 5IQ6A 4DSKA 2VH7A 1IXKA 3GWCA 3LF0A 4USJC 4B3SF 3BO2A 2AJFE 4A8WA 1WELA 2HLTA 2K7JA 3PW2A 3PX0A 4C98A 1Z1ZA 4DQPA 3KMSA 2GGPA 3H5UA 4LSNA 3MECB 2MSSA 1T8EA 2QMXA 1HW9A 3FMWA 1FNXH 4PQUB 3DN9A 2XGPA 1FA0A 4NXMF 2B51A 3H40A 3BDPA 2OPQA 3HVWA 2GO8A 2J0QD 3OTOF 1JXEA 4JV2A 1QE1B 2Z0GA 5LSOA 4JOUA 3OR1A 1YGYA 1VS3A 4CO5A 1TKTB 3CD6S 2M3DA 1JJHA 2DBBA 4B9TA 3IS9B 1H2TZ 1M1KT 2VODA 1S6QA 2DNOA 4A47A 1TR0A 3EYZA 4OHVA 3CEDA 5KFZA 4ED3A 1R8AA 2ATLA 4K4YA 4E98A 2C2EA 3Q24A 1MMDA 5A2QY 4DSLA 4X62F 3ENQA 4ZKAA 3QGGA 4H4OA