3CCSE

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
172
structure length
172
Chain Sequence
PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 3ccsE02
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 3ccsE01
4IOAE 4U67E 4WF9E 1N8RG 1S72E 2CQLA 3CMAE 1VQ4E 5DM7E 1K9MG 1VQME 1M1KG 4WFBE 2ZJPE 4WFNE 2QEXE 3DLLE 3CCSE 1VQOE 1Q86G 1YITE 2OTLE 3CC4E 3CPWE 1VQLE 1QVGE 1Q81G 3PIOE 3CD6E 4UY8G 4IOCE 1RL6A 1YJ9E 3CC7E 5JVHE 3CCJE 3OW2E 1VQ9E 3J7ZG 3CCEE 3CCUE 1Q7YG 3CC2E 4WCEE 5GADG 3G4SE 1YJWE 1VQNE 1YIJE 1K8AG 3CXCE 2QA4E 1NJIG 3CCRE 1KQSE 3CCLE 1QVFE 3G6EE 3I56E 1VQ7E 5JVGE 1YHQE 5AN9B 5DM6E 2ZJRE 5H1SI 1KC8G 1VQ6E 3G71E 3CF5E 1W2BE 1K73G 5HL7E 1VQPE 1VQKE 1M90G 1JJ2E 5GAHG 3PIPE 2ZJQE 5GAEG 3CCQE 1VQ5E 1YJNE 1VQ8E 5MLCH 3I55E 3CCVE 2OTJE 5GAGG 3CCME 1KD1G 4WFAE 1YI2E 4IO9E 1Q82G 3CMEE
chains in the Genus database with same CATH superfamily
4IOAE 4U67E 4WF9E 1N8RG 1RJLC 1S72E 2CQLA 3CMAE 1VQ4E 5DM7E 1K9MG 2I5VO 1VQME 1M1KG 4WFBE 2ZJPE 4WFNE 2QEXE 3DLLE 2HKDA 1FJ1E 3CCSE 1VQOE 1YITE 1Q86G 2OTLE 3CC4E 3CPWE 1VQLE 1QVGE 1Q81G 3PIOE 1P4PA 2OY7A 2PI3O 3CD6E 2FKJA 4UY8G 4IOCE 1RL6A 1YJ9E 3CC7E 5JVHE 3CCJE 3OW2E 2OY8A 1VQ9E 3J7ZG 2OYBO 3CCEE 3CCUE 1Q7YG 3CC2E 4WCEE 5GADG 3G4SE 1YJWE 1VQNE 1YIJE 1K8AG 3CKFA 2G8CO 3CXCE 2QA4E 2OY1O 1NJIG 3CCRE 1KQSE 3CCLE 5B2AO 5B11O 2AF5A 2FKGA 1QVFE 3G6EE 3I56E 3IGEA 1VQ7E 5JVGE 1YHQE 1OSPO 5AN9B 5DM6E 5H1SI 1KC8G 1VQ6E 3G71E 3CF5E 1W2BE 2OL7A 1K73G 3EC5A 2OL8O 5HL7E 1VQPE 3CKGA 1VQKE 2OL6O 3AUMO 1M90G 1JJ2E 5GAHG 3PIPE 2ZJQE 2OY5O 5GAEG 3IG9A 3CCQE 1YI2E 1YJNE 1VQ5E 5MLCH 5B3MO 1VQ8E 3I55E 3CCVE 2OTJE 2I5ZO 5GAGG 3CCME 1KD1G 4WFAE 2ZJRE 4IO9E 1Q82G 3CMEE 5B10O
chains in the Genus database with same CATH topology
4IOAE 4U67E 4WF9E 1N8RG 1S72E 2CQLA 3CMAE 1VQ4E 5DM7E 1K9MG 1VQME 1M1KG 4WFBE 2ZJPE 4WFNE 2QEXE 3DLLE 3CCSE 1VQOE 1Q86G 1YITE 2OTLE 3CC4E 3CPWE 1VQLE 1QVGE 1Q81G 3PIOE 3CD6E 4UY8G 4IOCE 1RL6A 1YJ9E 3CC7E 5JVHE 3CCJE 3OW2E 1VQ9E 3J7ZG 3CCEE 3CCUE 1Q7YG 3CC2E 4WCEE 5GADG 3G4SE 1YJWE 1VQNE 1YIJE 1K8AG 3CXCE 2QA4E 1NJIG 3CCRE 1KQSE 3CCLE 1QVFE 3G6EE 3I56E 1VQ7E 5JVGE 1YHQE 5AN9B 5DM6E 2ZJRE 5H1SI 1KC8G 1VQ6E 3G71E 3CF5E 1W2BE 1K73G 5HL7E 1VQPE 1VQKE 1M90G 1JJ2E 5GAHG 3PIPE 2ZJQE 5GAEG 3CCQE 1VQ5E 1YJNE 1VQ8E 5MLCH 3I55E 3CCVE 2OTJE 5GAGG 3CCME 1KD1G 4WFAE 1YI2E 4IO9E 1Q82G 3CMEE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IOA E;  4U67 E;  4WF9 E;  1N8R G;  1S72 E;  2CQL A;  3CMA E;  1VQ4 E;  5DM7 E;  1K9M G;  1VQM E;  1M1K G;  4WFB E;  2ZJP E;  4WFN E;  2QEX E;  3DLL E;  3CCS E;  1VQO E;  1Q86 G;  1YIT E;  2OTL E;  3CC4 E;  3CPW E;  1VQL E;  1QVG E;  1Q81 G;  3PIO E;  3CD6 E;  4UY8 G;  4IOC E;  1RL6 A;  1YJ9 E;  3CC7 E;  5JVH E;  3CCJ E;  3OW2 E;  1VQ9 E;  3J7Z G;  3CCE E;  3CCU E;  1Q7Y G;  3CC2 E;  4WCE E;  5GAD G;  3G4S E;  1YJW E;  1VQN E;  1YIJ E;  1K8A G;  3CXC E;  2QA4 E;  1NJI G;  3CCR E;  1KQS E;  3CCL E;  1QVF E;  3G6E E;  3I56 E;  1VQ7 E;  5JVG E;  1YHQ E;  5AN9 B;  5DM6 E;  2ZJR E;  5H1S I;  1KC8 G;  1VQ6 E;  3G71 E;  3CF5 E;  1W2B E;  1K73 G;  5HL7 E;  1VQP E;  1VQK E;  1M90 G;  1JJ2 E;  5GAH G;  3PIP E;  2ZJQ E;  5GAE G;  3CCQ E;  1VQ5 E;  1YJN E;  1VQ8 E;  5MLC H;  3I55 E;  3CCV E;  2OTJ E;  5GAG G;  3CCM E;  1KD1 G;  4WFA E;  1YI2 E;  4IO9 E;  1Q82 G;  3CME E; 
#chains in the Genus database with same CATH topology
 4IOA E;  4U67 E;  4WF9 E;  1N8R G;  1RJL C;  1S72 E;  2CQL A;  3CMA E;  1VQ4 E;  5DM7 E;  1K9M G;  2I5V O;  1VQM E;  1M1K G;  4WFB E;  2ZJP E;  4WFN E;  2QEX E;  3DLL E;  2HKD A;  1FJ1 E;  3CCS E;  1VQO E;  1YIT E;  1Q86 G;  2OTL E;  3CC4 E;  3CPW E;  1VQL E;  1QVG E;  1Q81 G;  3PIO E;  1P4P A;  2OY7 A;  2PI3 O;  3CD6 E;  2FKJ A;  4UY8 G;  4IOC E;  1RL6 A;  1YJ9 E;  3CC7 E;  5JVH E;  3CCJ E;  3OW2 E;  2OY8 A;  1VQ9 E;  3J7Z G;  2OYB O;  3CCE E;  3CCU E;  1Q7Y G;  3CC2 E;  4WCE E;  5GAD G;  3G4S E;  1YJW E;  1VQN E;  1YIJ E;  1K8A G;  3CKF A;  2G8C O;  3CXC E;  2QA4 E;  2OY1 O;  1NJI G;  3CCR E;  1KQS E;  3CCL E;  5B2A O;  5B11 O;  2AF5 A;  2FKG A;  1QVF E;  3G6E E;  3I56 E;  3IGE A;  1VQ7 E;  5JVG E;  1YHQ E;  1OSP O;  5AN9 B;  5DM6 E;  5H1S I;  1KC8 G;  1VQ6 E;  3G71 E;  3CF5 E;  1W2B E;  2OL7 A;  1K73 G;  3EC5 A;  2OL8 O;  5HL7 E;  1VQP E;  3CKG A;  1VQK E;  2OL6 O;  3AUM O;  1M90 G;  1JJ2 E;  5GAH G;  3PIP E;  2ZJQ E;  2OY5 O;  5GAE G;  3IG9 A;  3CCQ E;  1YI2 E;  1YJN E;  1VQ5 E;  5MLC H;  5B3M O;  1VQ8 E;  3I55 E;  3CCV E;  2OTJ E;  2I5Z O;  5GAG G;  3CCM E;  1KD1 G;  4WFA E;  2ZJR E;  4IO9 E;  1Q82 G;  3CME E;  5B10 O; 
#chains in the Genus database with same CATH homology
 4IOA E;  4U67 E;  4WF9 E;  1N8R G;  1S72 E;  2CQL A;  3CMA E;  1VQ4 E;  5DM7 E;  1K9M G;  1VQM E;  1M1K G;  4WFB E;  2ZJP E;  4WFN E;  2QEX E;  3DLL E;  3CCS E;  1VQO E;  1Q86 G;  1YIT E;  2OTL E;  3CC4 E;  3CPW E;  1VQL E;  1QVG E;  1Q81 G;  3PIO E;  3CD6 E;  4UY8 G;  4IOC E;  1RL6 A;  1YJ9 E;  3CC7 E;  5JVH E;  3CCJ E;  3OW2 E;  1VQ9 E;  3J7Z G;  3CCE E;  3CCU E;  1Q7Y G;  3CC2 E;  4WCE E;  5GAD G;  3G4S E;  1YJW E;  1VQN E;  1YIJ E;  1K8A G;  3CXC E;  2QA4 E;  1NJI G;  3CCR E;  1KQS E;  3CCL E;  1QVF E;  3G6E E;  3I56 E;  1VQ7 E;  5JVG E;  1YHQ E;  5AN9 B;  5DM6 E;  2ZJR E;  5H1S I;  1KC8 G;  1VQ6 E;  3G71 E;  3CF5 E;  1W2B E;  1K73 G;  5HL7 E;  1VQP E;  1VQK E;  1M90 G;  1JJ2 E;  5GAH G;  3PIP E;  2ZJQ E;  5GAE G;  3CCQ E;  1VQ5 E;  1YJN E;  1VQ8 E;  5MLC H;  3I55 E;  3CCV E;  2OTJ E;  5GAG G;  3CCM E;  1KD1 G;  4WFA E;  1YI2 E;  4IO9 E;  1Q82 G;  3CME E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...