3CCRS

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ccrS00
3H2VE 2FY1A 2M7SA 2XS5A 1S72S 2EK6A 2MSSA 2EK1A 2A3JA 1VBXA 1KOOA 3S6EA 3LPYA 2CPFA 2CQDA 5DDOC 2FC9A 1DRZA 2JX2A 2LECA 3CCLS 3THPA 3SDEB 2J0SD 3UD3P 3VALA 2KT5A 1WI8A 2AYMA 3J7YU 2KFYA 3JB9k 1WWHA 2MHNA 4RU2A 2DNMA 1FXLA 2MKHA 1VBZA 3PIPQ 1YJ9S 4UY8T 5FJ4A 1WHXA 5H1SV 4LJMA 2BZ2A 1M5OC 1WF0A 2ADCA 4P6QA 2MQNA 2KM8C 1ZZNA 1VQOS 5HL7Q 2DNPA 1S79A 2WBRA 2N3OA 1FJ7A 2U1AA 2M52A 1WELA 5DETA 1H2VZ 2MZTA 2M9KA 1U1MA 5LJ5Y 3HHNB 1U1LA 3CTRA 2J8AA 1X5SA 2HZCA 3U1LA 1A9NB 2MMYA 1VQNS 1Q82T 2HVZA 3MDFA 4QU7A 1VC5A 2U2FA 3P49B 1OO0B 2FHOB 3IRWP 1DHMA 1VQ7S 3R1LA 2OIHA 2CPXA 4CH1A 3G8TA 4F25A 4U67Q 2DNNA 2M8DB 3MURP 3VAKA 2LA4A 2FPHX 3TYTA 1CVJA 5DM7Q 3VF0B 1YJNS 2MGZA 2VODA 1Q7YT 2YWKA 5IQQA 3P5TL 2MKJA 3CCMS 4C0OC 4WCEQ 4TU8A 1FJCA 2KU7A 2LYVA 2XNRA 1R8PA 3NS5A 1OWXA 2RRBA 1NO8A 1SJQA 1O0PA 2DNZA 2X1AA 2D3OR 2MQQA 3CCQS 4F02A 2O3DA 2QEXS 2HYIB 3Q2TC 2DNQA 2CPIA 1X4DA 5GAHU 1UW4A 2KM8B 2XS2A 1UP1A 1R8HA 1U1KA 2BOPA 4M5DB 3SMZA 3G8SA 4QQBA 1UAWA 3CCVS 1VQMS 3MUVP 1WEZA 2DNRA 3G71S 2F9DA 1YTYA 4CQ1A 4TU7A 2OSQA 2PE8A 5ITHA 3S01A 1WEYA 2J0QD 2MJUA 3UE2A 4PKDB 3MD3A 2N7CA 1JJHA 1K8AT 3CCJS 3MUMP 4IOAQ 4ZKAA 5LSLA 2MKCA 3RW6A 4WFNQ 5DDPC 3D2WA 4IOCQ 2MB0B 4C4WA 2KG1A 2MQPA 1HL6A 2MQLA 1KC8T 4TU9A 2LXUA 5IFMA 1YIJS 2JRSA 1WTBA 3ZZZA 1P27B 3G4SS 1PGZA 1QVGR 4OZ0A 2MKKA 2G4BA 2DHSA 2MZJA 2N82B 4J5OA 5LXRA 2DHXA 2OTLS 2OTJS 2RT3A 1P1TA 1FHTA 2M0GB 2MSTA 2DIVA 1FJEB 2GHPA 2I38A 1H2TZ 2L41A 3CCES 3V4MA 2CQGA 2KXNB 2MY7A 3CXCR 1N8RT 1WHYA 2RRAA 3TP2A 1B7FA 2ERRA 2ADBA 3MUTP 3THTA 3L3CA 4C7QA 5JVGQ 2MKIA 2DK2A 2DNHA 1M5PC 2DNLA 2CPZA 4QPTA 1NJIT 3OW2R 2KXHA 5GADU 3UCUP 3SDEA 1VQ5S 1U6FA 2DNKA 1VQ9S 4WFAQ 4WIIA 1WG5A 2CPHA 1VQ8S 1SJFA 2L9WA 2KRBA 2L08A 3UWTA 1U1OA 3U1MA 5CXTA 4WKRA 2MXYA 3MOJB 5D77A 3TO8A 1X4AA 2CQPA 2RS8A 4V19X 2DGTA 1VQLS 4OZ1A 2DGWA 3HI9A 3G6ES 2F9JA 1KD1T 2K3KA 3I56S 2QFJA 5CA5A 2DHGA 2ZJPQ 2XB2D 2E5GA 2LA6A 4FXVA 3IWNC 1XN9A 1ZZFA 2YH1A 1H6KX 2MZRA 1W2BR 4W92B 1U2FA 1NU4A 2LQ5A 2LMIA 3VAJA 1SJ4P 2JVRA 4QU6A 1X5PA 1WI6A 3EGNA 2VOPA 1K9MT 2CQ4A 5IM0B 2MKSA 2KYXA 1M5VC 3FEYB 2CPJA 2YH0A 1X4CA 2DGXA 2RNEA 1X5TA 4CH0S 1VBYA 4CIOA 2KHCA 3NNAA 3K0JA 3UCZP 2MZ1A 5LJ3Y 2RU3A 1QM9A 1UFWA 1WG4A 2DNGA 1VC0A 1VQPS 2N3LA 1F9FA 2E5JA 2CPEA 3US5A 1K73T 2Q79A 3P6YC 1U1NA 2X1FA 2KH9A 2AYBA 3DLLQ 3G9CA 2D9PA 2DGVA 2V94A 3N9UC 4ERDA 3CC7S 1OIAA 3UD4P 3CD6S 4LMZA 3DXBA 2LCWA 2DGSA 3CC2S 2HGNA 3VAMA 2DGUA 3LQVA 1SJRA 5GMKa 4IO9Q 4YUDA 1SJ3P 2JWNA 1URNA 2G1DA 4PRFA 1A7GE 4A8XA 1M1KT 1WHWA 2OSRA 3CUNA 2MY8A 2RQCA 2UP1A 2KVIA 3NMRA 2M8HA 5MLCV 2VOOA 1N52B 1X4EA 2CJKA 1FO1A 2MZQA 1G2EA 3B4DA 3J7ZT 2DB1A 3SXLA 2GO9A 1WF2A 4WFBQ 3S7RA 2RVJA 2CQBA 3CCRS 3B4MA 2E44A 3ZZYA 3G96A 2LXIA 4YB1P 5LXYA 3P3DA 2E5IA 1JJ4A 5LSOA 2LEBA 1KOHA 1X0FA 1Q86T 4UQTA 1U6BA 1QVFR 3MI7X 4LIRA 2KXFA 1X4FA 3BO2A 1AUDA 2F3JA 1Q81T 1SXLA 2LEAA 2KI2A 2DISA 2XSFA 3BEGB 3BO3A 2CPYA 2DIUA 4ED5A 3VAIA 4YOEA 2SXLA 4Y00A 2CQHA 2ZJRQ 2HGLA 1L3KA 1YWXA 2DITA 2QA4S 1N88A 2KG0A 2ZJQQ 2MZSA 1U1RA 5EN1A 1HA1A 3I55S 2J76E 2CQIA 3R27A 2OJ3A 2XS7A 1YI2S 2M2BA 1PO6A 1WF1A 5DDQC 3PIOQ 4BS2A 2I2YA 3BO4A 4WF9Q 2MQMA 5DM6Q 1VQKS 3CF5Q 1VC6A 4EGLA 4W90B 3H2UB 2DH9A 1YITS 2FC8A 1VQ4S 2DHAA 2EVZA 1ZH5A 4TLQA 1OPIA 2MGZB 1HD0A 2DNOA 1RK8A 2KRRA 2DO0A 1YJWS 3ULHA 2LKZA 4F26A 1BY9A 2RQ4A 2NLWA 1HD1A 5HO4A 1KQSR 1FNXH 2YKAA 1JJ2R 3CC4S 5BJRA 3UCGA 1JMTA 1WHVA 3CCUS 3CMAS 2PEHA 1M90T 3CCSS 3CULA 1X4HA 3MD1A 2AYEA 4IUFA 1N54B 2CQ1A 1WEXA 1FT8A 3FEXB 5IM0A 1DBDA 2CQ2A 2DO4A 5GAGU 1M5KC 5JVHQ 1X5OA 2DGQA 2D9OA 4FXWA 2CQ3A 4PR6A 2G0CA 2KN4A 2JVOA 2DGOA 5GVQA 5DDRC 2MPUA 1RKJA 1U1PA 2HGMA 2M4MA 1IQTA 1X4BA 2MYFA 2AD9A 1WG1A 1X4GA 2CPDA 3S8SA 1YHQS 3EGZA 2MJNA 2VONA 2YTCA 3Q2SC 3NS6A 3MXHP 1D8ZA 3RW7A 1H2UX 2X1GA 4Y0FA 2MQOA 2K8GA 2DNYA 2RUGA 5CYJA 2DH8A 2X1BA 2AYGA 1U1QA 3CPWR 2E5HA 3VAFA 2B0GA 3VAHA 3NNCA 2CQCA 3NNHA 3BS9A 3EX7B 2M88A 2CQ0A 4Z2XA 2XNQA 2RS2A 3R1HA 2DH7A 2NZ4A 1VQ6S 3VAGA 1DZ5A 5D78A 3CMES 5GAEU 1D9AA 2M70A
chains in the Genus database with same CATH superfamily
4F4WA 1SL0A 2EK6A 2ZEJA 5F41A 3HPOA 4U95A 4FYVB 2OPPB 1DY3A 4O3RA 1NK5A 1Q0NA 1Y0HA 3R5AA 3RTVA 3DLKB 5HMXA 4DSEA 1FK9A 1NDCA 1VISA 3GYNA 4KGVB 4DUTA 2LFVA 1PSDA 3CJQA 4UOFA 2H54B 5LJ5Y 4AXIA 3RR8A 3NY0A 1CJVB 4QU7A 1R3NA 1ZPWX 2YNGB 2KVQE 2OIHA 2HBZB 4ZPTR 3HDSA 2YKNB 4CH1A 2ZITA 1SV5A 1CVJA 1NLKL 1NB2A 4M1KA 4IRKA 4KV8A 2MKJA 2Y1JA 3FMBA 3ZTRA 1OWXA 1U25A 1IXKA 2AEMA 4ZIVA 1D09B 3BF4A 2HFUA 4F02A 2GIFA 4OV1A 1V3RA 2C3PA 1NJZA 1AA1B 5D4PA 1NM2A 3OSNA 1NRKA 4KPCA 2ZH1A 3GV5B 2R8IA 2HFNA 2GMJA 3QFWA 4TVAB 5HVGA 4ED4A 2BJ1A 4CQ1A 4J9QA 2KFZA 2PE8A 3B78A 1FCAA 4RR5A 2MJUA 2EBEA 1RA6A 2IVFB 3KG0A 1HBMA 2G0JA 1NK6A 3U02A 2XM3A 3SCKE 3QSYB 2JZ5A 4JI3J 2QGFB 3JSMB 4CLFA 3D68A 2HVHA 1FHTA 3PEHA 2DIVA 4Y2IA 2HQIA 4NCGB 1OY8A 4DF4A 1TL5A 2RRAA 1KP6A 3THTA 5LMUF 3IP0A 1YBTA 1N5YA 1JLBB 2JLGA 2RB7A 5E0OA 1KHVA 4AQYF 2B8QA 1U1OA 4BWMA 1T05A 1KTVA 5C2GA 2NXJA 3C66A 3DRXA 1G4CA 1LK7A 2B6AB 2DGTA 2VPXB 4WK3A 3G6ES 3RAXA 1OY6A 4B9MA 4LQ3A 1TKTA 3KXDA 2D74B 1M1GA 4R0JA 1NU4A 2JVRA 3D66A 1K9MT 4ID5A 1Y3JA 2HHTA 4CIOA 3PW4A 4B3OB 4LF9J 3JXOA 4O0NA 2PFDA 3MM6B 3MFIA 2EI5A 1FXRA 2E1AA 2XWXA 1EAYC 4N76A 2VQFJ 3CD6S 4M5MA 2C28A 3CO9A 2HIYA 3W9JA 3KJVA 5J1NA 4RJVA 1PC5A 5B09A 1HHSA 1JX4A 1URNA 2BYCA 4K50A 2YWWA 3KUEA 1FFGB 1I3OB 3IAM9 3MEDA 3Q8QB 1RT7A 2GZOA 5B0DA 4DQQA 5MLCV 3KLEA 1X4EA 2IDLA 3GSIA 4EBDA 5K9FA 3DU6A 2DEIA 4QIGA 4Q2MA 3PEJA 4LR8A 2V8HA 4CLPA 1IJEB 1MROA 2ZUAA 1OYEA 3TZWA 1UCNA 1B0TA 3RGIA 4IKAA 2OD4A 3J7Z5 2DR7A 4RNOA 1CJKB 2BVZA 1T03A 2ASDA 3ILLA 4NLVA 2HGLA 2B7BB 3HO1A 4KHPJ 3FQLA 3I55S 1S1VB 3BN7A 4ZP6A 3C14A 1NKEA 2BJ7A 2RKIB 4BS2A 3ZZOA 4RW4A 1ELOA 2FC8A 1B4SA 4OI1A 3KJQB 1CG2A 1NPPA 3K57A 1F1BB 3MGJA 4PQUA 3BKTA 1WHVA 2WVDA 4GKKJ 1ZM4A 4KH0B 1KNZA 1TZ0A 2CQ1A 2HRTA 3BGOP 3FEXB 2ZWPA 5KFFA 5KT7A 1M5KC 2WTFA 5M2UA 3JQKA 1KLMB 2DKOB 1YKWA 2V2VA 3T5HA 1WG1A 2AGPA 4JV2A 2ZH4A 5HLFB 2EG1A 1M1HA 3FNNA 2UXCJ 3MPVA 1PYSB 3EXYA 5BR8J 2F8HA 1ZETA 1H7XA 3NNHA 3QIPB 1EQMA 2MTLA 2XMKA 1RAJA 3T6JA 1IWAA 1NBEB 4OFZA 5CYQA 2YWFA 2FY1A 1I94J 1XC9A 2R7UA 3DYAB 2YNHB 3QSIA 1XIQA 3UN3A 4B3MF 3ET6A 2V67A 4FKYA 2BKPA 1F6TA 3VALA 1HBUA 1JLCA 2H4WB 2VFUA 2OH2A 4DV6F 2C3YA 1DAXA 5KT6A 4OX9F 1WF0A 4L74A 4P6QA 3SV4A 1T94A 5G0RA 3D0GE 1EHWA 4S0MA 1OSCA 4NZ6A 2HNDB 4LBHA 1LV5A 1V9OA 1VQ7S 3R6GB 4F3OA 2FJXA 1Q8KA 4X62J 5DLGA 5AXMA 3J81j 1KVJA 3NS7B 4DV3J 1NCLA 5AE2A 2RRBA 2HFOA 2UVRA 3HVWA 3CDEA 4WFYA 4DV4J 2VKZG 5A0YA 4IFYB 3FSIA 2R3VA 3MM8A 5CD4H 5LM7E 4HH0A 3U7JA 3ZTOA 4LRDA 5KG0A 4DG1A 1OPZA 3KUGA 2VG6B 4JP8A 2CNOB 5IV4A 2LDIA 2YXLA 2HKEA 3A4TA 2OPQB 2Q3PA 3GZ7A 1PAEX 5KFUA 2APOA 1KC8T 4GVLA 5KFTA 1T9TA 2GX8A 1S76D 4ZDNA 3MAHA 4J5OA 2YQ1A 1PCAA 1BHNA 2RT3A 3PY8A 2HWTA 1NZ8A 1NMEB 2B4VA 3MUTP 4RKUC 3TQ1A 4C6AA 3BSCA 3IG1A 4P7VA 4EI2A 3GIMA 2R7RA 4LVNP 2B4PA 4WIIA 3GWCA 1ZM2A 3M2UA 3TOQA 2L08A 4YS2A 2JOQA 4KB7A 3R6LB 3HT3A 1EARA 2A6OA 4OQJA 4DR6J 3O1LA 1B64A 1AXQA 4EWTA 2VFVA 4IDKB 1FVQA 2FTRA 3CB4A 2N7YA 3LWLA 2C2DA 3BKFA 2FJWA 1HFEL 1BC6A 4IG0B 4TKTA 2FQQB 4IH7A 3DRPA 2MKSA 2Z2YB 3CJ0A 3FEYB 1RABB 1S10A 1MN9A 1BQMB 4M94A 1UFWA 5AXKA 3THVA 4AE5A 4RW6A 4AXJA 3OL7A 3RBDA 3H90A 1TL4A 2F63A 4XIUA 2V94A 3IS9A 4WE1A 4MFBB 2ALZA 3PX4A 3BGLA 1OMSA 3BJYA 3EDQB 1S77D 2RF2A 1DTQA 1UJ4A 5F9NA 4OX8A 5LSOA 2Y9HA 2W4DA 3N6MA 4ED0A 1NSQA 2DIUA 1R8AA 4IQMA 4OHWA 2R2RA 4NLTA 1QSSA 1N88A 2JL9A 1S6PA 1T95A 3R27A 4V19J 2XGQA 4HDGA 4IFVB 1RB0A 2EWHA 1NXIA 2A10A 4ECVA 1UEVA 1KONA 3CF5Q 3IFEA 1U7LA 2G13A 2HS4A 2G1HA 2CVIA 1AYEA 3GJQB 1RAGB 1HBOB 3M8QA 2BW7A 1J5OA 4WJBA 1FJGJ 4GKJJ 2WSCC 4RNMA 2KT3A 1DTTA 2AYEA 4DI6A 3ZFVA 1DBDA 3G8QA 1Z2LA 2OEJA 3GU0A 3T3FA 1F2HA 2QYGA 3A3OB 4LRBA 3QO9B 4DL6A 2V2KA 1ZM3A 5LMNF 5B0BA 5IZHA 5HN0A 4FF4A 4PUOA 4JI2J 3GQCA 1JNRB 5L1IA 2LEPA 1S4EA 3C16A 2UUCF 2RMLA 3EX7B 3I0SA 2K1RA 2YKQA 3CNQP 3DOMB 2NUUG 3A8JA 3H2VE 3LANA 2BM1A 1IWGA 5HMZA 2LP4A 3B6BA 4DR3J 3GJSB 2IBKA 1UJ6A 4J9UE 2HNZA 3FSYA 1FRIA 4IG3A 2DNPA 3AOAA 1FJ7A 5A8WB 1QAJA 3HHNB 3EZOA 5ETKA 2VHGA 3OTEA 1OO0B 2H5EA 4DWIA 1ZYQA 3TYTA 2GAGC 2XYHB 2CUYA 1T8EA 3BSOA 3J7A1 3TUPA 1FJCA 5B0EA 3HHEA 3KHLA 4DFJA 1B0VA 4K4ZA 3AXKA 2QEXS 1JLQA 2KKHA 1UW4A 2BQ3A 3R7SB 1JLGA 2I9SA 4DSLA 3CD0A 3MUVP 5D8HB 1ICEB 1YTYA 2Y1IA 3CD5A 3MEEB 4U8VA 4ETZA 4YP3A 1JLEA 2P5VA 2QSFA 1QSYA 3MUMP 4ZKAA 1T3OA 2C3UA 4OI4A 3V4IB 2B5JB 3GIJA 5DQGA 3MEKA 1TV6B 1GK8A 1P1TA 1YJVA 1H2TZ 2B9YA 4JYAJ 3QJPA 2YX1A 4ZVRB 3EVOA 1B7FA 4F2RA 4DS4A 5L46A 3D1OA 5CZXA 4NWBA 4NEYA 3OUYB 4AD6A 4KJIA 2WSEC 2HS0A 1N32F 2VJVA 3CIMA 2B4UA 3RU0A 4X4SA 5C25A 4C98A 1WC5A 3UWTA 4CH7A 1ZOTA 5HSPA 2KFNA 2JJ4D 5BYRA 4DHVA 5D0GA 5AJ3J 2BE2A 3W2VA 8AT1B 2DHGA 3T5JA 3TX8A 3NBPB 5F8NA 1HQ2A 1RE1B 4HKQA 5L38A 3VAJA 1X5PA 1S5ZA 3BGRA 2GMHA 2IIHA 2O1PA 6AT1B 5H9FK 2VPWB 5D4LA 4R5PA 3MPDA 1N56A 4FBUA 3GV8B 1RT5A 3NNAA 1DARA 3NCQA 5JUMA 2A2DA 3OD2A 2FVQA 3SCJE 2DNGA 4R8UA 4U7UD 1HQEA 2CPEA 3M9MB 2YQ3A 1S1XA 2Q79A 3RBXA 1U1NA 1TUGB 3OFHA 3DLLQ 4NLPA 1SQGA 3OR1A 3R2CJ 5KG2A 2DGSA 4DLGA 4P2SA 4F8RA 5KFAA 1YJUA 2WOMA 2KJVA 1RISA 2YKMA 2HPUA 2VG5B 2KB2A 3GJTB 2Q66A 2PC6A 4YEAA 1LWXA 5B7WA 3RRHA 4OHVA 1HWJA 4KGMA 1SIWB 4DR1F 3CCRS 2AHOB 4O4GA 1U6BA 4LIRA 4FYDA 2KXFA 3OSPA 2DT9A 1FK9B 3BEGB 3VAIA 3GCXP 4ZN3A 4Y00A 1K0TA 1L3KA 2R8KA 3FKBA 2ZJQQ 4R25A 1Q4RA 3D6MB 2W7AA 2DD8S 4H4KA 4A8FA 2C1EB 2CQIA 2OMOA 4ZJQA 2LQBA 1SH0A 3OVSA 3SFGA 4OZLA 4QWBA 4TQSA 4GC6A 4ELUA 4WU3A 3OL6A 1N6QA 1YITS 2ZM6F 1SV5B 2FHJA 3PW2A 4Y34A 5KFEA 4KV8B 4L3NA 3UI3A 4NZ7A 3PHEA 4ED1A 1EP4A 2E7VA 4YB6A 2YKAA 5IV3A 5ADZA 3CCUS 3T1YF 3W61A 4ZVQB 1FT8A 1XR6A 2EW9A 4ECTA 2PMZD 1X5OA 2UZAA 4FXWA 3M9OB 3R5JB 4CDIA 2HGMA 5B08A 1NPKA 1RBAA 1X4BA 4FYWB 4F7VA 2CVEA 2ZHAA 3CCWA 2XY5A 3EGZA 4DBQA 4HACA 3Q2SC 5KFXA 1TFWA 1HBMB 2HBYB 4W4MA 2OELA 3G2XA 1N5VA 5KFSA 1IKVA 5B0FA 1T0TV 2HRUA 1JQGA 1AZSA 3HLUA 2XZWA 1DZ5A 5D78A 5GAEU 2M70A 3M32A 3M1VA 5HROA 1S72S 1J27A 4H54A 4YFUA 1VBXA 4WXWA 4MKVA 3EYZA 4CO3A 2CPFA 2EC0A 2V4RA 2EFPA 2W2MP 3THPA 1FTRA 1RTZA 2EEYA 2ASJA 3O6QA 3A8EA 3JB9k 1YVFA 2MHNA 2YPZA 3AT1B 4KGKA 4PEOA 2BXJA 3JQJA 1T05B 2KDOA 4WFXA 5E3RA 1R7IA 2QMXA 4ETXA 1S6UA 3G6YA 2BJDA 4UY85 4DSIA 1TKTB 2QA1A 3MDFA 2Y0SD 2XMAA 4NLRA 3CJ3A 2PD1A 2XULA 3MURP 4DR4F 5DM7Q 4ID5B 4ZA1A 3P5BP 4EUVA 5A6PA 3D67A 5IQQA 1S7IA 2KU7A 5EUHA 1NB7A 2ZVSA 3IWXA 5LMUJ 3MECA 2V6AA 2XS2A 2YX4A 3KMSA 1F5BA 2RDDA 4AQYJ 4DSJA 3KJVB 1C4AA 3D4JA 4H4MA 4TU7A 7FD1A 2UXDF 1UVKA 1VDHA 3MEDB 1RT7B 3KLEB 4OYMA 3D2WA 2V63A 5KTQA 3NGRA 1MWQA 3D5MA 3POTA 4TU9A 1Q8BA 1MROB 2NCKL 3FK4A 2MZJA 2OTLS 3F41A 2XLKA 1IM4A 2MSTA 1UVLA 1HIYA 4DJBA 2MY7A 1T03B 3AA8A 1F5AA 3KK2A 5C5JA 4C7QA 1O8BA 2XO6A 3OV7A 4E2FB 3AHPA 2GGPA 3UCUP 4JOUA 3C46A 2J8SA 3DDKA 4ANEA 1G6BA 2GIRA 2HVEA 4PPDA 4RW4B 2AF6A 1EB0A 4JI5F 3EPGA 1YJRA 4PQUB 3VZIA 4DL0C 4W92B 2NXUA 1U0HA 1XNQF 1F3FA 4RWXA 3SCIE 3VQTA 4ES2A 4RBTA 2BABA 3T9ZA 2KHCA 3UFCX 3UCZP 1FE4A 1RU1A 3W65A 1REGX 4PWDA 3UVJB 1YSJA 4IH6A 4MJKA 4CT9A 4NE9C 4M5DA 3N9UC 3UNYA 2PA8D 4DX5A 4FKXA 4AUKA 3D3CJ 1RDRA 4GO7X 3K58A 2JNJA 5G4DA 2YKPA 4QYZK 4LFCF 5CYQB 3HSGA 2CZ9A 3LUYA 1JIHA 2HVDA 4IRDA 1N33J 4U7CA 1LFPA 1UKUA 3AJDA 3ET6B 4WIQA 1FDAA 3W66A 4JI0F 4ZVTB 3W5YA 1HBUB 1JLCB 1RLCL 4L3KA 2GFFA 2KI2A 2HMIA 2UUWA 4X4VA 3ADAC 5F8MA 2FHJD 3M2VA 2MKYA 2IMOA 5G0RB 3D0IE 5KFKA 3AD7C 3BPDA 4KR0B 2UVWA 4O23A 3ZXWA 1EIYB 1VIOA 2HEKA 3P4UB 4NPOA 2YKOA 3MR7A 2L3MA 3RBZA 2XWYA 4MYTA 2M5YA 4HHJA 5C42A 4JV5F 5HVFA 4MTPA 2PN6A 1NSPA 4LQ9A 1HPZA 4FBTA 1GT8A 2PEBA 2QA2A 4C0BA 2QX0A 4DMZA 4J9RA 1YQHA 2EFQA 5A0YB 3MM8B 2D9OA 2WZ1A 4QR1A 4DG1B 4G3IA 3RG6A 1GMWD 2V5HG 1N5TA 2CZVC 2MJNA 3GLJA 2YTCA 3MXHP 3CJ5A 2RHSB 2MQOA 5CYJA 4USVA 1MSWD 4NYPA 5L39A 5H9EK 2HLTA 2DH7A 1Z2ZA 5M2RA 1V3SA 4NZ0A 4Y6IA 4K4YA 1MMLA 3K7RA 5U47A 2A3JA 2KZZA 2ZHBA 2YWEA 1S9GA 3B82A 3D1QA 5K8OA 3AQPA 3IG1B 4EBCA 2I1RA 2XEXA 3CCLS 2D41A 4OYIA 1WOPA 1WWHA 4TN2A 3RYLA 4DOZA 5K8MA 5GAHI 2ADCA 4OHYA 1ZZNA 1GX5A 2WBRA 2IYIA 1TL7A 3DN9A 3O2IA 3U1LA 3MMJA 1VQNS 5JJBA 2HVZA 2OI2A 3LO3A 3DM2A 5EWFA 4OZNA 1MWYA 2IDEA 3TEGA 3IRWP 1M5HA 4G1IA 3IAS9 4DCOB 2BJEA 1ULRA 3JSYA 5D3GA 1S6OA 2WONB 4UOHA 2VODA 2FVSA 5E3AA 3PFEA 4ZVGA 3V6DA 4JI3F 2H5JB 1RHMB 1TK5A 3KLVA 1FTCA 4RW6B 2FGCA 1BD6A 3HD1A 5KOWA 2HK2A 3TAMA 3G8SA 1B70B 3T1HJ 3H5XA 1RHUB 2DRBA 3IS9B 4G1QA 3IM9A 2E9ZA 1PYTA 1XTZA 4WE1B 2IC3A 2J6TA 2IVYA 4P72A 2CZ4A 3CCJS 2AGQA 5E7OB 4YHHF 1DLOB 2K7KA 4QWAA 4U9RA 1XNRF 2RF2B 4RNHA 5THWA 3NGKA 4OI3A 5IFMA 3OFFA 1DTQB 1QTMA 2CJ9A 3BYRA 2N82B 5LXRA 4ZCMA 3PYEA 5K8NA 3VV2B 2L41A 3QBCA 3NP5A 3FBEA 1YZ6A 4NLSA 2ZH7A 2OKQA 3DHWC 1Y5NB 4W98A 1SC1B 4ECSA 4LF9F 5E33A 4X66J 4AT1B 1VQYA 3HSDA 4MAKA 2MXYA 3IRXA 5KT3A 2VQFF 1TU0B 2K3KA 1QE1A 4LVOP 3M8QB 3OTBA 4NA3A 2E5GA 4DX8H 1XN9A 4AL5A 3G6VA 3DXSX 1RWOB 2GJ2A 1U2FA 2XHWA 1DTTB 1SJ4P 1UA1A 3ISZA 2BKNA 2W2NP 1CC7A 3I31A 5DO2A 2IY5B 3UDVA 2BA9A 2YH0A 2DGXA 2RNEA 4RBUA 2JEFA 4USHA 1RCOB 1U09A 9RUBA 4P75A 1QSLA 2FHMA 2VJUA 3KK3A 4ECYA 2WVBA 2WW4A 2X1FA 2ZDOA 4M95A 1BUXA 2A0FB 2BRLA 2J9DA 4N8NA 2D9PA 2HNYB 2FZCB 4NLQA 1FWPA 4ECRA 4LR7A 4KHPF 1Q16B 2HLUA 3C16B 2HGNA 2ACMA 4RX6A 3I0SB 2K1RB 3Q89A 2BQRA 2G0IA 3BDPA 2HS3A 2MY8A 3MMCA 2W8LA 4ZOSA 1UZHA 5IC6B 2O66A 4J9SA 1YRXA 3TNVA 1FO1A 3GTYX 2GQQA 3Q22A 4ECXA 1I1GA 3GE9A 1J2VA 3GG0A 4PXBA 1F9HA 5KG7A 1FESA 4CP5A 2J0WA 2HNZB 2YWGA 2F3JA 4GKKF 1SXLA 4IG3B 4ZP8A 4CT8A 1C0UA 2ZJRQ 4MK7A 5LMNJ 1RGVA 4X64F 2MZSA 1U1RA 2ZBIA 4USIA 5CZVA 2EBGA 1YI2S 1TMJA 3NL0A 2UUCJ 5D0EA 2AJ2A 3V2UC 3C6UA 3LGHA 1UJ5A 2DHAA 2QL9B 2BJ9A 4DN0A 2UXCF 2VFRA 3ETOA 4YDXA 3ULHA 5BR8F 3HSJA 3M4XA 3J81U 2UU9J 2WVFA 1HD1A 1TL1A 5A8KB 4QWEA 3N4WA 1GAOA 3CULA 2NXCA 4J9OA 1HNZF 1LFWA 1RA7A 1JLQB 4TYBA 3MOZA 1JLGB 1NKCA 2FVPA 1SQEA 2CQ2A 1XJWB 1N0UA 2F8EX 3CWJA 2W24A 4OJ3A 3GR1A 2C2OB 2CQ3A 5HAOA 3ILIA 3LGNA 2DVIA 3J7YI 2RH3A 2GAHC 1KEKA 2Z0GA 1NJXA 3K59A 3C2PA 3RW7A 3QIDA 2UV8A 3QT5A 3A12A 3A1YG 2DH8A 3E51A 1Y10A 2BW2A 4I6WA 5J2MA 2L9DA 2ZBPA 4Y2AA 4LF2A 3DGVA 3PG9A 1C0TA 2IJFA 5KFDA 5DGAA 2NYIA 1N36J 1KQFB 3KKFA 1WUUA 3S6EA 4X62F 4EYIB 1HYSA 3LPYA 3W8GA 2PSZA 4DEZA 2J0SD 2GQCA 4DV3F 4NL5A 5KG4A 1UMJA 1HHQA 1VBZA 2X7IA 4MKBA 4DV4F 2BZ2A 1M5OC 2Z30B 4CLZA 1IN0A 2JLEA 2J9EA 2E9RX 2BE2B 5DETA 3W2VB 4DQPA 5HVHA 1FD2A 2HHXA 3OL9A 4F3QA 5T41A 3KLFB 3BGRB 4UT4A 4I64A 1R43A 4ES1A 3P5TL 2X3DA 4R5PB 1RT5B 2E29A 3EXCX 1DURA 4R8UB 1O0PA 2QRRA 2B4OA 1HQEB 4O3NA 2IAJA 1S1XB 2L48A 1Q78A 3OR1B 2DBBA 3CCVS 3PRVA 1NSKL 1HI8A 4DV2J 2WOMB 2YKMB 2DR6A 3PHTA 1S0MA 4OIXA 2N7CA 2VC1A 1K8AT 4HT5A 5KT5A 3Q8VA 4DUYJ 4WFNQ 2NUHA 2EKNA 3N6NA 4DR6F 3NEKA 4OZ0A 1TL3A 2V50A 2DHSA 4O4GB 1GXUA 2HVIA 4ATNA 1L5UA 4RW8B 3BV8A 4EMDA 1M5PC 1S97A 2V68A 3PW5A 2KXHA 1VQ5S 2HBRB 3IM8A 1F3VA 1FERA 4Q45A 2QLXA 4LF8F 5CXTA 2GIQA 4WZQA 1N6QB 1IQZA 2CQPA 1R6VA 3Q0AA 3TZXA 1KWMA 5DZ6A 2VICA 3SQOP 5AXNA 4ZP7A 2FJAB 2C2KB 2JFKA 2L9NA 4H4OA 2XB2D 4MIAA 1FE0A 2BQUA 1EP4B 1T9YA 1WKJA 1C4CA 2E7WA 2YVSA 4NLWA 2R2TA 3B54A 2XI2A 5D6GA 5K14A 1RI7A 4CH0S 1CULA 4K4XA 3EVWA 1QM9A 4CTAA 4HH1A 1RLDA 3R5DA 3BBFA 2AYBA 4O44B 4HACB 1K47A 4G1PA 3LP0A 1RACB 1APSA 1VHFA 4E8UA 2W01A 2V9WA 3CJTA 4ZCKA 4BCAA 4USMA 3BM7A 2JWNA 5F8HA 2UP1A 5I42A 3M1VB 5HROB 1JKHA 5CAAA 2V0NA 5J1PA 3HHDA 2W4CA 3QAUA 4HI1A 1FJGF 1RHKB 5LXYA 3FCVA 1SH3A 3KK1A 1QVFR 3LF0A 2VPZB 1QAIA 3HHLC 4K7QA 4O3OA 2P2CB 3CGIA 1U2RA 3TZZA 3TUZC 2JC1A 4ZJLA 5EN1A 2IM2A 3GIKA 3UR3C 1T02A 5IS2A 4DUZF 4NLOA 1EETA 2FLNA 1ZAXA 2MQMA 3BGFA 3R5GA 3FDSA 3O3LA 4JI2F 4EBEA 4QYRA 5J1EB 3W5ZA 4RNFA 1KQSR 2HWIA 1Y7PA 2AJ4A 1JMTA 2ZE2B 4UOCA 3CCSS 1TVRA 1UZDA 4LFBJ 1Y5LB 3I0RA 3KWMA 4RUHA 2QIFA 1FVSA 3LW5C 2DGQA 1R6YA 4PR6A 4Q8FA 2ZHOA 3RB0A 2XMMA 3DGPA 4X4OA 4DR3F 1D9FA 4H4MB 4I67A 2Y8YA 1AUSL 4PPZA 2FVRA 4C8ZA 3FGVA 2C2EA 4F67A 3D1HA 3POTB 2AYGA 1LNQA 2QFIA 4Z2XA 4DR4J 5K8PA 3AQOA 2C3MA 1N34J 2ROPA 5ETTA 5F9LA 2ZKTA 4LREA 3R3TA 2FLLA 2F40A 3KK2B 4RUBA 1FXDA 2VASA 4XDCA 2F5GA 3M8PA 2LECA 1NDLA 2GGPB 4K4TA 3H40A 2RQMA 4QZVB 1IBMF 3ZZPA 4JI7F 3P8BB 5H1SV 1WNEA 2XMTA 1XERA 1IVZA 3E3XA 2N3OA 5DQHA 2BE7D 3NGTA 2J8AA 4M5GA 2R7XA 1WJ9A 3I96A 4X2BA 1U0HB 2KTQA 2FJVA 2XGPA 3GFZA 2LA4A 2FPHX 4F4YA 3CCTA 5M2PA 2MDAA 4CO5A 3T9NA 4WCEQ 2CNLB 4ZVUB 4WZMA 1AROP 3DKDA 1RT3A 4X65F 2PI5A 1XMQJ 3ZO7A 3TW0A 2J9DE 2X1AA 2VQEJ 1C2PA 4PWDB 1KS2A 3HVRA 2B3TB 4A48A 2NREA 4JYAF 1IBLJ 3ITHA 4M5DB 5ETNA 2R4FA 1UAWA 4HVZA 5EDWA 3IR5B 3N6LA 1P9YA 6FD1A 5DG7A 3MD3A 4RW7A 5FDLB 4CLYA 3W9IA 4FXDA 3CIZA 5AE3A 2OHDA 5AJ3F 2OO4A 5HATA 5SUHA 3OR2B 3BQ0A 2CJAA 1GXTA 2VDIA 2VB6A 3MPUB 1U8WA 3D6HB 3UD5A 1LW0A 3CT9A 5EWGA 2KYZA 2HMIB 1K44A 1YLXA 3CXCR 4N41A 1LQ9A 4NCBA 1IR2A 3M2VB 2ERRA 3FRZA 4PXEA 4MKAA 4F36A 2VV5A 3GONA 4ZLNA 2JFDA 2DY9A 1LWCA 3EDRB 4WFAQ 2CPHA 3HCXA 5F0WA 4A8KA 3LH2S 4U7UK 1HBNA 3TO8A 3WX8A 3PJ9A 3HJFA 3MMBA 5ETQA 3HHLD 3LGMA 5KT2A 2E1PA 2FJDB 4USWA 3IWNC 1G1XA 1U48A 1W2BR 2JC0A 1VJQA 2LQ8A 1WC4A 5IQ6A 2VOPA 2CXEA 2P8IA 3SIPB 4NCAA 4WPAA 4FYXB 2CQ4A 1RTIA 1PC4A 3MAQA 4B17A 1FDDA 3MCSA 4K4WA 1X5TA 2ZC4A 3JYTA 3UPFA 4OI2A 1WG4A 1RT4A 1RWXB 1Z1ZA 4FS2A 1X9WA 1SC4B 4O4RA 2EFGA 2DGVA 3DLGB 4IO9Q 2ILZA 4I6YA 4PRFA 2NSCA 3NWGA 1XEZA 4N56A 5J2PA 4E98A 3TVZA 3JQMA 1RWKB 2F4VJ 4JV5J 1NNDA 3GYXB 4OI0A 1U02A 1GFWB 2DB1A 3QWPA 5DRKA 1S9GB 1X60A 2DPIA 1Q8IA 1X0FA 5KFNA 4DN9A 3MI7X 4PG4A 2Z56B 1UW9A 2AQ4A 2LEAA 4CNYA 3QZ8A 1CSJA 2CPYA 3NGDA 4DSKA 3P45B 2PMHA 4HI2A 4ZIWA 1E6YA 4EO6A 5CQGA 3HFVA 3SZ2A 1TL7B 5E3PA 2YY3A 5MAOA 4FN5A 4B9UA 2M2BA 1WF1A 3DM2B 4FNHA 1VC6A 4WKYA 3KLGB 1TUVA 4AFFA 2Q6CA 4V1Ak 5HO4A 2HQ3A 2ZUGA 5A6WA 3V6DB 3CEDA 5C24A 3CMAS 2PEHA 4P52A 1R0AB 2OEKA 2LXFA 2AIRB 3QNWB 4HTIA 2CG4A 3ENVA 3TAMB 2HHVA 5FLXU 5JVHQ 1RT6A 4DL2A 4G1QB 4ZVPB 4LF5J 4YY3J 4LF4J 2IC3B 1RKJA 1NHVA 2XHCA 1NAQA 2MYFA 3H20A 1SH2A 2YNFA 1LXJA 1D8ZA 1YGYA 3GIRA 3OJUA 2Q1LA 2B0GA 1SI9A 2VFSA 4D3HA 3R9LA 2VPYB 4RNNA 3K5MA 3NRBA 3D9BA 4JB8B 4ILLA 2FHKA 3D3BJ 1D9AA 1RT2B 2IM1A 3VVUA 3ZZUA 2MSSA 2EK1A 2B8PA 1FFWB 3KFWX 3PXGa 3TI0A 2A6MA 5AT1B 1DRZA 1KQKA 4QW9A 1T7PA 2KFYA 1FI4A 4LRCA 3BQ2A 4E0DA 2XMWA 5L8RC 3IRXB 1S49A 5HL7Q 4P73A 3EVMA 1QE1B 4USJC 3H4DA 4ECZA 4YHHJ 3VQSA 3NGUA 2D3UA 1XNRJ 5HJXA 1NHUA 4MT1A 4J9PA 1SPBP 5J2NA 4KT0C 4DPOA 3JSBA 2R7WA 4ELTA 2W2QP 2OMLA 1TK0A 1Q7YT 3IBFB 2HQCA 4TU8A 1ZBTA 1HR0J 2IA0A 8RUCA 3KK3B 4LF6J 2LQJA 3PRDA 2RDIA 1S48A 2KM8B 3MR5A 3PYDA 1SQFA 1VJWA 1VQMS 3SV3A 5KFZA 3A3PB 4OYXA 2ATCB 3QATA 3ZZTA 1S0OA 4RLEA 5F3TA 1CJUA 3W2WB 3MMCB 3QZ7A 1D9DA 2J0XA 3OFGA 3T1AA 2AJQA 2KJWA 1SB6A 1PGZA 1QVGR 2HG4A 5DZ7A 2ZZTA 3VHQA 4GO5X 2G9OA 4K5SA 4C8MA 4UZBA 3FCHA 1VK3A 1WHYA 3DRRA 1C0UB 1U49A 1CJKA 2CPZA 3OFEA 4RL1A 1WG5A 4DLEA 2AMCB 2BDPA 5L1KA 2OPRA 3GFHA 2GW8A 4JI1J 5F8IA 4WYWA 1S6QB 4HL9A 2BOAA 1KD1T 2RHQB 5GMEA 3LP1A 1MMNA 3KG1A 1SIZA 2ZH9A 4HLBA 5KFYA 2CA9A 1TL1B 2XY7A 3K5OA 2Z8QA 1TKZA 3CDAA 2ASYA 5AE1A 2W25A 3W5XA 1OQ6A 3CDUA 1N33F 3FJ2A 4OMFG 4C8YA 5E2QA 3GV7B 4BDPA 3TANA 4X64J 3WBZA 2V8GA 2ALYB 4Y2MA 4KH1B 4F4KA 3N5BA 4BBYA 3DXBA 1HI0P 3EJMA 1SC6A 5J2MB 4FZVA 4YUDA 4ZITA 2C2NA 2Z57B 4OLPA 2Z2ZA 3CUNA 2B9XA 1OYDA 4I4BA 4I2QA 2M8HA 5HBMA 3LOUA 1C0TB 2CJKA 3W1YC 1WC6A 3M8SA 1JLAA 4EU0A 3R2DJ 4IO1A 4ELVA 2AP6A 1HYSB 3RRGA 2CQBA 3G96A 1HNZJ 1UVNA 3LAKA 1SBRA 2I0XA 4C3MA 3K17A 3EGVA 3MPYA 3BO3A 4NXMF 1S9EA 3D6FB 4YOEA 1D1UA 4QOTA 1YWXA 4J9NA 2DITA 1RJJA 1HA1A 4M5IA 4ZPAA 2FLPA 4WBFA 2W7OA 2FY8A 2OEMA 4K5RA 3PO4A 1A6LA 1UWAA 3TEHB 3L7UA 1NDPA 2EVZA 1L3UA 2DNOA 3LALA 2AWZA 2J7KA 1FDNA 2RQ4A 1K0VA 4PYDA 2XY6A 4ZLLA 5IT9Y 1S7HA 2IAJB 4C97A 1TAUA 5DG9A 3V6KA 5GAGU 1JNZB 4LSLA 3M8YA 2IRYA 2PT0A 3BSAA 2QV6A 4NLGA 1DQAA 2G0CA 5HMWA 4CO1A 4XPEA 2MPUA 1U1PA 2HRYA 3L9ZA 5C7PA 1YHQS 4TY9A 1WDTA 2BEFA 1FX2A 1VCTA 2HWHA 4P2FA 2HHQA 4J7CA 2OPQA 3VAFA 4B3SF 3BS9A 3I6PA 2M88A 1YG0A 1TL3B 4WXOA 2POKA 3G82A 1WKKA 3VCDA 2B43A 2QA4G 1TKXA 3QRRA 7FDRA 2RE1A 5KG6A 2I5JA 2AX0A 3OVAA 2B51A 3CJ4A 2B7CB 1Q5VA 4C0HA 4FPIA 1RWNB 1FXLA 1KFSA 5HP1A 5FJ4A 3GJRB 3T1HF 5CCLA 2HHUA 4M63A 2HFZA 3CTRA 2HZCA 2XG8A 4H4OB 4FYYB 4TLRA 1H73A 1M0SA 4TQRA 2LLZA 1YDLA 2FJEB 3PKMA 3E01A 2DNNA 3CE8A 4OHXA 2JEJA 2GNKA 5GAEI 3ILJA 2YWKA 3TA0A 5K14B 3EWGA 3MM9A 2ZVIA 1CULB 1HKAA 3IR6B 4CTAB 2UVVA 4Q2LA 1FWLA 1H7WA 4C8LA 1NK4A 2DR8A 4FS1A 5GAHU 2ATLA 2UVUA 4K2XA 5JMNA 1UPPA 2XMJA 5HQLA 3LP0B 3ZTPA 1FFSB 1WEZA 4LF8J 3A8IA 3GMGA 2IVMA 3C6TA 3S01A 2DEJA 2BRKA 4X66F 3DLHA 1JJHA 3OQ2A 1R89A 1TUWA 1CEZA 5I42B 1JKHB 2MKCA 3RW6A 5DDPC 1IR0A 2WSFC 1FRMA 4A46A 4ILRA 2EFOA 1XR7A 2QE5A 4EFAC 1RYSA 2G4BA 1GH8A 5DQIA 3KK1B 3DDNA 4Y65A 4JI6J 3S1TA 4GVBA 2CKWA 2GHPA 5I3UA 2HHHJ 4DZ6A 3TP2A 1KVKA 4J90A 1XK8A 4ED7A 3FRYA 1S59A 3PVXA 4USUA 2N4CA 1NJIT 2B56A 5GADU 2AKWB 2DCLA 3SDEA 2QZ8A 4I68A 3QPIA 1EETB 4CO4A 4X84A 3DDIA 4ZPWR 1X9MA 4V19X 3JAMY 1VQLS 2VC0A 3KNGA 3MM7A 2W9BA 3HZGA 4WYLA 3DI6A 4F4XA 5KFMA 2MZRA 2HAIA 3VZHA 4A8QA 4ZVHA 3SEOA 3JTPA 1TVRB 5E3QA 3SSSA 3KTQA 5F8LA 2OAUA 2ZOFA 2MLXA 5DJBA 4CYUA 2H48B 2UUTA 3DGPB 1RU2A 5L9NA 2W1BA 3P6YC 3TRGA 4NA2A 4DDFA 2AGOA 4DUZJ 3IMQJ 1BXNA 3RJMB 1L3VA 2DGUA 1S0NA 3E2EA 1KBRA 2KVIA 1TFYA 3NMRA 3HZEA 2R7VA 4OYOA 1T3NA 3UDLA 3CO0P 1N52B 3UR0A 2BUNA 4DV0F 4WFBQ 4TY8B 3I32A 2RVJA 1Y4ZB 2UU9F 2Y0BB 1KOHA 2PDAA 3BO2A 4OYBA 3WQPA 1S9FA 2DISA 2XSFA 1Q95G 2DRDA 5D15A 4L76A 3IN5A 2JSXA 2HAFA 2QA4S 1UFKA 1RAIB 1NJWA 1C1CA 4C11A 3IBWA 3QWUA 2I2YA 3BO4A 3FSXA 2UXBJ 2LDYA 4W90B 1IKYA 4BC7A 4TLQA 3FQKA 4F26A 3UO0A 1RT3B 2A2CA 2FUG9 3KHGA 1VBKA 1X4HA 1JB0C 3MD1A 4ZCIA 4DR2J 1YJTA 5IM0A 3AAWB 3ITHB 1N36F 1IBMJ 4JI7J 5IT0A 2UV8G 4NLXA 1V6HA 3GIIA 2PGCA 4LRAA 4CLTA 4RW7B 3D28A 3NCPA 3ELHA 4OJ1A 1TKDA 1H2UX 2R2SA 2CAJA 4KFBB 3HSZA 1GXLA 1S4FA 3Q8YA 1NJYA 4F04B 3QT7A 1G7CB 2VBWA 3H25A 1LW0B 3BB5A 1SKUB 2XS5A 1F9EB 3NCRA 2RAQA 3WX4A 2VL1A 3RRKA 4X65J 1HQUA 3AFGA 3N5FA 4FDFA 5E5NA 1Q5YA 4ICLA 3W3SA 2P6TA 3J7YU 4YR2A 4UQGA 1YJ9S 4RU9A 1HBNB 1LWEA 4KHMA 4NEZA 5J2QA 3PDNA 3MMBB 1U1MA 2MZTA 2HHPA 2G2ZA 4DV2F 4DXLA 3P49B 1DHMA 1F5CA 4URGA 3DOLA 4F25A 1RTIB 3VF0B 4DUYF 1YJNS 2QG9B 4IYQA 3RZAA 2GA7A 2DPJA 3BZQA 5HQMA 2XNRA 1AW0A 1N5QA 3TWZA 1SJQA 3KHRA 4ID8A 3LP2A 3SI8A 3ZTSA 1RT4B 3J80Y 3H42A 2DNQA 2CPIA 5ETRA 2EXUA 4LF1A 3BREA 3IBCB 2HBQB 1U45A 4ENOA 4I69A 3QQCD 3AB4B 1QUPA 4QIEA 4CZCA 2CNKB 5ITHA 4OX7A 1KN6A 3JSRA 4Y2KA 5J2PB 4DV7J 4NX9A 1YJ7A 5IWAJ 4YMEA 2UUAJ 4NXNJ 1VFJA 4LBPA 3F0NA 2MQLA 3M05A 3DRSA 1S0VA 3TQEA 3T41A 1O5JA 1VLOA 2XLIA 1CQMA 2M0GB 3OLBA 4NI2A 1REVA 3HJVA 2JLFA 4C8OA 3TJ8A 1RCXB 2CG8A 3OTOF 2NR0A 1E6YB 3HXMA 2G2YA 3Q83A 2DK2A 5B0GA 5EX3A 2DNKA 2E66A 3HP6A 1LW2A 3RB4A 2AZ3A 2P9CA 4O3PA 2RS8A 3N01A 1ZAWA 1AT1B 3PX6A 1GMVA 2ZNZA 3G87A 4OX6A 2K3IA 5LOQA 4MKYA 1RWVB 2CJBA 3PW0A 5HI7A 4ES3A 1H6KX 5KFCA 3FC9A 4M5HA 5C24B 3FZ2A 3CJKA 4DQSA 1WORA 4B08A 2XSJA 4URSA 1C1BA 4NLYA 1RT6B 1VBYA 3QT6A 1TMMA 1W2IA 4HDHA 5D0HA 5LJ3Y 3BH7B 4C3LA 1EQ0A 3US5A 4CRJA 4KC5A 2YNFB 1IKWA 1RTDA 5IT9U 3QYYA 3W7BA 2HIQA 4ANDA 2RJZA 1CS4A 4ECWA 2GV1A 3WC0A 1A7GE 2E5LJ 4DL4A 3TUIC 2GJFA 3MZIA 1GMWA 3SXLA 4XTTA 2PI4A 2M3DA 1PJ6A 4L73A 4YB1P 2K7JA 1JJ4A 3H7HB 1X4FA 3BKUA 5ETSA 4DCJB 4HHHA 4CLKA 2QLBB 4LFBF 3GR0A 1FRLA 1S57A 4K0KF 1N5YB 3M2RA 4RUAA 4DV5J 4OJGA 4CO2A 1NH7A 1HWIA 2BMBA 3J81Y 4USTA 4O0IA 3GSDA 4KTQA 5J2NB 1WSVA 1R0CB 1CPZA 3FBFA 3K2YA 5FD1A 4ZLPA 4F4AA 4D3GA 3K5PA 2FDNA 3NLCA 2LKZA 2YNIA 4Y28C 3QLHA 4I7FA 5JXSA 3SBMA 2CFXA 2GVDA 4KHRA 1N34F 1VK8A 4Y3CA 4IUFA 1Q79A 2R7SA 4KPYA 2H1YA 3OPKA 2J5AA 2J6UA 5A8RA 4HT7A 1X4GA 2CPDA 3OVBA 4I2PA 1EKSA 1CJUB 3AD8C 4KGXB 3NMAA 2RU9A 4B9NA 2X1GA 2ZKUA 2DYAA 4U96A 2GVZA 1JXLA 2VBZA 2J6SA 1FKPA 5KFJA 3U1NA 3PJXA 1H0HB 1P6TA 3H5YA 2QLJB 1ZPVA 2BM0A 1EKRA 3OXLA 2YBVA 4DPUA 1Q1KA 2M7SA 3UN2A 4RW9A 4DZDA 2D3O1 5LSRA 2C42A 4ZMMA 3DRRB 1W25A 4U6PA 2JX2A 1SKWA 3UD3P 5I3QA 1RWUA 1O6XA 1XMQF 2ACYA 2DR5A 2OPRB 5KFVA 2VQEF 1S1WA 3I87A 1WC3A 3JTOA 1IBLF 2ROEA 4XPCA 3PZPA 1S79A 3VGTA 3C14B 4ZCLA 3H98A 4FF1A 3LP1B 3PM9A 2IYGA 2DHHA 2HQFA 5K20B 4X4TA 2F7VA 5ETVA 5CHCB 4K4SA 3G6XA 2P6SA 2VD3A 3FFIA 1TKZB 2MGZA 2QLWA 3DLEA 3PYFA 1U6ZA 3JAMU 4EZ9A 3PJWA 1FA0A 1H74A 3HT0A 3BR8A 2D3OR 1IUJA 1UP1A 1R8HA 1A0OB 4NA1A 1MLAA 1SCJB 2ZFHA 1GTEA 3PRBA 3SMZA 4QQBA 2HFVA 3IR7B 3UVJA 4QPXA 2DNRA 1KSPA 2F9DA 1U0SA 1S1TA 2J0QD 1IM6A 3FUYA 4I2QB 1HNXJ 5HJYA 5HBMB 1FKOA 4QR2A 3KMQA 2ZH8A 1JLAB 2MQPA 1HL6A 3VGVA 3L09A 3V81A 1FRHA 3GFYA 1FWKA 1WTBA 3M6UA 1P27B 4QCLA 1CC8A 2DHXA 1VS3A 3OHBA 1FJEB 3EE3A 3FBBA 2HZAA 2I38A 2MQ8A 1PIEA 1S9EB 3OXGA 4CM2A 2ADBA 1J5EJ 5JVGQ 4RBVA 2KHDA 3TJAA 3X1LB 3Q24A 1MN7A 1RTJA 4KSEB 4Z7CA 2WK4A 3C15A 1U4BA 2KRBA 1E6VA 5D77A 3N28A 2IJNA 2VF3A 1XMBA 1R0BG 2V8DA 2QFJA 5CA5A 1VRQC 2Y1LB 1ZZFA 2R8GA 1GQEA 2F4VF 4X4PA 2R42A 3ZZ0A 4ZLJA 3UDCA 3PYGA 4LSLB 4LSNA 1UEUA 4B9SA 4P74A 3W9HA 2XC9A 4NXMJ 3K0JA 2NPFA 4DPWA 2MZ1A 4OYWA 3C19A 1W7WA 3B8HA 4XDDA 5F8GA 1F2GA 4BWJA 4A47A 1UA0A 3VGUA 3CC7S 3UD4P 2W7PA 1FDBA 3CC2S 1OS5A 3G82B 4UF4A 3TZYA 1FRXA 1TKXB 4EO8A 2GJIA 2MZQA 1D0EA 3QGGA 3PO5A 3S7RA 1BGXT 1UVJA 4P10A 2X51A 2E44A 2I5JB 2E5IA 1P9QC 2NXEA 4EZ6A 1CQNA 4DR5F 1Q81T 1JWWA 5HP1B 1LEOA 5HANA 5A2QY 2J7UA 1OY9A 1BE4A 4UW2A 1R8CA 3TVYA 1U2CA 3M2UB 5ETPA 2KG0A 4LF5F 4YY3F 2QN6B 4LF4F 2QJ3A 1Q53A 2E7XA 2X3GA 2OUGA 3HM9A 1KQGB 2C3OA 1VRTA 4LRFA 4B3SJ 3E01B 1ZA2B 2QL7B 2HHSA 3PW7A 1ZH5A 4K8RA 2IJRA 2KRRA 1YJWS 3T19A 1WDDA 3MM9B 2WONA 1FNXH 1JJ2R 4YDDB 3HKZD 3DRPB 2MLYA 2W8KA 4PYAA 1FEHA 5ETMA 2LVWA 2H3EB 5FIIA 2DO4A 3MFHA 3CJSA 5KFBA 2HSEB 3H4BA 4DFMA 3MTJA 2BBEA 2M4MA 3C6TB 9ATCB 5LL6d 2AJ1A 2EG2A 2Y8WA 2VONA 2IM3A 4YB7A 1TTHB 3W8PA 3J80U 4DV1F 1NEEA 5GMDA 4CM0A 4NRUA 2QLFB 1IJFB 2CIMA 4GRSA 3NNCA 1DLOA 3QAEA 3FZBA 4GVBB 3MM5A 4OZ3A 1BQXA 5I3UB 2ZBQA 3KUHA 4NLDA 2LU2A 1XMOJ 4WTOB 1PYOB 2NXNA 2IMWP 4ZHRA 1HR0F 3SDEB 3D6TB 2UUBJ 2AYMA 1KFDA 1WOOA 4LF6F 3R97A 1S6PB 1KHWA 4YR3A 1IR1A 2O01C 5H9FJ 1WELA 4QWCA 3MM7B 2W9BB 1PILA 3DI6B 1JXEA 2GQ2A 3BH6B 2VBYA 3OLAA 5KAKA 2AU0A 1N48A 1J5OB 2F8MA 2V4JA 4ZN1A 2WVEA 1SL2A 3KJNB 4NLUA 4A8SA 3J7AN 2XTJP 4CYUB 4JI4J 4M5KA 2ZC3A 3CJRA 2MQQA 1WOSA 2HYIB 1L3SA 2VU5A 1RAEB 1RAOA 2BOPA 3H0PA 4PAAA 2XYGB 4KO0A 4CLLA 1UTAA 3OT9A 3G71S 3I5CA 2HNYA 1Q7LB 3LA0A 3HD2A 2OSQA 5D4NA 2CDQA 4PUOB 3ENAA 3MCMA 5KFGA 4JI1F 2RILA 2MB0B 3LWMA 3A13A 4M5JA 5T7LA 2JRSA 5KFIA 1HNWF 1NK7A 3PR5B 1MMDA 4HR2A 2WBMA 3HF5A 3KLIA 3BBBA 5DS7A 1U24A 2CQGA 2ZZNA 2GS8A 2IBOA 3MAAA 4JI8J 5CD4A 3RUBL 2HHWA 1KLNA 1C1CB 2ZD1A 3H2LA 4C11B 1TK8A 3F73A 2KZMA 1IKYB 2DGWA 3HI9A 4KY3A 2F9JA 3CDBA 3BBCA 4ZP9A 2PA3A 1JLFA 2XZDB 2YH1A 3TR5A 1RBOB 2MHEA 2F65A 4DV0J 1I51B 4NYOA 3Q8RB 1WI6A 2FD2A 3M8RA 2JH3A 2ZH3A 2V8PA 5CYMA 3QRPA 5A8KA 4RO0A 5IM0B 1HARA 5IXUA 4C8KA 2ZZMA 4I0WA 1HMVA 2OGUA 3DOKA 1WKLA 2RU3A 2CWXA 1K73T 3DLJA 1OIAA 4LMZA 2W9CA 2LCWA 1QTNB 4RUCA 1JLEB 3VAMA 1IBKJ 4MYUA 4F0HA 1HLWA 2DJWA 4B3RF 3HK2A 2DTJA 1Z4UA 5EWEA 4UUWA 4B9VA 2D1CA 5KOXA 2R7QA 4UUXA 3J7ZT 1HQUB 3OTCA 2W2PP 4YR0A 3T5KA 4ICLB 3ZZYA 1NKBA 2LEBA 2ZBRA 1RTHA 1AFIA 4X4QA 4ED5A 1LWEB 3CJ8A 1R31A 4ZK7M 5J2QB 1QUVA 4KQZA 1BLUA 5C25B 3M6XA 3A8KA 1FD8A 2Z2LA 4UOGA 1U8SA 2FGOA 3EUNA 2PIIA 2IRXA 3PX0A 4WF9Q 5DM6Q 4EGLA 3DOLB 3EPIA 1VYAA 4LFAF 2AJFE 1QAXA 5IOLA 1ZM9A 3I4HX 3UDEA 1HW9A 3ZZRA 3KLFA 1RK8A 1NUEA 5IC4B 4N47A 2NPIA 3RB3A 3KNAA 3O8WA 5FLXY 5HMYA 3LP2B 2EFNA 2FZGB 5HK4A 1KKHA 1IBCB 2OD6A 4LF7J 1D3WA 2NSBA 3DRYA 1TQLA 3HFZB 4I1TA 3N0VA 2AD9A 4CLUA 3WC2A 1PJ5A 1FNMA 2V69A 5KG3A 1TELA 1UPMB 3DRSB 3K89A 1W26A 4DSFA 1PKUA 2CQ0A 2G2OA 4WP8A 5D4OA 4DU7A 1RSCA 1VQ6S 3VAGA 3CVKA 1R8BA 2V2QA 2YWHA 3QGPA 4NI2B 1REVB 2EKYA 3EZ5A 3SYZA 1RUSA 4IR1A 4NYZA 1KOOA 1N4LA 2ROGA 1NPRA 4RW8A 1RWWB 1UVMA 4B3TJ 5DDOC 4C3KA 1LW2B 2DNMA 1T9XA 2MKHA 1KVIA 3PIPQ 4IR9A 3OL8A 1MG7A 2CRLA 2ZWOA 4KBIA 5KFHA 4GMKA 3IGNA 4Q0BA 2H5IB 4OYAA 2U1AA 2M52A 4A8MP 4A8YA 4DF8A 1U1LA 4P9SA 4Q5VA 3H8YA 2CADA 1VC5A 3WDOA 2LQ9A 2ZH6A 2HQDA 1JXVA 3MPWA 1I6JA 4ZVOB 3CJKB 4MIWA 4GC7A 4J9MA 3VAKA 4M5NA 2Q43A 4X4RA 2RSQA 2XSJB 3K5NA 1C1BB 4C0OC 1VRUA 2DY1A 2KO1A 3NOCA 1R27B 3NS5A 4QYZJ 3FVYA 3BQ1A 3OTOJ 4AL6A 3HHLA 2DNZA 4JI6F 2J9CA 3I5BA 2WW8A 5L1JA 2WB1D 2HHHF 1IKWB 4N5SA 1RTDB 3ILOA 4ALZA 1LWFA 3KLHA 3E8OA 3SSRA 4O44A 1CS4B 1YK9A 1SKRA 4H4KC 2GCFA 3VWSA 4NRTA 1MU2A 3MF5A 4DFKA 4DR7F 1Y11A 4IOAQ 1IKVB 4IRCA 1PAUB 5LSLA 1Y9OA 1AZSB 4J9LA 4K4VA 2IHR1 2LXUA 1HHTP 3FCWA 4ILMA 1SVDA 2P9EA 2VFTA 4QR0A 3R5BA 4LR9A 3M32B 1H38A 1ZAVA 1RAHB 1UWBA 4OV6A 2F1FA 1HNVA 3V4MA 5CABA 1HW8A 3L3CA 3M2RB 4NMLA 2C22A 4QPTA 3EICA 4G6VB 1U6FA 1N0VC 1NSAA 1LOUA 2OPSA 2Y3YA 2QSWA 3BR9A 3W64A 3HVAA 3MMAA 3P96A 2XMUA 5E3CA 3SQGA 1K1QA 4XK8C 3RAMA 1X4AA 3FBCA 3G86A 5KFQA 1WTFA 1BWEA 3K5LA 4OL8A 3K8VA 4RPFA 3MEGA 5A2QU 2YNIB 2XCAA 1H3DA 3QLHB 4DL7A 4I7FB 2LA6A 4JV1A 4FXVA 2GVDB 1O51A 1HNIA 4ZPVR 2H65B 2LMIA 3I9ZA 5J1EA 4L72B 3PFOA 2HURA 4P7TA 4MK8A 1GEHA 4XO0A 2ZE2A 3D0HE 4MMOA 2PFFB 2E1RA 1AFJA 5H9EJ 5A8RB 3MECB 4ANCA 4K0KJ 2AW0A 2E5JA 4I2PB 2IM0A 1WACA 3O5TB 2FZKB 4PG5A 1DQ9A 1URRA 1UEKA 3RB6A 2VUGA 2GVZB 5LT5A 3MR3A 1FKPB 2Q6BA 4A8WA 1BMQB 1M1KT 2QMWA 3NWRA 5CH7B 4KRWA 1SL1A 2UXBF 2R2UA 4RW9B 2CDRB 4MK9A 1NZAA 4Q7AA 3WIUA 2V34A 3AOCA 4L75A 5B0AA 2R7TA 2Z2MA 1S1WB 4K59A 4DR2F 2NZCA 2CQHA 3AA9A 1ZS6A 3V5RA 3ZC4A 3K8WA 2BJ8A 1CJTA 2ZOMA 4CLWA 3U27A 2XS7A 3PIOQ 3OXFA 1SUQA 3H2UB 3DMJA 2H51B 2K06A 2RIJA 3FFIB 4OZ5A 2ILYA 2MGZB 3SFUA 3DLEB 1RHRB 3R7NB 1Y00A 2V8VA 3LAMA 5BJRA 1M90T 5DLFA 3MR6A 2ZH2A 2VG7A 4IQXA 3KHHA 4P2MA 4ED6A 3PV8A 1RHJB 3I4PA 1T11A 3GPAA 4Q8EA 2O5DA 2BANA 2JVOA 2DGOA 5GVQA 3QJLA 3M30A 2NYHA 2JEIA 1IQTA 2W9AA 1UETA 2O67A 1S1TB 4JBCA 3I82A 5AXLA 1FKOB 6FDRA 4FPRA 4Y0FA 2EC2A 5FDLA 2X1BA 4KIAA 3CPWR 3V81B 2J7WA 5L9XA 3MWBA 2NZ4A 3HKWA 2BACA 4ECQA 3GCWP 3ONQA 1TP7A 3OR2A 5BYSA 5ETOA 1RT1A 3CCZA 4ER8A 3L7PA 1ITPA 1LKZA 2GMLA 4TYAA 1V3ZA 3IXQA 3V6JA 3PKYA 1YRTA 4DFPA 1RTJB 2KT5A 1WI8A 5GAGI 4OHZA 2WCXA 4KKOA 2B9WA 4LT6A 3C15B 1E6VB 2B9EA 1WHXA 4LJMA 3BSNA 4OZ2A 2MQNA 2CWKA 3NKYA 2ZDPA 1GMUA 1H2VZ 2M9KA 1X5SA 3HVTA 4B02A 2PO4A 2RRNA 2Z58B 2K2PA 3X3UA 2U2FA 3TUJC 3L7OA 1ZTWA 4AL7A 3UN5A 3R1LA 4DU8A 4DV7F 4O3SA 1T9WA 5C42B 5IWAF 2UUAF 4NXNF 1FRJA 1FX4A 4B3MJ 2WRMA 4LSNB 1HPZB 4PZVA 3UW1A 1IKXA 3O44A 3CCMS 1CBKA 2LYVA 2HQGA 1YX2A 1BQNA 1ZTTA 4FF2A 2OP5A 3SCLE 4DV6J 2O3DA 3IC1A 1RWMB 4OX9J 3F44A 1U1KA 3GG1A 5DGBA 3NAHA 3TX0A 3DNCA 2OLWA 1H98A 4F0MA 1Q8LA 3DLGA 1S1UA 3R7BB 3UE2A 4URQU 1PBUA 4PQAA 3OBIA 1GX6A 2CJQA 1TAQA 4M8LA 4IOCQ 3ZNJ1 2EFVA 3SSQA 2LU1A 3GFXA 2GHVC 3M6WA 1P1LA 3ZZZA 4FP9A 4J9VA 2MKKA 5K5MA 1RHQB 3NOGA 1XR5A 1VOMA 3MCOA 4KAIA 4F0KA 3DC2A 4X4UA 5KFPA 4TNOA 1N8RT 3TARA 1FF2A 4YN3B 1WSRA 1JK9B 2OPPA 2MKIA 2DNHA 2HW3A 3QRQA 1VIXA 3DLKA 4FVMA 1NH8A 3U1MA 1VRTB 3W63A 4OZ1A 2AEFA 3AH6A 3I56S 4QBUA 2CNNB 2FYXA 2ZJPQ 1CJVA 3KDNA 2QT7A 5D3GB 3KLGA 2NQPA 1T9UA 2E5LF 4FF3A 2YNGA 2V9KA 1H72C 3LPEA 4NOHA 4QU6A 1SC3B 3EGNA 2YKNA 4WFZA 2RD5C 1RBLA 5A76A 2E9TA 5B0CA 4WWSA 3TA2A 4WP3A 2KYXA 1M5VC 1GTHA 1R0AA 4DR5J 3AD9C 2ABYA 1HWLA 3RBEA 1RQ0A 4L6V3 2CJYB 3TAQA 1VQPS 1F9FA 1NK8A 4N77A 4K4UA 2FVCA 5GADI 2V4QA 3KOAA 1NK0A 4DV5F 4B9TA 3LQVA 1S99A 4DPTA 1SJ3P 1TR0A 2AT1B 4A8XA 1WHWA 2OSRA 3I9V9 3MM5B 4F4ZA 1MWZA 2VOOA 1UFLA 3Q8PB 1ACMB 1RT2A 5KFLA 4C2MA 1EJ7L 3B4MA 4PG8A 4CWBA 4ZHRB 3JSMA 1Q86T 4JV0A 4NASA 1AUDA 1F60B 3DHXA 2H4YB 2VZ9A 3NGSA 4UZCA 4BHQA 4NCGA 2I8EA 1U47A 5F8JA 4WP9A 3CDWA 2XO7A 3ISNC 2AZ1A 4QW8A 4J37A 4XAKA 2ZBCA 3L95X 2N4DA 3M7VA 1YBUA 3QMQA 1JLBA 2J76E 2FB0A 4DV1J 1JJCB 4JUZA 3Q23A 4O3QA 1VQKS 3EZUA 2B6AA 1YZ7A 2V4JB 1GNKA 2DO0A 2VDHA 3GYGA 3VGSA 5EHHA 3CC4S 4ED2A 4Z37A 4TXSA 4J9KA 1WEXA 1B7YB 1VR6A 2JEGA 4F3MA 5T14A 1AB8A 3ENQA 4KO0B 4B3OA 4C9DA 1X0PA 1U26A 3CJ2A 3MM6A 1KRPA 2R8HA 2RUSA 4P2XA 1MW7A 3W2WA 4HYKA 2K8GA 2DNYA 3M9NB 2E5HA 5T7LB 2DCUB 3R1HA 4ZPBA 5KG1A 3KLIB 4K2JA 3R8YA 5KG5A 2CQDA 1N5SA 3GB0A 2C2RA 3MAAB 3KYLA 2ZD1B 2FJBB 3RAQA 3LTOA 1UVIA 4UY8T 3FMWA 2KM8C 1RXOB 2R7OA 2GO8A 2AEJA 1MNEA 1S6QA 2MMYA 1Q82T 1L3TA 1S1VA 4PG6A 1JLFB 4HEA9 3C6UB 1DFDA 4EK2A 2RKIA 3ENWA 3W62A 2CYYA 3G8TA 1HNXF 1HNWJ 1KDNA 4UTGA 5CYMB 3MTKA 4F50A 3BYPA 2ZNYA 3R5CA 4C48A 3DU5A 1I94F 1HMVB 2A1BA 1KTQA 5KFWA 4I56A 3TAPA 1FNOA 3DOKB 1NO8A 3KG4A 4R0EA 3CCQS 3L4BC 1FKAF 1WC1A 2WB4A 2F4FA 2Z4PA 2W9CB 1J5EF 1NHKL 2AV5A 1KLMA 2BE9B 4EYHB 1VQSA 1WEYA 2XZTB 2H9ZA 3EM1A 4RZRA 3HFKA 1KR4A 5HLFA 1HWUA 2KT2A 2KG1A 4YQWA 2XI3A 1S12A 4U8YA 3QIPA 5RUBA 3G4SS 1QLNA 4OYZA 1RTHB 2OTJS 4DS5A 3CCES 5EX0A 2WHOA 3DYAA 2YNHA 3JTNA 5E41A 3N79A 4IH5A 1ZA1B 4FNIA 5D0RA 2NS1B 2AJ0A 3OW2R 4EEYA 4ZPDA 2HFSA 2L9WA 1VMBA 3MR2A 2IPOB 3AOBA 3VR1A 4WKRA 1B3TA 4PABA 2R9LA 3T6BA 4B3RJ 2HNDA 3ISND 5BYQA 4QJVA 2I6WA 2XCPA 4CCHA 4WTYA 3EGWB 2CPJA 4ZVEA 3Q86A 1OSDA 1X31C 3TA1A 4Q43A 1RADB 2ZH5A 1XBWA 1N32J 4QIFA 1VC0A 2N3LA 3HMJG 1FEEA 4ZVFA 3TVKA 4IFYA 4F2SA 4LBIA 1XWLA 1QY7A 3RR7A 4LUBA 4HTJA 1QDUB 3HHKA 3UQSA 4DX6A 1RAAB 3AB2B 3IWLA 5GMKa 4LFAJ 2G1DA 1V5VA 2VG6A 2VIHA 3CD7A 2AX1A 1EX8A 2IFXA 4ZVSB 2RQCA 2YX7A 4ZS6A 2XBPA 1EZZB 3BPSP 4CO0A 2XYPB 4LIWA 1G2EA 2DXEA 1DJ0A 3IA0A 1X7VA 3NAIA 3PNIA 3HULA 3P3DA 4PCQA 1G3OA 1HI1A 1NDKA 2XMVA 1PG5B 7AT1B 2BR0A 2Y1RI 4DPXA 2IRUA 5KT4A 2DRAA 2PMWA 4Q0BB 3QFHA 2QYCA 5BXIA 3PTWA 2YPYA 5HQ8A 3GP9A 1QJHA 2GHWA 2IA6A 3TJ9A 3DCAA 2KL8A 2ZOGA 4A8OA 2DH9A 3AY0A 4CNZA 3ZTQA 1HD0A 4DR1J 1RP5A 3BGUA 3PR4A 2MEWA 4DX7A 1BY9A 1VRUB 2NLWA 3HX9A 2ASLA 2OFGX 4N8OA 4IDKA 4YB5A 1PBAA 3HHLB 3V6HA 1D8YA 4IG0A 5CCMA 3VVTA 2VA3A 1XMOF 2W4PA 1LWFB 2VBXA 3KLHB 3MCNA 3T5LA 1BQMA 2JHEA 1RWPB 2UUBF 1WC0A 3S8SA 4DL3A 1HWKA 1MU2B 3NS6A 2ZM6J 5DG8A 3DLBA 3EMTA 2EPIA 2RUGA 4BC9A 1U1QA 5I4MA 3VAHA 3M6VA 2CQCA 4MFBA 3NG8A 3BDEA 1LK5A 3T1YJ 3UNGC 1UWBB 1HNVB 4GKJF 4Y2CA 2XQCA 1X8DA 3FEZA 2FC9A 2OFHX 2OPSB 4RU2A 4JI4F 2DXDA 3MMAB 2YQ0A 4J91A 4PG7A 1V5IB 4IOBA 3SQGB 2WAQD 3D54A 4B9LA 1VQOS 2QMUB 2V2ZA 2VA2A 4M5LA 3MEGB 4I6AA 4DR7J 1A9NB 4IFVA 1Y3KA 2FHOB 1HNIB 2VH7A 3MHYA 2A18A 1K1SA 3W60A 2BJ3A 2CPXA 4U67Q 2M8DB 1WD6A 1HBOA 2QTWA 1QAYA 2HZVA 1VGYA 3OTDA 4PWWA 1R8PA 3CMQA 3AXMA 3BN4A 3I0RB 2RQKA 2BKOA 2BV3A 1QD1A 3Q2TC 1X4DA 4DL5A 4QWDA 3IGVA 4DQRA 4ECUA 3QO9A 4KGZB 4JI8F 1OJ4A 4HHUA 2XLJA 4DPYA 4PKDB 4QIWD 1I5OB 4OZJA 2P9GA 1P8GA 3NXZA 3WZ0A 4C4WA 3A3NB 2HK3A 2GC8A 1VLYA 1YIJS 3IO1A 1UL3A 3M8WA 4P71A 3KJFB 2QO3A 4N7TA 4TY8A 3DOMA 4Q44A 2MLZA 3QJJA 2KXNB 4OLOA 5IT4A 1YRUA 3M8PB 4PWUA 4AYBD 5KFOA 4NMXA 5L1LA 2E1CA 2DNLA 1T9VA 1VQ9S 1CJTB 2D7SA 1VQ8S 2UXDJ 1SJFA 2COLA 4DQIA 5C2CA 1SKSA 1RAFB 4RWWA 1SUQB 2RDJA 3ICLA 3DMJB 3MOJB 4X4NA 2FIUA 3F56A 4ZJOA 5A8WA 1PJ7A 4LSZB 3QGHA 3ZNUA 2FLOA 1IBKF 3C8YA 4USKA 4ED3A 2LQ5A 3H59A 4OI6A 5KFRA 3KDOA 2VG7B 5F3ZA 4MIBA 3M8ZA 2E1MC 5I3PA 1X4CA 4ED8A 4C8NA 2BANB 3H5SA 3M30B 3Q8UA 1RYRA 4DCPB 3CSKA 3QT8A 4CLSA 3AJ1A 1LXNA 2C2ZB 2KH9A 1Y5IB 3G9CA 2CJXB 4ERDA 4JI5J 1B0PA 1X9SA 1OQ3A 4KYZA 2D69A 3D7SB 4ITSA 2WVCA 1SJRA 4CI0B 4KFBA 3MEEA 4BLGA 3VTIA 1B99A 1BWVA 1XNQJ 3DFEA 3WIVA 3H5UA 3CW2C 1RKIA 1RT1B 3B4DA 2R8JA 2GO9A 1WF2A 3PACA 3JS9A 3V4IA 2DXFA 4KE5A 2B5JA 2LXIA 1TV6A 2W2OP 3OHAA 4UQTA 5SZTA 4KKOB 4ZPCA 3AJ2A 4OYPA 1LWCB 2SXLA 4LF7F 5F0UA 3QGIA 5ETLA 2BX6A 4PXCA 4WU2A 1ROFA 3OUYA 3I5AA 3HVTB 3Q8SB 1SJ1A 2OJ3A 1PO6A 4LFCJ 3OJSA 1VHIA 5DDQC 4FVCA 8ATCB 2QC3A 1YBAA 1VQ4S 1OPIA 4OJHA 4QIVA 2C2MB 1IKXB 1RZMA 1M5SA 5EGYA 1F0XA 4JI0J 2QL5B 3NBPA 4MH8A 1BQNB 3UCGA 4PXDA 3C3LA 4WK1A 3WHIA 1N54B 4Z7YA 3JYTB 3ETMA 1VI7A 4B3TF 2KN4A 5DDRC 2VKRA 4G65A 1NK9A 1S1UB 2DR9A 1DQ8A 3AODA 3PCOB 1XQIA 2JDJA 4A4JA 3GILA 2XNQA 2RS2A 1CLFA 2VG5A 3CMES 2D3ZA 1FRKA
chains in the Genus database with same CATH topology
2QA4G 1REVB 2EKYA 4K4YA 4F4WA 1SL0A 1MMLA 3EZ5A 1TKXA 3SYZA 4IR1A 2EK6A 3K7RA 5U47A 2A3JA 7FDRA 4NYZA 1KOOA 1N4LA 2ROGA 2KZZA 5F41A 2ZHBA 2RE1A 4RW8A 2YWEA 1S9GA 5KG6A 1UVMA 3B82A 5DDOC 3HPOA 3D1QA 2OPPB 5K8OA 3AQPA 2I5JA 4O3RA 3IG1B 1NK5A 4EBCA 2I1RA 2XEXA 3CCLS 2AX0A 1Y0HA 2D41A 3OVAA 2B51A 3CJ4A 2B7CB 3R5AA 3RTVA 4C0HA 1WWHA 4C3KA 1LW2B 2DNMA 1FXLA 2MKHA 3DLKB 5HMXA 4TN2A 4DSEA 1KFSA 1KVIA 1FK9A 5HP1A 3PIPQ 4IR9A 5FJ4A 3OL8A 3GYNA 3RYLA 4DOZA 2CRLA 5K8MA 5GAHI 2ADCA 4KBIA 4OHYA 5KFHA 1ZZNA 1GX5A 1PSDA 4GMKA 3IGNA 4Q0BA 2WBRA 3T1HF 5CCLA 2U1AA 2M52A 2HHUA 4M63A 4A8MP 2HFZA 4A8YA 4DF8A 5LJ5Y 4AXIA 1U1LA 2IYIA 3CTRA 3RR8A 4Q5VA 3DN9A 2HZCA 3O2IA 3U1LA 3MMJA 1VQNS 5JJBA 2XG8A 2HVZA 3H8YA 4H4OB 4QU7A 4TLRA 1M0SA 1R3NA 1VC5A 3WDOA 4TQRA 3LO3A 2LQ9A 2LLZA 3DM2A 1ZPWX 5EWFA 4OZNA 2ZH6A 1MWYA 3IRWP 2YNGB 1M5HA 2FJEB 4G1IA 3IAS9 3MPWA 3PKMA 1I6JA 3CJKB 2OIHA 4ZPTR 3E01A 3HDSA 2YKNB 2BJEA 2ZITA 4MIWA 2DNNA 4CH1A 4GC7A 1ULRA 3CE8A 3JSYA 4J9MA 5D3GA 1SV5A 4OHXA 3VAKA 1S6OA 1CVJA 2Q43A 2WONB 4X4RA 2JEJA 2RSQA 2XSJB 2GNKA 2VODA 4M1KA 3K5NA 4IRKA 5GAEI 1C1BB 2YWKA 3TA0A 4KV8A 2MKJA 5K14B 2Y1JA 3FMBA 4C0OC 1VRUA 2FVSA 3MM9A 2KO1A 5E3AA 3IR6B 3PFEA 4ZVGA 1R27B 3NS5A 3V6DA 1OWXA 4JI3F 1U25A 1IXKA 3FVYA 4QYZJ 4CTAB 3BQ1A 4AL6A 2UVVA 3HHLA 4Q2LA 2DNZA 4JI6F 1H7WA 2J9CA 1TK5A 3I5BA 3BF4A 2WW8A 1FTCA 4RW6B 3KLVA 2WB1D 5L1JA 1NK4A 2DR8A 4C8LA 4F02A 2FGCA 2HHHF 4FS1A 5GAHU 4OV1A 1BD6A 1V3RA 1IKWB 2C3PA 5KOWA 1NJZA 4N5SA 5D4PA 2ATLA 1RTDB 2UVUA 4ALZA 3OSNA 1LWFA 4K2XA 3TAMA 3G8SA 3KLHA 2XMJA 3E8OA 1NRKA 3LP0B 2ZH1A 3SSRA 3H5XA 2DRBA 3IS9B 4G1QA 4O44A 2E9ZA 1WEZA 1XTZA 3GV5B 4WE1B 2HFNA 2R8IA 2IC3A 2GMJA 2IVMA 3GMGA 2J6TA 2IVYA 4CQ1A 3C6TA 4J9QA 1SKRA 2KFZA 4H4KC 2GCFA 2PE8A 3B78A 3VWSA 1FCAA 3S01A 2BRKA 4NRTA 2MJUA 4X66F 3DLHA 2CZ4A 1JJHA 1MU2A 2EBEA 3MF5A 3CCJS 4DFKA 3OQ2A 2AGQA 4DR7F 4IOAQ 1IKVB 1RA6A 1R89A 3KG0A 2IVFB 5I42B 4IRCA 1CEZA 1HBMA 5LSLA 1NK6A 5E7OB 1Y9OA 3U02A 4YHHF 1JKHB 2MKCA 3RW6A 5DDPC 1DLOB 2K7KA 4QWAA 4U9RA 1IR0A 2WSFC 1FRMA 4J9LA 2RF2B 4RNHA 1XNRF 4K4VA 5THWA 2IHR1 2LXUA 3NGKA 1HHTP 4A46A 4OI3A 5IFMA 4ILRA 3SCKE 4ILMA 2EFOA 1XR7A 2P9EA 2QE5A 2VFTA 3OFFA 1DTQB 4QR0A 3R5BA 4EFAC 1QTMA 3M32B 1H38A 2JZ5A 2CJ9A 1RYSA 2G4BA 1ZAVA 2N82B 3JSMB 5DQIA 1GH8A 3KK1B 5LXRA 4ZCMA 2HVHA 3DDNA 4Y65A 5K8NA 3S1TA 1FHTA 3PEHA 1UWBA 2DIVA 2CKWA 4Y2IA 2F1FA 1HNVA 2GHPA 5I3UA 2L41A 2HQIA 3V4MA 4NCGB 4DF4A 1TL5A 2RRAA 3TP2A 3NP5A 1XK8A 1HW8A 3THTA 3L3CA 3M2RB 4ED7A 4NMLA 5LMUF 2C22A 3FRYA 3PVXA 4NLSA 4QPTA 2N4CA 1NJIT 2ZH7A 2OKQA 3DHWC 2B56A 5GADU 3SDEA 2DCLA 4G6VB 1U6FA 1N0VC 1JLBB 1N5YA 1LOUA 1Y5NB 2OPSA 2QSWA 3BR9A 2JLGA 2QZ8A 4ECSA 4I68A 2RB7A 3HVAA 3QPIA 3MMAA 3P96A 5E33A 4LF9F 2XMUA 5E0OA 1VQYA 1KHVA 1EETB 4AQYF 5E3CA 4CO4A 4X84A 3SQGA 1U1OA 4BWMA 4ZPWR 1KTVA 4MAKA 3C66A 1K1QA 3DRXA 2MXYA 1X9MA 1T05A 4XK8C 3RAMA 1LK7A 1X4AA 3G86A 3IRXA 4V19X 5KT3A 2B6AB 3JAMY 2DGTA 2VPXB 1VQLS 2VC0A 4WK3A 3G6ES 5KFQA 3KNGA 1WTFA 3RAXA 2VQFF 1BWEA 3K5LA 4OL8A 2K3KA 1QE1A 3K8VA 3MM7A 3MEGA 4LVOP 2W9BA 2YNIB 4B9MA 3M8QB 3HZGA 2XCAA 4WYLA 4LQ3A 3OTBA 1H3DA 1TKTA 3QLHB 4NA3A 4DL7A 3DI6A 2E5GA 4I7FB 2LA6A 4JV1A 4FXVA 4DX8H 1XN9A 4F4XA 5KFMA 4AL5A 2MZRA 2D74B 1O51A 3DXSX 2HAIA 1HNIA 4R0JA 3VZHA 3G6VA 2GJ2A 4ZPVR 1U2FA 1NU4A 2XHWA 2LMIA 1DTTB 1SJ4P 2JVRA 4A8QA 4ZVHA 3I9ZA 5J1EA 1UA1A 4L72B 3SEOA 3JTPA 1TVRB 3PFOA 3ISZA 1K9MT 4ID5A 5E3QA 4P7TA 4MK8A 3SSSA 3KTQA 4XO0A 2ZE2A 1CC7A 3I31A 3D0HE 5DO2A 5F8LA 1Y3JA 4MMOA 2BA9A 2OAUA 2YH0A 2DGXA 2RNEA 4RBUA 2PFFB 2HHTA 2ZOFA 4CIOA 2JEFA 2E1RA 1AFJA 5H9EJ 5DJBA 3PW4A 4USHA 1U09A 5A8RB 3MECB 2UUTA 4B3OB 5L9NA 1QSLA 2FHMA 2AW0A 2E5JA 3KK3A 4ECYA 4I2PB 2IM0A 3P6YC 3MM6B 3TRGA 1WACA 3MFIA 2ZDOA 3O5TB 2X1FA 4NA2A 2EI5A 1FXRA 4DDFA 2BRLA 2J9DA 2AGOA 4M95A 2E1AA 4N8NA 4PG5A 2XWXA 2D9PA 2HNYB 1DQ9A 4NLQA 4N76A 1URRA 3CD6S 4ECRA 2C28A 3CO9A 4KHPF 3RB6A 2VUGA 1Q16B 2HLUA 1L3VA 5LT5A 2HGNA 3KJVA 2DGUA 3MR3A 1S0NA 5J1NA 1FKPB 2Q6BA 4RX6A 1PC5A 3E2EA 4A8WA 5B09A 1HHSA 1JX4A 1URNA 3I0SB 2BYCA 2K1RB 4K50A 2BQRA 1M1KT 2QMWA 3BDPA 2HS3A 3IAM9 3MEDA 3Q8QB 2MY8A 1RT7A 3MMCA 5CH7B 2W8LA 4KRWA 2KVIA 4ZOSA 1TFYA 3NMRA 3HZEA 5B0DA 2O66A 4DQQA 5MLCV 3KLEA 2R7VA 1SL1A 1T3NA 4J9SA 3UDLA 1N52B 1X4EA 2UXBF 2R2UA 1YRXA 3TNVA 3UR0A 4EBDA 1FO1A 5K9FA 3DU6A 4RW9B 2BUNA 2GQQA 3Q22A 4MK9A 4QIGA 4ECXA 4Q2MA 1I1GA 4DV0F 3GE9A 4WFBQ 1NZAA 4TY8B 1J2VA 3PEJA 3I32A 2RVJA 4Q7AA 1Y4ZB 2V8HA 3GG0A 1IJEB 1MROA 4PXBA 5KG7A 1FESA 2UU9F 1KOHA 2PDAA 2J0WA 3BO2A 1B0TA 2HNZB 2YWGA 4IKAA 5B0AA 1S9FA 2F3JA 2OD4A 3J7Z5 1SXLA 2DR7A 4GKKF 2R7TA 2DISA 2XSFA 4RNOA 4IG3B 2Z2MA 4ZP8A 1S1WB 2BVZA 4K59A 1T03A 2ASDA 4DR2F 4CT8A 3IN5A 4NLVA 2CQHA 1C0UA