3CCQS

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 18
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ccqS00
5IM0A 4TU7A 1X5OA 1M5OC 3S01A 2CPHA 2CQGA 2AYBA 2E5GA 1KOOA 2MZTA 3RW6A 2DNQA 2MQNA 1OWXA 2VONA 1NO8A 3CCQS 3IWNC 3VALA 2CPEA 2B0GA 2GO9A 2MMYA 1X5TA 1ZZFA 2DGSA 4IO9Q 3CC4S 2KI2A 2MYFA 4F25A 3UCUP 2YKAA 1VBZA 2OTLS 4C4WA 2SXLA 3S8SA 4OZ0A 1Q86T 4ED5A 2V94A 1WHYA 1OPIA 1KD1T 3NMRA 2J8AA 2D9OA 3CCJS 4CH1A 4TU8A 2G0CA 2DGTA 5GMKa 2YH1A 2LCWA 2RUGA 5DM6Q 3CUNA 1X4HA 2DNKA 1QVGR 2EK6A 1U1QA 2LA4A 5DETA 2I38A 3G8SA 1VQOS 1NU4A 2KHCA 3MD3A 2U2FA 3CD6S 2M8DB 3CULA 2OSQA 3NS6A 4LMZA 2DO4A 2MZQA 3UD3P 2MKSA 1WHVA 3SMZA 5GAEU 1YJ9S 4TLQA 1K8AT 5IFMA 1U6BA 3MD1A 2MQPA 2E5HA 2HZCA 2MGZB 3G6ES 3UD4P 2AYEA 1H2VZ 1U1MA 3OW2R 2N3LA 5DDQC 3D2WA 2MZRA 2MHNA 2KVIA 1R8PA 4QU7A 2I2YA 2DNGA 2RQCA 3CPWR 4W92B 2DGXA 2XS5A 3G96A 2RVJA 3MI7X 3NS5A 5DDOC 2DGUA 1B7FA 1UP1A 1P27B 4ZKAA 2KU7A 1QM9A 2MZJA 1SJRA 3VAKA 4RU2A 2PEHA 4UY8T 3R27A 1YITS 3EX7B 3P49B 1L3KA 1WI6A 1YJWS 2D3OR 1FT8A 1YIJS 3P3DA 1H2TZ 2CQCA 5GAHU 2XS7A 1S79A 3IRWP 2MGZA 2CPIA 1OIAA 2DGQA 3MDFA 2KXHA 2QFJA 2KRRA 5D78A 2MY7A 2JWNA 2K3KA 1VQPS 1WWHA 2RRBA 2FY1A 3BS9A 2DNMA 1U1OA 2CQ0A 1VQLS 3V4MA 5FJ4A 2MKIA 1XN9A 3RW7A 1X4EA 2XNQA 2DHAA 2RS2A 2CPXA 5EN1A 1NJIT 3H2UB 1R8HA 2M88A 2E5IA 2DHGA 4WCEQ 2MZSA 2VOPA 3CTRA 1BY9A 2DNRA 3G9CA 1VQ8S 3Q2TC 2AYMA 2L08A 2U1AA 4OZ1A 3HHNB 2NLWA 2MY8A 3VAFA 1PO6A 1M5PC 1N8RT 1SXLA 3Q2SC 2E5JA 2K8GA 4P6QA 1M5VC 2QEXS 2M8HA 1VQ4S 3LPYA 1VC6A 4WKRA 3K0JA 2LA6A 4WFAQ 1JMTA 1WEZA 1YTYA 4BS2A 3CCVS 4YOEA 2N82B 2DIVA 2DNYA 1X4CA 3CXCR 1Q7YT 3CF5Q 1U1RA 1K73T 1KC8T 2MKKA 2GHPA 2M4MA 1X4FA 2YH0A 3CCSS 5GAGU 2CPDA 2MKJA 4CQ1A 2MJNA 4FXVA 1KOHA 1D8ZA 2N3OA 2DNNA 2JVOA 1UFWA 3UCGA 2ADBA 2CQ4A 3CMES 2MJUA 4QQBA 4CH0S 2ZJPQ 3US5A 2KXFA 3MXHP 3UWTA 5LXYA 1FNXH 2RRAA 2DNPA 2Q79A 3J7YU 2LKZA 1RKJA 3PIOQ 3B4DA 2JVRA 2DB1A 4WF9Q 2M0GB 2RT3A 2L41A 2DNZA 3CCRS 2XB2D 1W2BR 3NNCA 1FHTA 4UQTA 3SDEA 3UE2A 1HL6A 2CQ3A 3TYTA 1DHMA 3CCMS 1WF1A 3S7RA 2M9KA 4W90B 1VQ7S 3THTA 3G71S 3U1LA 3THPA 1X4BA 1WEXA 4CIOA 2LQ5A 1VQNS 5LSLA 1WF0A 1Q81T 4F02A 2MKCA 2MQQA 4PR6A 2LEAA 1WHXA 4TU9A 2KG0A 1VQ6S 3CCES 3CC2S 2X1FA 5JVHQ 1WHWA 4Y0FA 3VAMA 4Z2XA 2CQPA 3BO4A 1X0FA 2WBRA 5IM0B 2MSTA 1N52B 5CA5A 1FJCA 2DIUA 1WI8A 2AD9A 2DGOA 3TO8A 3R1HA 1DZ5A 3JB9k 2BOPA 2CPYA 3VAIA 2MPUA 3S6EA 2KYXA 2CPJA 1YHQS 3B4MA 5GVQA 3FEYB 4IUFA 3ZZZA 2KH9A 4FXWA 2RU3A 3SDEB 1U2FA 2CPZA 1K9MT 2OTJS 2FC8A 5DDPC 3CCLS 2LXUA 2G4BA 3CCUS 2DGVA 2JX2A 2CQ1A 2X1BA 5MLCV 5BJRA 1QVFR 1D9AA 2CQIA 2KT5A 1VQMS 3LQVA 1H2UX 2ZJQQ 2MB0B 1UW4A 2CQBA 1FXLA 1DBDA 2EK1A 4V19X 2KM8B 1M90T 1PGZA 2M2BA 3MUTP 2RS8A 3G4SS 1FJEB 5LJ5Y 3I55S 1CVJA 5CYJA 2UP1A 1WG4A 2HGMA 3U1MA 1HA1A 3VF0B 2KM8C 5IQQA 2FHOB 1S72S 4PRFA 2DNHA 2F3JA 1WELA 3ULHA 2F9JA 1AUDA 1IQTA 1P1TA 1X5PA 5HL7Q 2XNRA 2G1DA 5LSOA 1SJFA 3H2VE 2DGWA 2CJKA 2DO0A 2YWKA 2HYIB 3BO2A 2CPFA 2E44A 4EGLA 1URNA 2X1GA 1VQ5S 2MXYA 2ERRA 1G2EA 2M70A 2OJ3A 2VODA 2LYVA 5ITHA 4WFBQ 1A7GE 4YUDA 4YB1P 2N7CA 2LXIA 3P5TL 4C7QA 3EGZA 1UAWA 1JJ4A 1WG5A 2KG1A 3DXBA 3G8TA 2OSRA 1X4GA 1O0PA 3I56S 2M7SA 4PKDB 1RK8A 2HGNA 2XSFA 2KN4A 1U1LA 2LEBA 2F9DA 5H1SV 2FC9A 1X4AA 2HVZA 1VBYA 2O3DA 4QU6A 2YTCA 2MSSA 2KFYA 3L3CA 1SJQA 2HGLA 1N54B 1ZH5A 2ADCA 1U1NA 2DH9A 2DITA 1VC5A 1YJNS 1DRZA 2L9WA 3TP2A 1N88A 1FJ7A 2ZJRQ 2DH7A 2BZ2A 4A8XA 3MUVP 3UCZP 2DISA 3PIPQ 1JJHA 3FEXB 3J7ZT 1M5KC 3CC7S 4IOCQ 1U1PA 2J0SD 2FPHX 4QPTA 3R1LA 1HD0A 2JRSA 3BO3A 1U6FA 5HO4A 4WIIA 5LJ3Y 2NZ4A 3SXLA 2MKHA 1WG1A 2QA4S 4WFNQ 3VAHA 4LIRA 1ZZNA 3NNHA 1WEYA 1KQSR 4ERDA 2DNOA 3MURP 3N9UC 1YI2S 1SJ3P 3EGNA 1WF2A 2EVZA 3ZZYA 2LMIA 4C0OC 2CQHA 2J0QD 1H6KX 1X5SA 2VOOA 2CQ2A 1Q82T 3BEGB 5GADU 3HI9A 5DM7Q 2MQOA 3MUMP 2DNLA 2DHSA 2OIHA 5D77A 2PE8A 4IOAQ 2DH8A 4J5OA 1X4DA 1A9NB 2X1AA 4M5DB 4F26A 3P6YC 2RNEA 2D9PA 2J76E 1VC0A 2XS2A 2KRBA 1VBXA 3VAGA 2MQMA 3MOJB 2LECA 1OO0B 2A3JA 5DDRC 1YWXA 4Y00A 5CXTA 1VQKS 4U67Q 1F9FA 1SJ4P 1VQ9S 3VAJA 3DLLQ 5LXRA 3NNAA 2DHXA 2MZ1A 5JVGQ 1FO1A 2KXNB 2CQDA 2RQ4A 1WTBA 1M1KT 4LJMA 2AYGA 1JJ2R 2MQLA 1U1KA 2M52A 1HD1A 2DK2A 3CMAS
chains in the Genus database with same CATH superfamily
1KNZA 1L5UA 1MG7A 1ZA2B 2FGOA 2YKNB 3C8YA 4N8OA 4DV1J 4MH8A 2CPHA 1FTRA 1QUPA 4C0BA 3OTBA 1Y7PA 4HH1A 2YXLA 1KOOA 5E5NA 3RW6A 1JNZB 3R97A 1OWXA 1KVJA 1RJJA 4DR5F 1NO8A 5D6GA 3IWNC 2PGCA 3TOQA 2B0GA 1S6PA 3M1VA 4JI1J 2ZKTA 4FYWB 4OHWA 1GFWB 4C8ZA 4LFBF 1S99A 1GH8A 2DGSA 4NE9C 4RW9B 4IO9Q 2CVEA 3Q23A 2A2DA 2YKAA 5A8WB 1RWWB 2J0WA 1F2GA 4ZA1A 1RHMB 3TZYA 3N28A 2W2QP 1TL3A 2BA9A 4FVCA 3CJ2A 3OT9A 3Q24A 1VOMA 3NMRA 3PO4A 2Z2YB 4OX6A 1CJVA 2DXFA 2ZNYA 2DXDA 2Z2LA 4LF8J 3GYGA 3GZ7A 4QR2A 1UZDA 2A10A 1LOUA 2BJ9A 4MT1A 4DR5J 4PXDA 5H9EJ 4I68A 1VCTA 2HWIA 4LSZB 1ZETA 2BE2A 5KFQA 4ED6A 2YH1A 4Q0BB 4J9QA 1X4HA 1FFSB 2ROPA 4NOHA 1U1QA 4OX7A 5FD1A 5DETA 4ANEA 1R0AB 1FDAA 1R8CA 1VQYA 2NSCA 2YWHA 3HVTA 1WC5A 2KHCA 3MCMA 3M30B 1I6JA 5L1IA 4DN0A 4QYRA 3CULA 1BQMB 1T02A 4DR1J 3HXMA 1NXIA 2DO4A 4DFJA 5T14A 1JWWA 1NH8A 5IXUA 5E2QA 1EP4A 3BSCA 4NLSA 5D3GB 4DV5J 2XMTA 4IFYB 1YSJA 3W9IA 4LRBA 5GAEU 1OQ3A 1YJ9S 4ANCA 4C9DA 3MM5B 1YBAA 2HZCA 4NLXA 3H5XA 4JV5J 2C2KB 4UTGA 2HBYB 5HMYA 4IG0B 3CNQP 1H2VZ 3MEEB 4W4MA 1J5EJ 2CNOB 2EW9A 2XMUA 3V6HA 3D2WA 4UQGA 4M8LA 1C0UA 1REVB 2YNIA 2RQCA 1IUJA 2XSJA 4NMLA 1HHSA 3I5BA 3RJMB 4B9LA 4K2JA 3I82A 4LF9F 5LOQA 4PPZA 3BDPA 3SV3A 2VC0A 3G96A 1CJUA 3CD5A 4OJ1A 3WX4A 1NB7A 5IQ6A 1UEVA 4OL8A 1UMJA 3A4TA 4KGMA 4DLGA 4DSFA 4ZIWA 3QRQA 1QM9A 1FWLA 2CIMA 2ASYA 2Z57B 2ZOMA 4QIVA 4DR1F 4UOGA 3R27A 3GWCA 4FDFA 3V6KA 1DTTA 3BGUA 5H9EK 1YITS 4CO4A 2POKA 4QW8A 4ES3A 1L3KA 1WI6A 2DEIA 2BW7A 3U7JA 1U26A 2D74B 3T1YJ 2CQCA 2XS7A 3DMJA 1U8WA 1S79A 1NKCA 3NG8A 1OIAA 2DEJA 2YWGA 3GJTB 4KKOB 1RTJA 2H4WB 1TR0A 3LP2A 3BQ0A 3W2WA 1FRXA 2JWNA 2K3KA 1JXEA 2F4FA 2KB2A 2PMWA 4IOBA 3MPDA 3AD7C 4USHA 4CYUA 3TI0A 4LF5J 4M95A 2RQKA 4AL6A 4WU2A 2HRYA 4DFMA 3I0SB 3TAPA 2XCPA 4KC5A 4DF8A 4NRUA 3PZPA 5HVHA 1X4EA 1F3FA 3UO0A 2EKNA 3H5YA 5EN1A 1RE1B 3M2VA 3KG4A 5EHHA 2PIIA 4DR2J 3CTRA 5J2NA 1E6YB 1RBOB 2DNRA 1FKOB 2WOMB 3AJ1A 3L4BC 3DRSB 4HT5A 1SL0A 4OLPA 3ITHA 4FF1A 1S57A 3HHNB 1UVKA 1PO6A 1LW2B 3MM7A 1CJVB 5KFSA 3QZ7A 2JDJA 3I31A 4JOUA 1IKWA 1HPZB 2Z8QA 3Q2SC 4G1PA 4HI2A 4RNFA 2KZZA 3KMSA 3BBFA 4CO5A 2IPOB 2CJ9A 1LWCA 4NLPA 1VLOA 1U1NA 1VQ4S 2DR8A 3RZAA 2RSQA 2WK4A 4NCAA 1TL1B 3K0JA 2VV5A 4DR7J 4WKRA 1JMTA 1Q5VA 1WEZA 4ZVQB 2DRBA 3QJLA 3KK2A 1S4EA 2EI5A 4Y2MA 5IS2A 3HP6A 4DF4A 1NK9A 4LREA 2W2OP 3GV7B 5DGBA 4XDCA 3RU0A 2DIVA 4U96A 4X65J 4OYXA 4DV2J 4J9VA 1Q7YT 1S77D 1U1RA 3KHGA 6FDRA 4RBVA 2DRDA 2LQJA 1R8AA 2ZUGA 1SKRA 1IJFB 2V2VA 2HFZA 4KBIA 4WTYA 1P9QC 1YJRA 2KDOA 1RT5A 2YH0A 3CCSS 4C8KA 4N7TA 4XAKA 3C16A 1RT7B 4I6YA 4C2MA 2P6SA 1PBUA 1D8ZA 3M8SA 3GYXB 3QPIA 3BYRA 4HACA 1UPMB 1H74A 2DNNA 1CC8A 2HIYA 3MAQA 1VHFA 4J9PA 3L7OA 4FS2A 5ETLA 1Y3KA 2CQ4A 2H1YA 2PFDA 2AU0A 2FTRA 5J1NA 3CMES 3DLKA 3DLHA 2NCKL 1SV5B 1WD6A 1CULA 1F5CA 1HBUA 2WCXA 2J7KA 4JI0F 5KFJA 1IBLF 5A8RA 3US5A 2J6SA 5L9NA 4ZJOA 3JAMU 2QL5B 3FSYA 3UR0A 1M1GA 4NA3A 3HX9A 4P7TA 8RUCA 4IH7A 4LSLB 5KFFA 2E1RA 5SZTA 1AROP 2ZBRA 4ES2A 2LKZA 1IJEB 2F8EX 3B4DA 4I6AA 3H42A 2HNYB 2HK3A 2RHSB 1B0VA 4TXSA 1BQNB 1K1SA 3MMAA 4Q45A 2W8LA 4A8FA 2V69A 5KAKA 2L41A 1RGVA 3QIPA 3A8IA 2W8KA 4M5DA 1NDCA 3MMJA 3I0RB 3OJSA 3MECA 3R7NB 2QLWA 2AKWB 3F0NA 5KT5A 5AJ3F 2XY6A 1JJCB 3LAMA 1C4CA 4PQAA 3TYTA 1NK8A 1RTDA 4NLWA 3CJKB 1HBOB 4AL5A 2V67A 1L3VA 2W7PA 2D69A 3SQOP 2M9KA 2VPYB 1VQ7S 2UUAF 1HQEA 1TKZB 2G2ZA 3THPA 3U1LA 1BMQB 3TVKA 3UN3A 4K0KJ 4OZ5A 1WEXA 3P45B 2CJQA 1ZM9A 5DGAA 2LQ5A 2X3DA 3IA0A 1VQNS 1WF0A 4P71A 2DR6A 4B3MF 4Q7AA 3N79A 2LEAA 2VU5A 3I96A 1FK9B 2DY9A 3W8GA 2C2OB 2ACYA 2HAIA 1EKSA 1U0HB 2QC3A 2XMWA 3CJ5A 5C2GA 2X1FA 4Y0FA 5HP1A 3GJQB 3BO4A 4UZBA 4ZPTR 3UVJA 2WBRA 3S1TA 1PILA 3T9NA 1X0FA 4UOCA 3NY0A 3A8JA 1WDDA 4XK8C 1GEHA 4ZPVR 5KFTA 4EI2A 2DIUA 3GG0A 1T05B 1FRMA 3TO8A 4HVZA 3EE3A 1VJQA 3LALA 1LK7A 3R1HA 2HKEA 3R3TA 4ZN3A 4K4YA 1FK9A 1MN9A 5KOWA 2PI4A 4WXOA 1DZ5A 3VZIA 5K8NA 2V50A 3BSOA 2BOPA 2CPYA 3CB4A 4OYMA 2C28A 2ZC4A 2DVIA 2R7SA 1NPPA 4A4JA 4KB7A 1RACB 3DLGA 4LFCF 1AFIA 4PG7A 2Q6CA 3K2YA 2QRRA 3KHHA 2VQFJ 1EIYB 4RUAA 4JI7F 5B7WA 4UOFA 4DR3F 3MHYA 1K0VA 5KG0A 3GONA 4IFVB 3CO9A 1ZYQA 2IM2A 4ZIVA 5L1JA 1RAJA 3J7Z5 4GRSA 2KVQE 4FXWA 1Z4UA 3FKBA 2DBBA 3K17A 4ZDNA 1JLEA 2AIRB 2ZZNA 1VLYA 2OTJS 3M05A 5E3QA 4RNOA 3Q22A 4Y65A 5HMXA 5EDWA 2HHUA 1RYSA 3IG1B 2ZM6F 1XR6A 1WC3A 2BUNA 4RW8A 4BLGA 2G4BA 1S1TA 3J7AN 2HMIA 1TL7A 5KOXA 3QRPA 3NGDA 4F0KA 3I9ZA 4RPFA 4B17A 5BJRA 2JEIA 1SB6A 4C6AA 2Z30B 9ATCB 2V6AA 5J2MB 1YBUA 3IR7B 1H2UX 3FBEA 1EQ0A 2DYAA 3KG0A 2FGCA 3GSDA 2ZBQA 3FRZA 2ZJQQ 1RT6A 1SQGA 3OBIA 4L73A 1FXLA 3KMQA 2EK1A 1TKDA 4V19X 3EDRB 2KM8B 2P8IA 1XJWB 1PGZA 2JEFA 3KLEB 4WFZA 1FD8A 5CZXA 2ZHBA 3NRBA 3EICA 1CSJA 4R0JA 4QPXA 1S10A 3GU0A 4USKA 2ASLA 3B54A 1FJEB 3PRBA 3VCDA 3R8YA 1JLFA 4RW6B 2ZH1A 5KFIA 1HI8A 3FQKA 4CTAB 2E1PA 1CS4B 2UP1A 1RT5B 5KG1A 2HGMA 1LFPA 3BPDA 2CNLB 2HBZB 5J2PA 4ILRA 2BX6A 4E8UA 2HFOA 1VHIA 1S72S 1RWMB 2ABYA 4PRFA 1AFJA 2BR0A 2DNHA 4DV0J 1N5SA 1TV6B 2B4UA 4O3PA 1M1HA 3KNGA 3GIIA 3M8QB 3JTNA 3TA1A 2F9JA 4AT1B 2VA2A 4B9MA 4OHVA 1DRZA 2B6AA 1GX5A 3OR2B 5F3ZA 1XNQF 3R2CJ 5LSOA 3BZQA 4DR7F 1UL3A 1N34F 3Q8RB 3H5SA 1EHWA 2YNGB 3ENQA 1VI7A 4B08A 3ISND 4CH7A 2HFVA 4LBPA 4DX8H 4JV2A 4EGLA 4DHVA 1RABB 3OLBA 1URNA 2WRMA 3W60A 1X60A 4ED7A 1J27A 5J2QB 2LYVA 3QGPA 1CJKA 4CLPA 2VQFF 5CZVA 3ZFVA 1PYTA 4NLGA 4DPUA 2KFZA 4WE1A 2IJRA 3NEKA 1P6TA 1LWFA 2XZWA 5F8MA 2N7CA 1S97A 1XNRJ 3UW1A 1SI9A 3AD9C 3ITHB 2F4VJ 3EZOA 3LGHA 4CT9A 1PAEX 4MFBA 3V6JA 2AP6A 2R7OA 3PG9A 3BPSP 5AJ3J 3KDNA 3QO9B 2WONA 4ZVFA 3DYAA 1JJ4A 1WG5A 4LF4F 4ZVRB 1VDHA 1FNOA 1FCAA 3AB2B 3BKTA 3CGIA 4B9UA 4DSJA 4EEYA 4B9TA 4TQSA 3I56S 3QFHA 1OS5A 3M8RA 1FEHA 1R0CB 1RK8A 1KWMA 3Q8QB 5LMUF 2KN4A 3PW0A 4YB7A 4O3OA 2BRLA 5EWGA 4NCBA 1RTIA 3AB4B 2VF3A 5H1SV 2R8JA 4B3MJ 3AOCA 1LW0A 2BYCA 1BWVA 1Q5YA 2V2ZA 2OI2A 4ICLB 4KHRA 4ZPWR 3QWPA 4F2RA 5HJXA 2AF6A 1RAIB 2RKIA 4LVNP 2JJ4D 2XEXA 4V1Ak 3ZTPA 3L3CA 2YKMA 2HVEA 1R43A 1LFWA 3DU6A 4WE1B 1N54B 1Q8KA 5CYMA 2DH9A 1VC5A 1V3ZA 2LDIA 1KQFB 2QJ3A 3LW5C 4OHZA 4I4BA 2IMOA 4RR5A 3TP2A 3TZWA 3I5AA 1N88A 1DTTB 1I3OB 4GVBA 2BZ2A 2ZJRQ 4I67A 1FJ7A 5FLXU 1FX4A 1T9VA 2BJEA 4UUXA 1LWEA 3UCZP 4Q8FA 2ZZMA 1JJHA 1M5KC 2O5DA 3HULA 1V5VA 3GYNA 2J0SD 1NH7A 5H9FK 5KFGA 1HLWA 3O44A 3R1LA 1YRUA 2N4DA 2ASDA 1Q1KA 2R9LA 2XYHB 1U6FA 3OR1B 4PG4A 3GCXP 4ZP8A 3BH7B 2WTFA 3MR5A 4FBTA 4CI0B 4X4PA 2XSJB 1RHQB 1U02A 3SXLA 4JV5F 2NZ4A 5IT9U 3MMCB 1C0UB 2YNIB 3SYZA 2UXDJ 1BC6A 3FSXA 3TEHB 4LT6A 3SQGA 2CADA 3C3LA 3NNHA 4JYAF 1X7VA 3MURP 1AT1B 1GNKA 2V9KA 3QT8A 4RW6A 1JLFB 4CLUA 5JJBA 5I3UB 3J80U 4DLEA 4ZS6A 2VC1A 4X64J 1YI2S 1ULRA 3DOMB 1BE4A 5AXLA 4DV3F 2EVZA 4NLVA 2ZDOA 3ZZYA 5D3GA 4RBUA 1YDLA 3AJ2A 4C0OC 2CQHA 1JLAA 1EP4B 3OUYA 1UWBB 4RW4B 1T03A 5E7OB 4ECSA 3GPAA 3MPUB 2VOOA 2GGPB 3P8BB 1RT6B 4QJVA 4RNHA 4UUWA 1EETA 2OPPB 2MQOA 2HQFA 4O0NA 1RQ0A 1R7IA 3TAQA 1R0AA 2FVPA 1R89A 4F4ZA 4B02A 3H90A 4EK2A 2R2UA 2PE8A 4I2PB 4NI2B 1TL7B 2C3OA 2Q6BA 5KFKA 4Q0BA 4OJHA 1KKHA 4R0EA 4RO0A 2IBOA 4ZPAA 4L72B 5DJBA 1RCXB 1WSRA 2FZKB 3D0HE 3ILLA 4A8MP 3GMGA 4CO2A 3LPEA 5DQIA 2B9EA 2D9PA 2J76E 4FYVB 4JI4F 1Y5LB 2BW2A 5IC6B 1GT8A 1N0UA 1RHUB 2XS2A 3NKYA 4Z37A 2MQMA 4IRCA 1UPPA 1SKWA 1UVNA 3IAS9 4OFZA 3O1LA 2LECA 1VQLS 4LFBJ 2CDRB 1OO0B 1NPKA 4UY85 2B9XA 4QZVB 2JLGA 2MLZA 4A8SA 1ZS6A 3ILJA 4LFAJ 5CXTA 3KLHB 2MQ8A 2D1CA 2YX1A 3ADAC 8AT1B 3T1YF 4PWUA 1NEEA 1GX6A 2IM3A 3DHWC 2FLPA 2UUBF 1FERA 4K0KF 3OFGA 3KNAA 5A0YA 3OV7A 3A3NB 2QX0A 2XMJA 5HK4A 5AXMA 2KXNB 2VBZA 1FF2A 2JNJA 2YWWA 2P9CA 1WTBA 4PQUA 4JI4J 2VFTA 4XO0A 1RB0A 3AOAA 4ZVSB 4WTOB 2AYGA 1DQ9A 2NREA 3GLJA 2YKNA 3R9LA 2MQLA 4OYBA 2APOA 1U1KA 4NLRA 2FLNA 4NXNF 1FESA 2IY5B 3LTOA 2GA7A 2RJZA 5EX0A 4CT8A 4TU7A 2H48B 1X5OA 2ZBIA 3RBZA 3NBPB 3UVJB 4X4QA 1IR1A 3VGVA 3UR3C 3KK3A 2Y1JA 2C22A 3QWUA 5IT9Y 2NXNA 4K59A 4LRDA 3S01A 4GKKF 1HQ2A 4B9NA 2CQGA 2D3UA 2PSZA 3AAWB 3W9JA 2FHMA 1PC5A 4F8RA 1RT1B 1CJTA 1TKXA 4NZ0A 1NLKL 1PC4A 2P5VA 4DPWA 3T5HA 3NCPA 1NSKL 1APSA 1V3RA 2VFSA 1DTQB 2XGPA 3VALA 2MMYA 3DGVA 4IDKA 2FVQA 3AA8A 2VG7B 1X5TA 1XERA 4IYQA 4ZCLA 1LWEB 1ZZFA 4X84A 1E6VA 3R7BB 3TVYA 4DZDA 3H2LA 4F25A 4RZRA 3IN5A 3JYTA 3K8WA 1FE4A 1TKZA 4ZMMA 1MWZA 1HI1A 1NJZA 2O66A 2Y0SD 3RRGA 1VRTA 1H98A 4M5MA 1OSDA 3JAMY 1TFYA 4IO1A 1WHYA 1KD1T 1Y3JA 2OGUA 2BM0A 1ELOA 3IXQA 2F63A 2CWKA 2LU2A 3MECB 1HNIA 1CQNA 2EG1A 2IRYA 3JSMB 2C42A 3GIJA 4ZJLA 4TU8A 2G0CA 2QA1A 1RTIB 3QIPB 4IR9A 2UXCJ 5GMKa 3IGNA 4F67A 2HNZB 1JLGB 3LWMA 1UWAA 3HO1A 2WVCA 1YG0A 1W26A 2FQQB 2RUGA 3M2UB 4JI6F 3CUNA 4DV6J 1Y5NB 4PWDB 4U9RA 2EK6A 3TA0A 2R7VA 1AB8A 3G8SA 2RQMA 3ET6A 2QL7B 1GMWD 2RB7A 3MD3A 3SCJE 2PO4A 1YRTA 5G4DA 5KFOA 2B51A 2BBEA 5GAGI 4R5PA 5D15A 3NS6A 3N6NA 4C8OA 3CD6S 3HJFA 2HNDB 3MMBB 4J91A 1NSAA 4MFBB 1QSYA 4M94A 5KT3A 2IJNA 3PYFA 4LUBA 5CYQB 5F0WA 2P2CB 1GMUA 1WHVA 1F60B 4O0IA 2PA8D 2VDIA 1W2IA 2FDNA 2J8SA 3M2RA 5IFMA 2MQPA 2Y9HA 4AQYF 2E5HA 2MGZB 4A47A 1ICEB 2BRKA 3AH6A 1EZZB 4DS4A 2Z4PA 1U1MA 2N3LA 2UXDF 4BCAA 2R7RA 1FRLA 3NOGA 5CQGA 2KVIA 4L3KA 4GKJJ 2A6OA 2XI2A 1MN7A 4KO0B 3ZTRA 2HAFA 1DURA 4KY3A 3E8OA 3HSGA 3IR6B 2C2ZB 1GTEA 2RVJA 3E51A 5B0DA 2YQ3A 4FF2A 3FK4A 3E01A 4KRWA 3O2IA 2YBVA 3AXKA 3HSZA 3M8QA 4P2SA 4LF8F 3MAAB 3CJ0A 1R0BG 3OQ2A 3KJVA 3M9NB 1D1UA 5DLGA 3WIUA 4TYBA 4ZHRA 2KU7A 3OL6A 4ED8A 2F8HA 3CJ3A 5KFEA 4CLLA 2V4QA 4RU2A 3VZHA 4LQ3A 5KFHA 2HS4A 3B78A 2FJEB 1JNRB 3OFFA 4OV1A 1JQGA 1OY6A 1LNQA 1NBEB 4CNYA 1QJHA 1YJWS 5KFAA 5MAOA 4NPOA 1YIJS 3IBCB 4OYZA 4KPCA 1O51A 5BXIA 2XLIA 2MGZA 5DZ7A 3KYLA 1D9FA 2BACA 2ZH7A 2BV3A 2WB1D 3ZC4A 2PFFB 1FVSA 4RU9A 4N8NA 2A1BA 2ZVSA 4P7VA 4P52A 1OMSA 1U1OA 5F8HA 3F56A 3CDEA 2MKIA 1QE1B 1AXQA 1XN9A 4QW9A 2R7TA 2H51B 1K44A 2EC2A 1XQIA 3WQPA 3PHTA 2W1BA 3CJ8A 2RS2A 1NK6A 4O3SA 2OO4A 3QYYA 4AE5A 4CNZA 1TUVA 4YB5A 3MR3A 1NZAA 4UF4A 3D6MB 1R8HA 4DUYF 4ZCMA 4JI5J 2E9RX 1U0SA 1XMOJ 3D4JA 1HMVB 3BGRB 4M5JA 4RW8B 1S48A 3T1AA 3RAMA 1NM2A 4LBIA 3Q2TC 4ZVEA 4LFCJ 2L08A 3W9HA 4AL7A 1O8BA 1S7IA 3JQKA 3OXFA 1HWUA 1RTJB 4HHUA 5LL6d 2UVWA 2K8GA 2K7KA 3KJQB 1AW0A 2WBMA 1HNVA 2BQUA 4MIBA 2HIQA 1H3DA 2LVWA 2M8HA 3DMJB 2QA2A 3HLUA 1VRTB 5B0CA 5KG5A 1XEZA 2JZ5A 4GO5X 4X62F 1EQMA 1ZTWA 1H72C 1VC6A 1NHVA 5B09A 3UD4P 2EC0A 1RT2A 4C3LA 1S1VB 2VKRA 4BS2A 2XLKA 2OP5A 3DM2B 3FBFA 3DNCA 1XNQJ 4DDFA 4DX7A 3OL9A 2R2TA 3K5NA 1A6LA 1CJTB 1UJ5A 4F3OA 3CF5Q 5ETQA 1NK4A 1U8SA 1Y0HA 1B3TA 3IRXA 1RLCL 2XHWA 2XCAA 1B70B 3KK3B 3H98A 1KC8T 4K4VA 3B8HA 3J81j 1N32J 1KLMB 3KLFB 1HYSA 1X4FA 2YQ0A 2YPZA 5GAGU 4IG3A 5AE2A 1RWKB 2NS1B 2GCFA 2MJNA 4FXVA 3VQSA 2XQCA 4F4KA 3DCAA 4K8RA 1RAAB 4P73A 4MJKA 2OFHX 3IR5B 1RBLA 2KT2A 4MIAA 2Z58B 5DO2A 4YFUA 3HFVA 3ZZRA 5A0YB 4CLKA 4GMKA 3HHDA 3UN5A 3M6WA 4H4OA 3G86A 5A76A 3HHLD 4CH0S 3PW7A 3PJ9A 2WAQD 5C5JA 3FCVA 2J9DE 2AQ4A 4ILMA 4USJC 2QSFA 4DU7A 2KXFA 1HQEB 2FHKA 4IH6A 5HANA 2CJXB 1YBTA 1FNXH 3MXHP 1CG2A 3CDBA 3HHKA 3HVTB 4K7QA 1RISA 2DNPA 1U4BA 2VZ9A 4C48A 4E0DA 4DX5A 1Y10A 4OJ3A 3CJKA 3DHXA 4ITSA 1H7XA 3QBCA 5T7LB 2J6UA 3T1HF 1N6QB 1J2VA 1SC6A 1KQGB 1YJ7A 1RDRA 2BE2B 1P8GA 2M0GB 1QDUB 2RDIA 3AODA 1U6ZA 3LH2S 2IAJA 1XR7A 2HRTA 3MPWA 4LQ9A 2XI3A 1S12A 1URRA 3M8YA 4Q43A 2V0NA 5D0GA 2AJQA 2D41A 2HEKA 2NR0A 4WZQA 3NNCA 2RDJA 5HAOA 1FHTA 4UQTA 4X4SA 3OTOJ 3TJ9A 4P75A 5ETMA 2HNYA 4HR2A 2A6MA 2FYXA 1B0TA 1NMEB 1DHMA 1S7HA 3PDNA 3OXGA 4NEZA 2IHR1 1SH3A 5ADZA 5B0AA 4KFBB 3FCWA 4YHHJ 3OJUA 2H4YB 3FJ2A 2VKZG 2EFGA 4OYOA 4DBQA 1X31C 2RRAA 2RHQB 2GGPA 1WKLA 2WZ1A 2IFXA 2LXFA 4NCGB 4KV8B 4PG5A 1SV5A 3ETMA 3O8WA 4CIOA 1NKBA 5A6WA 3OUYB 1PYSB 2PN6A 4JV1A 3DLKB 1S6PB 2ACMA 3M1VB 4QIFA 2MQQA 4DFKA 1XK8A 5KFYA 4X66J 1WHXA 2CJBA 4U8YA 4TU9A 3DOMA 5KT2A 3D0IE 4FKYA 2R3VA 4ID5A 2GJ2A 4OX9F 1VQ6S 4HHJA 4HACB 4LR9A 3HT3A 3BF4A 1WHWA 3Q0AA 2F40A 3VAMA 4LF7F 1AUSL 5E3CA 5EX3A 1SC4B 5F0UA 4WP8A 3OSNA 2MSTA 1N52B 2H3EB 3DOLB 3R6GB 4X64F 2L48A 1SVDA 1WI8A 4FPRA 4GVLA 1SPBP 3VVTA 4Q5VA 2AD9A 1S4FA 1HNZJ 4JI3F 4WK1A 1UVIA 3P49B 2QYCA 2XYGB 3FMBA 1TVRB 2AW0A 1UVLA 3N0VA 5GADI 4DV7F 3JB9k 1MMLA 4OYIA 2R7WA 4LSNA 3NCRA 2W9BA 4ECTA 2QL9B 1QSSA 4OZJA 4DG1B 1TL4A 3KK2B 2KYXA 1JLBA 4ER8A 4DPXA 1UFLA 1VRUB 4GVBB 4I6WA 1TL1A 2DPJA 3R6LB 3GJRB 3SFGA 3CCTA 1QTMA 3BR8A 1NB2A 1H38A 4TYAA 2B8QA 2G0IA 1JKHA 4IR1A 3IC1A 5HN0A 5HATA 2KH9A 4K4UA 4UT4A 4H4MB 4F0HA 1U2FA 1K9MT 4DPOA 3HDSA 4YY3J 4K4WA 4ZVPB 1KLNA 2XYPB 2E29A 1X8DA 1BUXA 4FN5A 3TUJC 5DQHA 5DDPC 3BQ1A 3CCLS 2HHVA 3MR7A 1UEKA 3LF0A 3HVRA 4I56A 4KHMA 5KG7A 2DR5A 3CVKA 4DL6A 2JX2A 2G2YA 3Q8PB 2H54B 3PJXA 3VTIA 2KKHA 2X1BA 4N77A 1QTNB 2GIQA 5T7LA 4CO0A 4ED0A 2WHOA 3PX4A 2GAHC 1IBKF 1QAIA 1QVFR 2KT5A 3OD2A 2IM0A 3UD5A 1WJ9A 1ACMB 1IWGA 2ZHAA 1GMVA 3N5FA 4YR3A 1S0NA 3DDIA 2FB0A 1C0TB 4MTPA 2MB0B 1EX8A 3I0SA 1UW4A 4ECVA 4C97A 1T9WA 3A8EA 1KHWA 2M2BA 2QYGA 2VD3A 3FFIA 3JQMA 3L95X 5K20B 3K57A 1OYEA 4ECZA 5HROB 4HKQA 2NXUA 4X4UA 4B9SA 2RS8A 5KG3A 3HZGA 3V4IA 1UKUA 2HHWA 3TJ8A 3M6VA 2QE5A 1CJKB 1F0XA 1FXDA 4M5NA 4CDIA 1CVJA 4IG3B 3SSQA 2ZITA 1WG4A 3LA0A 4RBTA 3W62A 5DQGA 3VF0B 4LIWA 1HHQA 1EJ7L 3D0GE 3MCOA 3L9ZA 4EYHB 1N5YA 4USWA 2XBPA 3IRXB 2VH7A 1FTCA 1SCJB 4JI8J 3HD2A 4NL5A 1M0SA 4CLWA 3C2PA 2AHOB 2JFDA 1YVFA 1WELA 2F3JA 1M5SA 2G0JA 2AZ1A 1MU2B 1SQFA 1P1TA 3BM7A 4JBCA 2Q1LA 4MKBA 5DZ6A 5HL7Q 5CD4A 1ZM2A 3CJSA 1SJFA 2EFOA 3H2VE 4B3TF 2DGWA 5CH7B 2HYIB 5K9FA 3DM2A 3J81Y 3I5CA 4ZP9A 3BO2A 1U2CA 2DXEA 1VGYA 1FDBA 1FDDA 1EAYC 1RT2B 1VISA 2AJ0A 2PT0A 3MEGA 4WBFA 1QY7A 4PG8A 2MXYA 4PUOB 3IBWA 3PTWA 5D0HA 4ECWA 2IVYA 2OJ3A 4IG0A 3W61A 1T7PA 4PABA 4CTAA 2PI5A 3NMAA 4ZVHA 1A7GE 2A18A 4YB1P 3O3LA 3MEKA 4A46A 2I5JB 3KTQA 4CP5A 2HHQA 3KLEA 4DCOB 2CWXA 1HKAA 3LP1B 1L3SA 2WSEC 2IDEA 1BQMA 1Q8LA 2W4DA 3TW0A 1T95A 3H7HB 2KG1A 4OMFG 3G8TA 3O5TB 1RU2A 1CC7A 1NPRA 3D67A 4Y28C 3T6BA 4A8YA 3NP5A 1Q4RA 1FI4A 4HTIA 2FIUA 2M7SA 1VRQC 3FVYA 4DI6A 1IBKJ 3W66A 2GQQA 4F04B 1V5IB 3PEHA 2LEBA 4ED2A 3LP1A 3MPYA 2F9DA 4DXLA 4YR2A 4EBEA 2C2EA 1HR0F 3DLBA 1R8BA 2AJ1A 4X65F 3HKZD 1X4AA 4O4GA 3DRXA 2Y8YA 5C7PA 1JLEB 3NWRA 2UZAA 3FNNA 2HRUA 1Y00A 3PCOB 4ZPDA 5ETNA 3UN2A 2XO6A 2KFYA 2KHDA 1UVJA 1SJQA 2AJ4A 1I51B 2HGLA 1Y11A 2AT1B 5ETKA 4ECQA 1HNXJ 1YJNS 2VJVA 2ZH2A 2IA6A 2RDDA 3EGVA 1IR0A 4HDHA 4KTQA 4PUOA 2OD6A 4EO8A 1HQUA 1TFWA 4YP3A 4A8XA 5ETOA 2DISA 5IV3A 2KJVA 3DLGB 3PIPQ 3GQCA 2OH2A 4DL3A 1DQ8A 3G87A 2RRNA 4WJBA 2KYZA 4I7FB 1OQ6A 3G82B 2PDAA 3PYEA 4DR3J 5KFNA 2WSCC 4EO6A 2XGQA 4QPTA 2V4JA 4DUTA 4TNOA 1HD0A 3DRRB 3BO3A 1HNWF 1BLUA 4MK7A 2HFNA 5HO4A 4WIIA 2V8HA 3SEOA 1GXUA 1H7WA 1MNEA 2LU1A 1WG1A 1T3OA 3VAHA 2OMLA 2VG5B 1SJ1A 3K7RA 2UV8G 2IMWP 5F8NA 3W64A 4ZP7A 1KQSR 2F1FA 1S6OA 4BHQA 2DNOA 3I6PA 2J6TA 2F7VA 4M5KA 5KFXA 4DV5F 3C6TA 2J7WA 3EGNA 4KE5A 4ALZA 3SCIE 1T94A 3QJJA 1S59A 4C8NA 2P9GA 3I4HX 1S6QA 2E7XA 1RT3B 3FCHA 4YDDB 1FJGJ 3W3SA 3NS7B 3BEGB 2H65B 5GADU 5DM7Q 3QAEA 4Y2AA 3LP0B 1KONA 1YLXA 3MUMP 3ISZA 2FJBB 1FX2A 4RW7A 2GMJA 4WP9A 4RUBA 1A0OB 1RA7A 4O44A 2ZH3A 2DHSA 2AJ2A 4Q44A 2EFQA 2XWXA 2OD4A 4NLQA 1Q0NA 1YZ6A 4G3IA 4I1TA 3GTYX 2QMUB 2ZEJA 5KG2A 5KFCA 4XPEA 2FJXA 1JLGA 3CE8A 4M5DB 2V8DA 1HNZF 4F26A 4DR2F 2W25A 4FXDA 4RKUC 3ISNC 3K58A 5JMNA 1UEUA 2JFKA 2KRBA 4H4MA 3PNIA 4ZJQA 5CABA 3H4BA 5FDLB 4YR0A 1VBXA 5KFWA 4HHHA 2JC0A 3CDAA 4DJBA 4OI1A 3V81B 4FF4A 4DR4J 1NDPA 3LP0A 2EPIA 2G9OA 2YNHB 4PYAA 2A3JA 1BD6A 1IBCB 1S5ZA 2J7UA 3B6BA 3R5DA 4CLYA 3AT1B 1FA0A 2FVCA 3AXMA 4HH0A 1VQKS 2GHVC 2W2PP 1U24A 1JLBB 2QT7A 1B0PA 2W9CA 5LXRA 3T3FA 4GKKJ 4X4NA 4F4AA 2HFUA 2VG7A 1S0MA 4RX6A 2MZ1A 1EB0A 3RBXA 5LT5A 2V2KA 1QSLA 1SC1B 1TKXB 2CQDA 2VFRA 2E9TA 4U7UK 1UA0A 3KHLA 2XMMA 4DU8A 4FYDA 4M5GA 1JX4A 2ZH6A 3Q8UA 5H9FJ 2E1CA 1G1XA 5KFZA 4CO3A 1IR2A 4D3HA 1JJ2R 3DOLA 4KHPF 1NSPA 2OPSB 3MF5A 5IM0A 1FVQA 3PX0A 2ZD1A 2VBWA 1M5OC 4Y34A 1C1CA 4URSA 4DMZA 2UVUA 2KFNA 5KFPA 4DV7J 4WU3A 1P1LA 3H5UA 3DRRA 4IH5A 4NLOA 1K47A 2HQIA 2QIFA 4KH0B 5F8GA 2DNQA 3UPFA 5JXSA 5M2UA 1NZ8A 2VONA 3HM9A 5M2RA 4QWAA 1V6HA 2F5GA 2GO9A 1ZPWX 2L9NA 4OI3A 3ETOA 3TAMB 4ATNA 4DZ6A 2DPIA 3TQEA 3CCZA 4KJIA 4NCGA 3DKDA 4LF6F 1RWXB 2KI2A 5C42A 3TUZC 3BQ2A 2HG4A 2K1RB 1JXLA 4G1IA 3CC4S 3T5LA 4C4WA 1JXVA 3DXSX 4NYOA 3OHAA 2XY7A 4EBCA 4F4YA 4QWDA 4FS1A 1QAYA 5E0OA 5GMDA 4PG6A 2CG8A 3CJTA 3D28A 3D7SB 2C1EB 3EXCX 4P72A 4LF6J 1LW2A 1G7CB 4J9OA 3RB4A 5C24A 1U25A 2W2MP 2QLXA 2HWHA 2RAQA 2XTJP 4CH1A 2DGTA 4I69A 1FWPA 4JV0A 4X4TA 1SKSA 1F5BA 4HEA9 1MMDA 5K5MA 3OTDA 3ZZOA 5J2NB 5IWAJ 1N32F 5DM6Q 4DR6F 5F3TA 2C3PA 1N6QA 1QVGR 1LV5A 2B56A 2AWZA 2LA4A 3ENVA 5EGYA 2AEJA 2I38A 1VQOS 2ZH9A 2BANB 4LBHA 3HHLA 4DUYJ 1VQMS 1LWXA 1NU4A 3NGUA 2UUAJ 2K7JA 2WVDA 4O23A 3SCLE 1FJGF 3AA9A 2OSQA 1YJTA 2RUSA 2IYGA 2HURA 5LM7E 3IAM9 4IRDA 2MZQA 2E5LJ 1UWBA 3UD3P 2DCUB 2HPUA 3ZZUA 2VFUA 4OZNA 4J7CA 3WX8A 3KG1A 4DL7A 3SMZA 3CWJA 1K8AT 2RILA 4TLQA 2VG6B 3MD1A 1IVZA 1H73A 6FD1A 5CD4H 2QLFB 3HHLC 3UNGC 4L76A 3EPGA 4X66F 3G6ES 1HBMB 3BDEA 4USTA 1F9HA 5DDQC 1YRXA 3A13A 4ZN1A 2MZRA 4DQRA 2CXEA 1R8PA 3W5ZA 2I2YA 1S1XA 2HHPA 3BGLA 3DRPB 3CPWR 5AXNA 4C3MA 1WC1A 2HS0A 2VPZB 1XBWA 3F44A 3NAHA 4KSEB 4MYUA 2DGXA 4N47A 5J1EB 3A12A 4W92B 2XS5A 2OEMA 3MI7X 3NS5A 2VHGA 1WOOA 2DGUA 3CW2C 3QZ8A 3T41A 2CNNB 2YQ1A 4DPTA 1UP1A 1B7FA 3OHBA 1RAOA 5J1EA 1YX2A 5A6PA 3VAKA 1SJRA 2QLJB 3RYLA 5LSRA 3BKFA 1OYDA 2GJIA 2PA3A 2PEHA 2UVRA 1PSDA 3EX7B 2ZWOA 2XM3A 1HW8A 2JHEA 1MW7A 1OY8A 3VVUA 4NEYA 2D3OR 1FT8A 4F36A 2OEKA 2N7YA 4TLRA 5CYMB 3J7YI 3THVA 4OYAA 2CPIA 3N4WA 3MDFA 5A2QY 3RRHA 1XMQJ 2KRRA 4ECUA 4IFYA 2RF2A 4AXJA 2ATLA 1HR0J 1KSPA 4PPDA 2NUUG 1WWHA 2DR7A 1LW0B 2DNMA 2CQ0A 2EWHA 4ICLA 3K59A 2ZHOA 3BGFA 3M7VA 5L1KA 4KGZB 4FZVA 2CAJA 1FEEA 5G0RB 5FJ4A 1FXRA 4N76A 2RD5C 2WVFA 1HMVA 3BGRA 4HLBA 4OYWA 3RW7A 1D3WA 2ZH8A 4F4WA 3IM8A 2XNQA 4R25A 3OXLA 2J9CA 3RAXA 1BHNA 2BANA 2CPXA 4HI1A 3KLVA 2XO7A 2QA4G 1NJIT 5KG6A 3H2UB 3PFEA 1RTZA 2E5IA 3M8ZA 4WCEQ 2LQ8A 2R8HA 1Q78A 4DWIA 4FF3A 5B0GA 1BY9A 3JS9A 4K4SA 5CCLA 1TZ0A 1VQ8S 2KL8A 2OKQA 3M4XA 2BXJA 2U1AA 1Q8BA 5IOLA 4XPCA 2ILZA 4X2BA 1AUDA 3BH6B 2HBRB 3KJFB 2MY8A 3VAFA 2JH3A 1G6BA 1M5PC 3KHRA 1RHKB 5IWAF 1KDNA 2E5JA 2DY1A 1DJ0A 1TKTA 1N5VA 2AJFE 2GQ2A 2YWEA 4UZCA 4DFPA 2QEXS 3RR8A 1JKHB 1TL3B 2AV5A 2IC3A 3OTEA 5L38A 1RKIA 2J0XA 2ILYA 2Y0BB 4LRAA 4HT7A 5J2QA 3TZZA 1S9GA 3ZZ0A 3R5JB 4QCLA 4JYAJ 1R6VA 4KH1B 4J9LA 2GQCA 4K5RA 4LSNB 3U02A 2W9BB 2B5JA 3EVMA 1F9EB 4YOEA 1T9TA 4I0WA 1C4AA 4Q8EA 2E1AA 1TVRA 3CXCR 1GXLA 4TQRA 2PC6A 1TV6A 4WWSA 4IRKA 1KFDA 1LK5A 4Y2IA 2ZD1B 3GB0A 4E98A 4DV4J 3BYPA 2MKKA 2GHPA 2M4MA 3R2DJ 3OTCA 2IVFB 3GV8B 3D3BJ 3ZNUA 4K4ZA 2IDLA 3NL0A 5KFDA 4P2XA 2C2DA 1CS4A 1LQ9A 2CPDA 2MKJA 3JSYA 3GIMA 3IS9B 5E3PA 3TUIC 4Y3CA 1KOHA 3I9V9 3EVOA 1MLAA 5HLFA 1REGX 3W1YC 2N3OA 3FUYA 3IWXA 1UFWA 4NA1A 3UCGA 1YGYA 4KR0B 4FYXB 4GC6A 1Q95G 2B43A 2J5AA 2FJVA 2HHXA 2V8VA 2XG8A 2ZNZA 4KV8A 2UUTA 1FNMA 2BJ1A 2BEFA 3Q8VA 1MMNA 3UWTA 1SQEA 2CG4A 2OPRA 2ASJA 3GJSB 2Q79A 3ET6B 4QR1A 1IBLJ 2PD1A 1YQHA 2ATCB 2B4OA 3MM8B 4YS2A 5FDLA 1GTHA 3M2UA 3R5CA 2RE1A 2DB1A 5KTQA 2WW8A 3H40A 3MFHA 4AUKA 2E7WA 4YY3F 5DG9A 3G6VA 4J9RA 2BQRA 5KG4A 2ZH4A 3UDLA 1GK8A 3CCRS 4C98A 1HNIB 3HJVA 2XC9A 1XTZA 3JSMA 1W2BR 3SDEA 3OL8A 3LWLA 4OX9J 5I3QA 3N01A 3CCMS 2CYYA 4U7CA 1N56A 1UW9A 4RW7B 1QUVA 4ZPBA 1VBKA 4PXBA 4ZCIA 4W90B 2C3UA 3MM6B 3WHIA 1TUWA 4O3NA 2EFNA 1RT3A 3HFZB 1S6QB 4QIWD 2K2PA 2EKYA 2XMVA 3J81U 3QT6A 5HBMA 5B0BA 5LSLA 3PR5B 3UDEA 2YVSA 1Q81T 2UXCF 1WORA 2MHEA 3WIVA 4F02A 4IDKB 2MKCA 2P6TA 3JSRA 4G65A 4QOTA 4PR6A 1VK3A 1S9EA 4CZCA 4B3SJ 2OLWA 4YMEA 2GVDB 5A2QU 4K2XA 3CCES 3CC2S 2VASA 3QATA 3VR1A 4J9MA 3BBBA 3NCQA 4R8UB 1TQLA 2XWYA 4Z2XA 2J9EA 3RRKA 1T05A 3MM9A 4S0MA 2QLBB 1HYSB 4C0HA 4BWMA 3DDKA 4ELTA 1FJCA 3DLEA 3M9MB 3EZ5A 1HWKA 1S1UA 5HP1B 2DGOA 1I5OB 3NGKA 1S6UA 3CD0A 3OFEA 3POTB 4OI2A 4WXWA 1U0HA 4LRFA 4OQJA 5F9LA 2D3ZA 1H0HB 3Q86A 4C8YA 1TK5A 2HHHJ 2GVDA 1YJVA 2CVIA 5AT1B 4HTJA 2MLXA 2KZMA 4NLDA 3WC0A 4ZLNA 2EEYA 4I7FA 4RUCA 3Q83A 3QJPA 1KS2A 4L75A 1D09B 4G6VB 5K8OA 2UUCJ 2CPJA 4G1QA 5E33A 1WKKA 1HQUB 2MTLA 4NXNJ 3MZIA 4U6PA 1Y5IB 3AHPA 4OIXA 3OPKA 4U8VA 1SIWB 3P4UB 3B4MA 3BN4A 5GVQA 1L3UA 3FEYB 4IUFA 3CJRA 1NK0A 2AMCB 3H0PA 4NX9A 2MKYA 4LF5F 5D4NA 2RU3A 2R8KA 3KLGB 1T11A 3SDEB 5JUMA 4RLEA 2IM1A 5THWA 4JB8B 2YX7A 1HNXF 1N48A 2FC8A 3MWBA 1WNEA 3GSIA 3KUGA 1FWKA 1U09A 2LFVA 5K8PA 1IM4A 1AA1B 4I2PA 4TN2A 3CJ4A 5MLCV 3K5LA 1D8YA 1Y9OA 2GVZA 1JLQB 1O6XA 1D9AA 3N6LA 3L7UA 4CLZA 2R8GA 4LSLA 1FRHA 4USMA 1EETB 1XR5A 3UFCX 4QR0A 1NKEA 2CQBA 1GXTA 4ZITA 1DBDA 1Z2LA 2VQEF 4X62J 2GO8A 4ZPCA 1GQEA 3MUTP 1CLFA 4CRJA 3C14A 1VJWA 1DQAA 1WKJA 3PR4A 1NJWA 2CRLA 3V2UC 2R7XA 1YZ7A 2QMXA 5AXKA 1KBRA 1CBKA 3A3OB 3UQSA 4CO1A 3G4SS 4DV4F 3QFWA 1ROFA 3I55S 1FRJA 5D4PA 2ZOFA 1F1BB 1T8EA 5CYJA 3HCXA 3SQGB 3U1MA 1HA1A 2GIRA 3MEGB 2GAGC 3ZZPA 2V63A 1KQKA 2KM8C 1T9UA 1WSVA 3LAKA 5IQQA 4D3GA 3NGSA 3P96A 3I87A 1I94J 2HHSA 4ZHRB 2RU9A 4KYZA 2AZ3A 1Z2ZA 2GC8A 4H4KA 1IKVA 3M8PA 2AEFA 3ULHA 5J1PA 4YB6A 2KG0A 3ICLA 2XNRA 3KDOA 4TY8B 1VQSA 4DUZF 5CHCB 2BJ7A 2B5JB 1LEOA 3PW2A 2VFVA 2DO0A 2QFIA 4FNIA 2CPFA 3T6JA 2E44A 4YDXA 3SZ2A 4KO0A 1N5YB 1OSCA 2EBGA 2DRAA 1CEZA 2X1GA 3D9BA 2Q43A 2XZTB 2BJ3A 2DJWA 1G2EA 5GMEA 1HBNB 2IA0A 1WUUA 2OMOA 2YX4A 5DS7A 3VWSA 2VODA 3LUYA 1CQMA 4OHXA 4KQZA 1RBAA 5BYQA 5ITHA 1LWCB 2VBYA 1RTHA 1S1WB 2VUGA 4WFBQ 2B9WA 3M32B 4NXMF 4YUDA 1TKTB 2GS8A 3GR1A 4Q2LA 3D3CJ 2WSFC 4U7UD 4HDGA 5HROA 3MM7B 3V5RA 6AT1B 1VIOA 1TMMA 4EMDA 3MMBA 1X9MA 5FLXY 4PCQA 4R5PB 4EFAC 1E6YA 1C0TA 4YN3B 3VQTA 2GZOA 2ZE2A 4B3OB 4ECYA 2OSRA 2W7AA 2BVZA 3ZXWA 3IGVA 1X4GA 4IQXA 1O0PA 4A8WA 4PYDA 4FPIA 2BQ3A 1ZBTA 4B3OA 4PWDA 1RWPB 4GC7A 1X0PA 3DYAB 4DN9A 2WONB 2XSFA 4J9KA 3PKMA 2QTWA 4DEZA 4C3KA 1ZA1B 1DAXA 5C25B 1T3NA 1WC4A 2AGOA 5FIIA 4CYUB 1RLDA 2BJ8A 3VHQA 3EMTA 2HVZA 3LO3A 3LP2B 3W2WB 1KTVA 1TL5A 2RF2B 2YTCA 2UXBJ 2EG2A 2EXUA 2F65A 2MSSA 3JSBA 3M32A 4LF1A 4AFFA 3AJDA 1NK7A 1ZH5A 2ADCA 3T9ZA 2HZAA 1FRKA 2DITA 3QQCD 4FNHA 4WYWA 1FRIA 4JP8A 3TX8A 2L9WA 3WZ0A 3ZTQA 4RNMA 3G6XA 3ZNJ1 4FKXA 4EZ6A 4DL5A 2B3TB 2V34A 3QMQA 1E6VB 5KFRA 1IM6A 3TNVA 3MUVP 3FQLA 4P2MA 4ES1A 2F4VF 3TX0A 2XLJA 3FEXB 3GFYA 2VQEJ 4ELUA 5F8IA 1FFGB 3CC7S 1KFSA 4LF9J 5C2CA 4J9SA 1NJXA 2HWTA 3RBDA 3E2EA 1B4SA 4EZ9A 4BDPA 3TQ1A 5IZHA 2MLYA 4DV6F 3BSAA 1PJ6A 1IKVB 3G2XA 2NXJA 3M8PB 4KGVB 5F8LA 2JRSA 2UUWA 4DQIA 4FYYB 1SIZA 1ZOTA 3W65A 3SBMA 5LJ3Y 2KJWA 2QMWA 3NBPA 1T9XA 2PEBA 3BB5A 2MKHA 1NHUA 1S1XB 4KGKA 3R7SB 2GW8A 4BBYA 5A8KA 2AX0A 2V4RA 4LFAF 2ZH5A 4LIRA 3SSSA 2BM1A 2HZVA 4NZ6A 1N33J 2ZFHA 3KUEA 3ZTSA 1ZZNA 2G2OA 1OJ4A 3PYDA 5HVGA 3BV8A 2WVEA 4PQUB 2Q66A 3N9UC 3MM5A 1RWOB 2VG6A 4ID5B 1K0TA 4FVMA 5HMWA 5KFBA 3F73A 4EYIB 4ECRA 3C46A 4ENOA 2LMIA 5CAAA 2J0QD 5HSPA 1H6KX 1JIHA 2EFPA 3UDCA 2HW3A 1S49A 4W98A 2VICA 2KTQA 2LQBA 2CQ2A 3HI9A 3M30A 4Q2MA 1YJUA 4ZLPA 3JQJA 4KFBA 4QBUA 3K89A 5I42B 3MR6A 3DU5A 1JLQA 3EWGA 3TEGA 2FHJD 2DNLA 2NYHA 3HVWA 4RWXA 5D77A 1D0EA 1SH2A 3DOKA 4ZVTB 2YKQA 4AYBD 2HHHF 4CCHA 4IOAQ 4J5OA 2ALZA 3I4PA 3ENWA 1A9NB 4XTTA 5ETSA 3P6YC 1UCNA 3TJAA 3BGOP 2RNEA 3HPOA 1XWLA 4PAAA 5B0FA 1IBMJ 1VC0A 2R4FA 4L6V3 3MCSA 2KT3A 1N0VC 3DOKB 4KT0C 3O6QA 1UETA 4NI2A 3LGNA 4NYPA 3EM1A 5L39A 3D1OA 1SL1A 2HLTA 3MEDB 5E41A 3P5BP 3NGRA 3PV8A 2UXBF 1LXJA 3HKWA 2HQGA 4OV6A 2OPPA 5IT4A 5I42A 1U7LA 3KLIB 4GKJF 2XY5A 2IBKA 3JTPA 3PM9A 1YWXA 1N36J 4U67Q 1PIEA 1I94F 5C42B 1F9FA 1SJ4P 3T5JA 3VAJA 3IFEA 3KWMA 1JLAB 2AX1A 2YPYA 1FE0A 5D4LA 2FJWA 2XHCA 5HQLA 5JVGQ 1RCOB 1SC3B 4NZ7A 1BGXT 4ZOSA 2RQ4A 5GAEI 2HFSA 4XIUA 3HD1A 2R2SA 5I3UA 2YNFA 3DN9A 1C1CB 3D68A 4ETZA 4DSLA 2FZCB 3KFWX 3DLEB 3UNYA 2HQ3A 4JI7J 1HD1A 3QRRA 3AQOA 2OPSA 2Q3PA 3N6MA 3MMCA 4RUHA 3CMAS 4F2SA 4ZLLA 4K50A 4K5SA 1RP5A 3H4DA 1WDTA 2FHJA 1UTAA 2AYBA 1ITPA 2E5GA 1NAQA 2MZTA 4E2FB 1TK0A 2MQNA 3M6UA 1F2HA 1S0OA 3CCQS 2CPEA 2UVVA 3BBCA 2I8EA 2O1PA 3CT9A 5L8RC 5HBMB 1VFJA 5D4OA 4JI2J 1SUQA 1FKPA 1S1VA 2JC1A 2MYFA 4MK9A 4URGA 5LMUJ 1TP7A 3UCUP 3KXDA 1VBZA 2OTLS 2SXLA 3B82A 3S8SA 2K3IA 1RADB 4OI4A 4OZ0A 4AQYJ 1Q86T 1R31A 3GIRA 5EWEA 2MEWA 1RT4A 4ED5A 3FZBA 2V94A 4LRCA 1S9FA 4ELVA 1OPIA 1HNVB 3GIKA 1UJ6A 2EBEA 2J8AA 2FD2A 2ZKUA 2D9OA 2A2CA 2RKIB 5ETVA 4URQU 4JI2F 3ZO7A 3CCJS 1KVIA 4NWBA 1EKRA 3TA2A 7FDRA 1QAJA 1IQZA 2IVMA 3EXYA 3QIDA 3VGTA 5C25A 3SI8A 4KPYA 2MDAA 4DR6J 4F0MA 2L9DA 2GMLA 2N4CA 5HI7A 2HK2A 2M5YA 5BR8J 3MMAB 3NXZA 1BQNA 2LCWA 1B7YB 5KFLA 2C2NA 1RA6A 1X9WA 2DNKA 2IRXA 5AE3A 2C3MA 1C1BB 4M5LA 2CZ4A 3CCWA 4I2QA 4M1KA 1NNDA 2OPRB 5B08A 2V8GA 2U2FA 3TUPA 1FD2A 9RUBA 4WYLA 1SL2A 2M8DB 1IXKA 5A8RB 3QO9A 2CUYA 4FP9A 4OZLA 4ZVGA 4LMZA 1QE1A 1MWYA 3QAUA 2FY8A 4C8LA 3K8VA 2QGFB 4QWBA 3FZ2A 2I0XA 2MKSA 3DFEA 3R5AA 3CDUA 2GHWA 3DI6B 3IM9A 1LWFB 1U6BA 3D5MA 1N5QA 2QN6B 2GV1A 1NSQA 4DSEA 3QGHA 5DG8A 3QSYB 1NK5A 2DHHA 1DLOA 3A3PB 3KJNB 3IS9A 4QWCA 2R2RA 1RT7A 2AYEA 1I1GA 1OY9A 4LVOP 4ZCKA 3OW2R 2ALYB 4NYZA 3T1HJ 3PACA 2ROEA 4MKVA 2DKOB 1F5AA 2MHNA 4ED4A 4DQQA 3KOAA 3GFHA 4KHPJ 2Z56B 2DNGA 4DL4A 4NMXA 3L09A 4QU7A 3PJWA 3RB6A 1ZAWA 2RMLA 2O01C 2ZUAA 2YNGA 4DX6A 2OEJA 5L46A 3SCKE 2DT9A 3CO0P 3MAAA 4TY8A 1KTQA 1RAFB 2B6AB 3OR2A 5DDOC 1ZTTA 1VS3A 3DDNA 4NA2A 3TR5A 4IQMA 2WB4A 2IIHA 3G82A 3HZEA 1N33F 2X51A 1P27B 4ZKAA 4ED3A 1KR4A 2MZJA 2H5IB 4BC9A 2VDHA 1HFEL 4UY8T 3MFIA 4DL2A 5J2PB 1JLCA 2CJYB 3CIZA 2FLLA 1CPZA 2IC3B 3P3DA 1H2TZ 5GAHU 1RUSA 4X4OA 1G4CA 2C3YA 4QIEA 5GAHI 3IRWP 2HVIA 2DGQA 3M2RB 2KXHA 1HPZA 3PX6A 4PXEA 2QFJA 2VPXB 5D78A 3DI6A 2MY7A 4WP3A 1VQPS 2RRBA 1KRPA 1WC0A 3BS9A 2W4PA 4DR4F 2ZM6J 2AEMA 3HK2A 2IYIA 3V4MA 2VPWB 2W7OA 1IWAA 4ED1A 1G3OA 1MSWD 2W01A 1W7WA 1FKOA 1Q7LB 3ILIA 2AGPA 3AQPA 2NYIA 1T0TV 3GFXA 2V2QA 1DARA 4FBUA 2DHAA 3M2VB 2ZBPA 4I2QB 1YK9A 2HS3A 3MGJA 1RAEB 4WFYA 1C1BA 1U47A 3RUBL 5J2MA 2DR9A 4QIGA 2GVZB 4C8MA 1IBMF 4H54A 2M88A 4B3SF 2CA9A 2UU9J 2DHGA 3FEZA 4UOHA 2MZSA 4B3TJ 2VOPA 2FVSA 2FZGB 1O5JA 1S1TB 3C66A 3LOUA 3MR2A 1TAUA 2ZDPA 1IKXB 2HNZA 4USVA 2LDYA 3G9CA 5G0RA 4RWWA 3JXOA 2AYMA 2X3GA 3DGPB 4J9UE 4OZ1A 4ZK7M 1XNRF 3OL7A 2NLWA 1R27B 2D7SA 3GFZA 3MAHA 1XC9A 1N8RT 1SXLA 4BC7A 1Q8IA 2RIJA 3KLGA 1NHKL 4KKOA 4OI6A 4P6QA 1M5VC 2W2NP 4ZVOB 2OAUA 4IFVA 3LPYA 2B9YA 2BE9B 2UU9F 3WBZA 7AT1B 3JYTB 2CNKB 2LA6A 4OYPA 1SUQB 4WFAQ 3EYZA 1YTYA 1PAUB 4JI8F 4O4RA 2J9DA 2QO3A 5M2PA 3EGWB 3CCVS 2O67A 3QGGA 2N82B 4JI1F 1N5TA 1MU2A 2NPIA 2DNYA 3TRGA 1X4CA 3H25A 1CJUB 3VGUA 2VBXA 3ILOA 4OHYA 4BWJA 1K73T 2YKPA 2G13A 3PHEA 4QYZK 3POTA 4V19J 3NAIA 4TVAB 4ETXA 1WTFA 1HW9A 3DRPA 3PFOA 1JK9B 3ZTOA 3T19A 2I6WA 4J9NA 4M5HA 5DLFA 1KP6A 3MM9B 5KFVA 3HMJG 2XMAA 5D8HB 4MAKA 3SFUA 4CQ1A 4R8UA 2YNFB 2XULA 2FY1A 2GMHA 1S0VA 2NQPA 1XIQA 4LF4J 2WVBA 3A1YG 2JVOA 4CLSA 1OPZA 5AE1A 3GILA 2ADBA 5KT6A 2FVRA 4B3RJ 4DQPA 2MJUA 3QT7A 4QQBA 1WC6A 1B64A 2HLUA 2XZDB 3M8WA 3KLHA 2DCLA 2GNKA 2ZJPQ 1UVMA 1QLNA 2HVDA 4CLFA 3M9OB 2LEPA 3CSKA 5LXYA 1N34J 2JEJA 3KLIA 3BREA 3FDSA 1HWIA 3H59A 5ETRA 4CM2A 5KFMA 2PMHA 4ECXA 4WFXA 4K4XA 4NLTA 3RBEA 3EVWA 3J7YU 2UUBJ 1RKJA 3LANA 3MEDA 4OLOA 4WIQA 3PIOQ 3PYGA 1RYRA 2A0FB 3EUNA 2BJDA 3BN7A 2JVRA 4PXCA 5I3PA 5L1LA 3SV4A 1Q16B 4WF9Q 3I0RA 2RT3A 3X3UA 3C6UB 5IC4B 1BXNA 1HWLA 2BKNA 4HL9A 4DV1F 2AGQA 2DNZA 2NZCA 4CM0A 1PCAA 5F9NA 2XB2D 2QG9B 3TVZA 1C2PA 4Y2KA 1RAGB 2K06A 3KKFA 3UE2A 2VB6A 4RL1A 2DTJA 3QNWB 1HL6A 4ZVUB 2CQ3A 4WKYA 1WOSA 3OVSA 4UW2A 3HHEA 3ONQA 3L7PA 3TARA 1WF1A 3MCNA 3DRYA 3S7RA 5EUHA 3AFGA 3QLHB 2NSBA 3THTA 3G71S 3VV2B 1X4BA 1VRUA 4L74A 2VIHA 1CULB 1HBUB 4RW9A 3RTVA 1W25A 3HT0A 4RW4A 1T03B 2H5JB 3FSIA 5IT0A 4JUZA 4NXMJ 3TAMA 1Q53A 1DY3A 1RU1A 2D3O1 5BR8F 4F4XA 4J37A 4Z7CA 3J7A1 1EARA 2JEGA 1QAXA 2I9SA 3FRYA 1Q79A 3NLCA 3Q8YA 2Y8WA 2QV6A 3D66A 4P10A 5HLFB 4ANDA 1WACA 5JVHQ 1PG5B 3C16B 5BYRA 4GO7X 2B4PA 2CQPA 3G6YA 4XDDA 4MKYA 5IM0B 1T9YA 4HYKA 2B8PA 3HVAA 5A8KB 2V9WA 2COLA 3GG1A 3HSJA 5T41A 5CA5A 8ATCB 4P2FA 4MK8A 5K8MA 3V6DB 3QSIA 2WW4A 1FKAF 3OR1A 3PO5A 1RWNB 2BOAA 5LMNJ 2NUHA 3SSRA 7FD1A 2JOQA 1TU0B 2ZC3A 1KN6A 2ZBCA 3D6HB 4JI0J 1HHTP 3VAIA 2MPUA 3IP0A 3S6EA 5EWFA 1R3NA 2FLOA 1ZAVA 4USIA 4YQWA 3CDWA 3TANA 3OTOF 1S9GB 1YHQS 3WC2A 4DSIA 4WZMA 3QLHA 3A8KA 4F7VA 3RGIA 4F50A 1AZSB 1F6TA 1PYOB 2CZ9A 3GR0A 2CDQA 3ZZZA 2YKMB 1BWEA 1M5HA 4O3QA 3Q89A 1IKWB 3OFHA 3EZUA 2CPZA 3MPVA 4A8QA 3GV5B 1NDKA 4M63A 3W63A 2OUGA 2YY3A 3PRDA 4PZVA 3RG6A 4DCJB 4ZLJA 5HQMA 1L3TA 3DRSA 1U45A 2IAJB 2RH3A 3C6UA 3TZXA 3FMWA 2WOMA 2OFGX 2LXUA 3ZZTA 3CCUS 2DGVA 3PW5A 4DV2F 2CQ1A 1XMQF 5KFUA 2BKOA 1UJ4A 1RWUA 2ZZTA 5ETTA 3T5KA 1N36F 2CQIA 2KO1A 1YKWA 3LQVA 4OZ2A 4OZ3A 4EBDA 1MROB 2ZVIA 2NXCA 4DS5A 3GE9A 2JL9A 3F41A 2ZE2B 3EDQB 1GMWA 3K5MA 1F3VA 2VA3A 4RJVA 2Y1LB 3IO1A 4KGXB 1QD1A 3RB3A 1M90T 2E1MC 3H8YA 4H4OB 4PEOA 3BR9A 4O3RA 3W2VB 5CCMA 3WDOA 2M3DA 5BYSA 2FJAB 3G8QA 4YEAA 1MWQA 2YKOA 3BSNA 1FDNA 3ENAA 3C6TB 2R8IA 2G1HA 4I64A 1RI7A 2CJAA 2XMKA 2W9AA 4NRTA 5LJ5Y 1RTHB 1S1WA 2HQCA 1BQXA 1VK8A 1Y4ZB 4MMOA 2Z2ZA 3J80Y 1LXNA 5LMNF 4Y2CA 3RB0A 1HBNA 1TUGB 5HJYA 1RAHB 1HARA 2VG5A 2UV8A 2HBQB 2IJFA 1KLMA 4L3NA 3KLFA 1TAQA 4NLYA 1IN0A 2FHOB 5L9XA 3AY0A 3D6FB 2R42A 4NLUA 1K1QA 3MOZA 1RHJB 2C2RA 1DFDA 3AD8C 4MKAA 1VIXA 2W4CA 1IKYB 3C15A 2V4JB 4DQSA 4N41A 4LF7J 5F41A 1WOPA 1IQTA 1X5PA 1RWVB 2G1DA 3MTKA 3CJQA 3PXGa 5I4MA 1TMJA 4KIAA 4OI0A 2YWKA 2LLZA 4OJGA 4C11A 4EU0A 3FC9A 2BE7D 2E5LF 4J90A 2VJUA 3CEDA 3W8PA 1REVA 1VQ5S 3OLAA 3QGIA 2ERRA 2M70A 3D54A 3MEEA 2NPFA 1HBMA 5SUHA 4K4TA 1NJYA 1HIYA 4X4VA 1PKUA 3UDVA 4DV0F 3HSDA 1V3SA 3D1QA 4OX8A 3E3XA 1NDLA 2GFFA 2LXIA 4DL0C 3C14B 3P5TL 4C7QA 4O4GB 1NRKA 3EGZA 1RSCA 4JI5F 5E3RA 3DGPA 3QT5A 5K14A 1R6YA 4MYTA 2BKPA 5IV4A 4DSKA 1IKXA 1UAWA 1U2RA 2GX8A 4N5SA 3SIPB 3DXBA 3U27A 2FJDB 2OPQB 3HHLB 4TY9A 4X4RA 1VMBA 1Z1ZA 3W7BA 1HWJA 1RXOB 4P74A 4F3MA 2VL1A 3CD7A 1B99A 3I32A 5D0RA 2OPQA 4PKDB 2HMIB 2HGNA 4Y6IA 2EFVA 2PMZD 3IG1A 1U1LA 3OVBA 3PRVA 4IKAA 5K14B 4DCPB 3OVAA 2BABA 3IMQJ 4AD6A 1LKZA 4B9VA 2FC9A 2B4VA 5C24B 2I5JA 5U47A 1VBYA 2I1RA 2O3DA 3N5BA 4DPYA 3ELHA 3DLJA 3PY8A 4QU6A 4F3QA 2B7BB 2CKWA 1XMBA 2Y1RI 2IRUA 2V5HG 4WK3A 1JLCB 3TWZA 1PJ7A 5A8WA 2CJKA 3PVXA 2K1RA 2W24A 3K5OA 2DH7A 2Z2MA 3GCWP 4G1QB 3RR7A 1PJ5A 4DOZA 1ZM4A 3FGVA 4QYZJ 2OELA 4N56A 2HVHA 2Y1IA 4C11B 3J7ZT 3VGSA 4RNNA 3NOCA 4MIWA 4IOCQ 3KJVB 1P9YA 5B0EA 2ZOGA 1AYEA 2OHDA 3CIMA 1U1PA 1ZPVA 2FPHX 2H9ZA 2GIFA 3E01B 2Z0GA 2L3MA 2C2MB 3D6TB 3HF5A 1IKYA 3C15B 4CWBA 3NGTA 2E9ZA 1NUEA 2UUCF 3IWLA 2F8MA 2DD8S 1S1UB 5F8JA 1U49A 2E66A 4JI3J 2E7VA 3H20A 5DG7A 2QA4S 1UA1A 1D9DA 4B3RF 4WFNQ 1J5EF 2ROGA 3LGMA 2QZ8A 3PW4A 3RAQA 3X1LB 1PBAA 1WEYA 4PWWA 4ERDA 1DLOB 4QWEA 5KT4A 2GJFA 5KT7A 2R7QA 3V4IB 3OSPA 1SJ3P 3DC2A 1S9EB 1WF2A 2B7CB 1KEKA 3NWGA 3BKUA 3W2VA 3D1HA 3FFIB 2H5EA 5HVFA 3W5XA 4LF2A 4DUZJ 5CYQA 5ETPA 1N4LA 2BMBA 2W9CB 1X5SA 2JLFA 2X7IA 3UI3A 2HNDA 3GP9A 4A8KA 4ILLA 1VYAA 1J5OB 1SBRA 2HQDA 4JI6J 1NCLA 1Q82T 2FUG9 2JSXA 2NXEA 3MM6A 3U1NA 2YNHA 4AXIA 4WPAA 1MROA 5HMZA 3FBBA 1TK8A 2P9EA 1SH0A 1HBOA 3JTOA 4YHHF 3KK1B 4M5IA 3V81A 2YWFA 1HI0P 4H4KC 4KAIA 1XMOF 1RHRB 1RTDB 2OIHA 1TELA 2HSEB 2CZVC 2LQ9A 4Z7YA 2DH8A 1X4DA 4ID8A 4DV3J 2X1AA 5D0EA 4EWTA 1KVKA 1FFWB 3AOBA 3R5BA 5E3AA 2R7UA 5RUBA 1ZM3A 1KHVA 1U48A 3VAGA 5HQ8A 3MM8A 4O44B 3MOJB 4CLTA 3KK1A 3C19A 3PKYA 1RT4B 2JLEA 3KUHA 1AZSA 2LP4A 1UFKA 1VR6A 1S76D 2BDPA 3R5GA 4P9SA 5DDRC 3BJYA 2ZWPA 4LR8A 3CMQA 4TKTA 2CFXA 4Y00A 1J5OA 1FKPB 1VQ9S 3K5PA 4DG1A 3DLLQ 1RZMA 1ZAXA 4USUA 3NNAA 2DHXA 2HHTA 1DTQA 2V8PA 1FO1A 1HNWJ 1JB0C 2V68A 1SKUB 4LR7A 4A8OA 5DRKA 1X9SA 3W5YA 1GAOA 1RT1A 3M6XA 3HFKA 1M1KT 4LJMA 4U95A 3FBCA 3MTJA 3Q8SB 3EPIA 3V6DA 1UZHA 3PEJA 4EUVA 3EJMA 2QSWA 4ZP6A 2M52A 3IBFB 2DK2A 1TTHB 2Y3YA 4NASA 1V9OA 4A48A
chains in the Genus database with same CATH topology
1KNZA 1L5UA 2FGOA 2YKNB 3C8YA 4N8OA 4MH8A 2CPHA 1FTRA 1QUPA 4C0BA 3OTBA 1Y7PA 4HH1A 1KOOA 5E5NA 3RW6A 1JNZB 1OWXA 1KVJA 1RJJA 4DR5F 1NO8A 5D6GA 3IWNC 2PGCA 3TOQA 2B0GA 1S6PA 3M1VA 1GH8A 2ZKTA 4OHWA 4C8ZA 4LFBF 1S99A 2DGSA 4RW9B 4IO9Q 2CVEA 3Q23A 2A2DA 2YKAA 5A8WB 2J0WA 1F2GA 4ZA1A 3N28A 1TL3A 2BA9A 4FVCA 3CJ2A 3Q24A 1VOMA 3NMRA 3PO4A 4OX6A 2ZNYA 2Z2LA 3GZ7A 4QR2A 2A10A 1LOUA 5H9EJ 4PXDA 4I68A 2HWIA 1ZETA 2BE2A 5KFQA 4ED6A 2YH1A 4Q0BB 4J9QA 1X4HA 2ROPA 4NOHA 1U1QA 4OX7A 5FD1A 5DETA 1R0AB 1FDAA 1R8CA 1VQYA 2NSCA 2YWHA 3HVTA 2KHCA 1I6JA 3M30B 5L1IA 4DN0A 4QYRA 3CULA 1BQMB 1T02A 4DFJA 3HXMA 2DO4A 5T14A 1JWWA 1NH8A 5IXUA 5E2QA 1EP4A 3BSCA 4NLSA 5D3GB 2XMTA 4IFYB 1YSJA 4C9DA 5GAEU 1YJ9S 1OQ3A 3MM5B 1YBAA 2HZCA 4NLXA 3H5XA 5HMYA 4IG0B 1H2VZ 3MEEB 2EW9A 2XMUA 3V6HA 3D2WA 4UQGA 4M8LA 1C0UA 1REVB 2YNIA 2RQCA 1IUJA 2XSJA 4NMLA 1HHSA 3I5BA 4B9LA 3I82A 4PPZA 3BDPA 3SV3A 2VC0A 3G96A 3CD5A 4OJ1A 3WX4A 1NB7A 5IQ6A 1UEVA 4OL8A 1UMJA 4KGMA 4DSFA 1QM9A 2CIMA 2ASYA 2ZOMA 4QIVA 4DQIA 3R27A 3GWCA 3V6KA 1DTTA 3BGUA 1YITS 4CO4A 2POKA 4QW8A 4ES3A 1L3KA 1WI6A 3U7JA 1U26A 2D74B 2CQCA 2XS7A 3DMJA 1S79A 1NKCA 3NG8A 1OIAA 2YWGA 4KKOB 1RTJA 1TR0A 3LP2A 3BQ0A 3W2WA 1FRXA 2JWNA 2K3KA 1JXEA 2KB2A 4IOBA 2FY1A 3TI0A 4USHA 4M95A 2RQKA 4AL6A 4WU2A 2HRYA 4DFMA 3I0SB 3TAPA 2XCPA 4KC5A 4DF8A 4NRUA 3PZPA 1X4EA 3H5YA 5EN1A 3M2VA 3KG4A 5EHHA 2PIIA 3CTRA 5J2NA 1E6YB 2DNRA 1FKOB 2WOMB 3AJ1A 3DRSB 4HT5A 1SL0A 4OLPA 3ITHA 3HHNB 1UVKA 1PO6A 1LW2B 3MM7A 5KFSA 4F4ZA 3QZ7A 2JDJA 3I31A 4JOUA 1IKWA 1HPZB 2Z8QA 3Q2SC 4G1PA 4HI2A 4RNFA 2KZZA 3KMSA 4CO5A 2CJ9A 1LWCA 4NLPA 1VQ4S 2DR8A 3RZAA 2RSQA 2WK4A 4NCAA 1TL1B 3K0JA 2VV5A 4WKRA 1JMTA 1WEZA 2DRBA 3QJLA 3KK2A 4Y2MA 2EI5A 5IS2A 3HP6A 4DF4A 1NK9A 3GV7B 5DGBA 4XDCA 3RU0A 2DIVA 1S77D 1Q7YT 1U1RA 3KHGA 6FDRA 4RBVA 2LQJA 1R8AA 2ZUGA 1SKRA 1IJFB 2HFZA 4KBIA 4WTYA 1P9QC 1YJRA 2KDOA 1RT5A 2YH0A 3CCSS 4C8KA 4XAKA 1RT7B 4I6YA 4C2MA 2P6SA 1D8ZA 3M8SA 3GYXB 3QPIA 2DNNA 1CC8A 3MAQA 1VHFA 4J9PA 3L7OA 4FS2A 1Y3KA 2CQ4A 2AU0A 2FTRA 5J1NA 3CMES 3DLKA 3DLHA 1SV5B 1WD6A 1HBUA 1F5CA 2WCXA 4JI0F 2J7KA 1IBLF 5A8RA 3US5A 2J6SA 5L9NA 3FSYA 3UR0A 4NA3A 3HX9A 4P7TA 4IH7A 4LSLB 5KFFA 2E1RA 5SZTA 1AROP 4ES2A 2LKZA 1IJEB 2F8EX 3B4DA 4I6AA 2HNYB 1B0VA 4TXSA 1BQNB 1K1SA 3MMAA 4Q45A 2W8LA 4A8FA 5KAKA 2L41A 1RGVA 3QIPA 2W8KA 4M5DA 3MMJA 3I0RB 3OJSA 3MECA 2QLWA 5KT5A 5AJ3F 2XY6A 3LAMA 1C4CA 4PQAA 3TYTA 1RTDA 4NLWA 3CJKB 1HBOB 4AL5A 2W7PA 2M9KA 2VPYB 1VQ7S 2UUAF 1HQEA 1TKZB 3U1LA 3THPA 3TVKA 4OZ5A 1WEXA 2CJQA 1ZM9A 5DGAA 2LQ5A 1VQNS 3IA0A 1WF0A 4B3MF 4Q7AA 3N79A 2LEAA 3I96A 1FK9B 2ACYA 2HAIA 2XMWA 3CJ5A 2X1FA 4Y0FA 5HP1A 3BO4A 1X0FA 4ZPTR 2WBRA 3S1TA 1PILA 3T9NA 4UOCA 4XK8C 4ZPVR 5KFTA 1T05B 2DIUA 3GG0A 1FRMA 3TO8A 4HVZA 3LALA 1LK7A 3R1HA 3R3TA 4K4YA 1FK9A 5KOWA 2PI4A 4WXOA 1DZ5A 3VZIA 5K8NA 3BSOA 2BOPA 2CPYA 3CB4A 2C28A 2DVIA 2ZC4A 2R7SA 4A4JA 4KB7A 3DLGA 4LFCF 1AFIA 4PG7A 2Q6CA 3K2YA 2QRRA 3KHHA 4RUAA 4JI7F 5B7WA 4DR3F 3MHYA 1K0VA 5KG0A 4IFVB 3CO9A 1ZYQA 2IM2A 5L1JA 1RAJA 3J7Z5 4FXWA 1Z4UA 2DBBA 4ZDNA 1JLEA 2ZZNA 1VLYA 2OTJS 3M05A 5E3QA 4RNOA 3Q22A 4Y65A 5HMXA 5EDWA 2HHUA 1RYSA 3IG1B 2ZM6F 1XR6A 2BUNA 4RW8A 2G4BA 1S1TA 2HMIA 5KOXA 3NGDA 3I9ZA 4B17A 5BJRA 2JEIA 1SB6A 5J2MB 3IR7B 1H2UX 3KG0A 2FGCA 3GSDA 3FRZA 2ZJQQ 1RT6A 3OBIA 1FXLA 3KMQA 2EK1A 1TKDA 4V19X 2KM8B 1PGZA 2JEFA 3KLEB 4WFZA 1FD8A 5CZXA 2ZHBA 3NRBA 1S10A 1CSJA 4R0JA 4QPXA 2ASLA 1FJEB 3PRBA 3VCDA 1JLFA 4RW6B 2ZH1A 5KFIA 1HI8A 3FQKA 4CTAB 2UP1A 1RT5B 5KG1A 1LFPA 2HGMA 5J2PA 1N4LA 2V9WA 4ILRA 4E8UA 2HFOA 1S72S 2ABYA 4PRFA 1AFJA 2BR0A 2DNHA 1N5SA 1TV6B 2B4UA 4O3PA 3KNGA 3GIIA 3M8QB 3JTNA 3TA1A 2F9JA 2VA2A 4B9MA 4OHVA 1DRZA 2B6AA 1GX5A 3OR2B 5F3ZA 1XNQF 4DR7F 5LSOA 3BZQA 1UL3A 1N34F 3Q8RB 3H5SA 4CH7A 2YNGB 3ENQA 1VI7A 4B08A 3ISND 4DLGA 2CJKA 4DX8H 4JV2A 4EGLA 4DHVA 3OLBA 1URNA 2WRMA 4ED7A 5J2QB 2LYVA 3QGPA 2VQFF 5CZVA 3ZFVA 4NLGA 2KFZA 4WE1A 1P6TA 1LWFA 2XZWA 5F8MA 2N7CA 1S97A 3UW1A 1SI9A 3ITHB 4CT9A 4MFBA 3V6JA 2AP6A 2R7OA 3QO9B 2WONA 4ZVFA 3DYAA 1JJ4A 1WG5A 4LF4F 1FNOA 1FCAA 3AB2B 3CGIA 4B9UA 4DSJA 4EEYA 4B9TA 4TQSA 3I56S 1OS5A 3M8RA 1FEHA 1RK8A 3Q8QB 5LMUF 2KN4A 3PW0A 4YB7A 4O3OA 2BRLA 5EWGA 4NCBA 1RTIA 3AB4B 5H1SV 2R8JA 1LW0A 2BYCA 4ICLB 4KHRA 4ZPWR 3QWPA 4F2RA 2AF6A 2RKIA 4LVNP 2JJ4D 2XEXA 3L3CA 2YKMA 3DU6A 1R43A 1LFWA 4WE1B 1N54B 5CYMA 2DH9A 1VC5A 1V3ZA 2LDIA 1KQFB 3LW5C 3EPGA 4OHZA 4I4BA 2IMOA 3TP2A 3I5AA 1N88A 1DTTB 2ZJRQ 4I67A 2BZ2A 1FJ7A 2BJEA 3UCZP 4UUXA 1LWEA 4Q8FA 2ZZMA 1JJHA 1M5KC 2O5DA 3GYNA 2J0SD 1NH7A 5KFGA 3O44A 3R1LA 1YRUA 2N4DA 2ASDA 1Q1KA 2R9LA 1U6FA 3OR1B 4PG4A 4ZP8A 2WTFA 4FBTA 3MR5A 4CI0B 4X4PA 2XSJB 4JV5F 3SXLA 2NZ4A 3MMCB 1C0UB 2YNIB 3SYZA 1BC6A