3CCSF

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
molecule tags Ribosome
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 32
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ccsF00
5GIPC 2LBWA 1S72F 3LWOC 1CN7A 4LCKA 1YITF 3CG6A 1T0KB 3PLAC 1X52A 1N8RH 1QVFF 2AIFA 3CC2F 1W40A 4NUTA 3MCAB 4X3MA 3AGKA 1VQLF 3JCMM 1XBIA 3RA5A 3SIVA 2JNBA 3OW2F 1VQ7F 1Q7YH 5FLXM 3LWVC 1W2BF 3NK7A 5GINC 3VI6A 1VQKF 2OTJF 5FJ4C 2KTVA 1VQ6F 2KTUA 2KG4A 3G71F 1W42A 4X3LA 3RA6A 1RA4A 3CC4F 2QEXF 3HAXD 5GAPK 1X7OA 1YHQF 5EWRA 2OHWA 3CCEF 2QA4F 1VQMF 1W41A 1M90H 1SDSA 3I56F 3WXMB 4BY9D 1VQOF 3CCLF 1KD1H 2HVYD 4C4WC 2CZWA 3CCVF 1VQ4F 5DCVA 1GZ0A 3J80M 2VGNA 2OZBA 5G4VC 3NVIB 3LFOA 3V7EA 3CC7F 3E1YA 1VQPF 3E20B 1GO1A 3LWPC 1Q82H 1K8AH 1NMUB 1YI2F 1IPAA 3NK6A 1E7KA 3LWRC 1VQNF 3PAFA 2BO1A 5GIOC 1M1KH 1GO0A 3OBYA 1ZWZA 2FC3A 4TZZA 1H7MA 3IR9A 2OTLF 3LWQC 3CCUF 3NVKE 3CCJF 1VQ5F 3CD6F 1KQSF 5A2QM 1CK2A 3VMFB 1VQ9F 1RLGA 3N4YA 3CCQF 3FFMA 3O85A 1Q86H 1K73H 3G6EF 3CPWF 3CCMF 1JJ2F 3CXCF 2I6DA 3I55F 3SIUA 1YIJF 2WALA 3JAMM 3J7AR 3CCSF 1YJWF 1K9MH 3CCRF 2QI2A 3OBWA 3CMAF 3G4SF 1QVGF 2ALEA 3CMEF 1PXWA 1X7PA 2VGMA 3CPQA 3HJWC 1DT9A 5IT9M 2LBXA 5G4UC 3J81M 1YJNF 4BW0B 5EO3A 1KC8H 3NMUC 3GYQA 1Q81H 5GANK 1YJ9F 1W3EX 1NJIH 1VQ8F 3N4ZA 3V7QA 3ON1A
chains in the Genus database with same CATH superfamily
3LWOC 5MN6A 1CN7A 4LCKA 1JFFB 4I4TB 3CG6A 3BYQA 3F6MA 3MDOA 3F0FA 3CC2F 4NUTA 3JAWA 2ZOVA 3VCZA 4BT6A 3ZO8A 5MN4A 5LA6B 1Q7YH 1JFFA 2IQQA 3F0EA 3L7QA 5EIBC 1VK3A 1XHOA 3S02A 4TUYA 4BT5A 1VQ6F 3S0HA 3HKCB 1JY8A 4X3LA 3FPIA 3HKDB 3M4SA 4HNAB 1ONIA 5EWRA 4O2AA 5KMGB 1VHAA 4FFBA 4BVQA 3WXMB 4BY9D 3JAKB 4WBNB 4TUYB 3VO8A 3KJKA 3ZOPA 2DYYA 1OFUA 5JCOC 2VGNA 5EYPB 2GZLA 3NVIB 5HY1A 3V7EA 4TV8A 3CC7F 3E1YA 3IEWA 5LP6B 3LWPC 4YJ3A 1Q82H 1FNJA 4X20A 2HQSC 3NK6A 3ERNA 1VQNF 2DT4A 3VOBA 4BVSA 2CHSA 1J7HA 3I3FA 1GO0A 5LYJA 1RQ7A 2FC3A 1XV2A 4I55A 4TZZA 4RHAA 3IR9A 4YJ2A 3N2GB 5ITZB 1Z5WA 3ZP4A 3WJQA 1FNKA 2HP0B 5A2QM 3JATA 3O85A 4YJ3B 3RYCA 4O4IB 5CA0B 4YJ2B 3CCMF 1PF5A 4I4TA 3U0OA 1YIJF 5BMVB 2WALA 4C8GA 4PWTA 3JAKA 3CCSF 1K9MH 2OTMA 2ZVYA 4EI9A 1U3PA 3CMAF 2UYJA 3K12A 3CMEF 4G4XA 3TD5A 4ZK7A 2B33A 2VGMA 2FGYA 3QHDA 1GX1A 1DT9A 5LOVB 5GONB 2H8CA 5J2TB 3K14A 2AMTA 2V9YA 4IIJA 2QTPA 2ZODA 3GYQA 3JASB 3FD6A 4X20B 1U43A 2CVLA 3F0GA 3Q8HA 3VYTC 3WPWA 3ON1A 5FNVA 5GIPC 2LBWA 1S72F 4ZOLA 3C9UA 1YITF 3PLAC 1T0KB 1X52A 1N8RH 3FBAA 4IHJA 4X3MA 3AGKA 4KWEA 3JCMM 5CB4B 4G4ZA 3C8LA 1RLUA 3RA5A 2JNBA 2HRYA 3WGLA 2F9ZC 5JVDA 3NK7A 1VQKF 3CYQA 3VYSC 3RYCB 5FJ4C 2KTVA 2PMPA 4ZHQA 1FFXA 2KG4A 5KX5A 1W42A 2QEXF 5GAPK 3VOAA 1YHQF 4G4VA 2R751 5GONA 3TD3A 3C9TA 4B5CA 1VQMF 4ZI7B 5IYZB 4ZHVA 1VQOF 3CCLF 2Z01A 1KD1H 2HVYD 3RYHB 1IV3A 5JVDB 4EI7A 2UYNB 1GZ0A 1VH8A 3C9SA 3LFOA 5HY4A 3UT5B 4ERHA 3HKBB 4F6RA 5CA0A 3M1XA 1E7KA 1T0AA 5IYZA 4ZI7A 2BO1A 2RHOA 3LDTA 2CSLA 1CLIA 5LYJB 3RYFA 3IKFA 4ZHQB 5CA1B 3LWQC 4O4LA 5LP6A 1VQ5F 3LMEA 2ZVZA 4HNAA 2HS4A 2LCAA 4I55B 2L26A 1VQ9F 3HKCA 2AIZP 4F6RB 4R40B 2ZAUA 4ZHYB 5HWEA 4E6EA 3S0WA 1QU9A 5B8FA 3IKEA 3RYIB 4BVRA 3RYFB 2HS0A 3S0YA 3I55F 3SIUA 4C8IA 5LXTA 3M84A 3WJPA 1YJWF 3CCRF 2QI2A 3OBWA 3P0ZA 1YQNA 4U3JB 4X1IB 5IJ9B 1PXWA 5LOVA 1W5BA 3JALA 2EWCA 2K1SA 3D54A 3ESJA 1YJNF 3B6NA 2BTUA 5ITZA 2P6YA 1W581 1W3EX 3HKBA 1NJIH 3N4ZA 1KNJA 5HXZA 2YXZA 2KGWA 1TVKA 1XRGA 5C8YB 3C9RA 1DBFA 3E22B 5J2UA 3KJJA 2Z1FA 2Z1EA 3MCAB 3R0PA 3SIVA 2LBTA 4DRXA 3OW2F 3S03A 1JN1A 2VAPA 3JALB 4LNUA 1VQ7F 2VXYA 5HXUA 3KHNA 4TV9B 5JQGA 1W2BF 5CB4A 1TVKB 5C8YA 3GTZA 3N2GA 5EZYA 3CC4F 1RA4A 4O2AB 4U39A 1SA0B 1W55A 4NQ3A 5KMGA 5LXTB 4BVTA 3FD5A 1IV1A 2OHWA 2QA4F 4G4WA 1W41A 1M90H 4C81A 4RQOA 2MQEA 5IJ9A 3QTYA 1W5AA 4ZHWA 4C82A 5IJ0B 2CZWA 2VAMA 3CCVF 3N2KB 2NMUA 2VAWA 2OZBA 4ZOLB 4O4JA 3KE1A 3JAWB 3MCQA 2UYKA 4BT3A 1NMUB 3RE3A 3WGKA 2BTQB 1H48A 3JVHA 3TD4A 2CW4A 2HRUA 2RHJA 4O2BA 3VTIC 5JH7A 2YYEA 3NVKE 3I7TA 4O4LB 1COMA 3WGMA 4O4HA 5JQGB 4O2BB 1KQSF 1CK2A 1NQ3A 1U40A 3VMFB 1RLGA 1W5FA 2R6R1 4X1YA 3HKEA 3CCQF 4BT2A 1K73H 3RYHA 3G6EF 4B45A 3CPWF 2W8BC 1ODEA 4X1YB 3CXCF 3WPXA 1QD9A 1QAHA 1FSZA 4O4HB 3EORA 4BT7A 2Z1TA 3G4SF 2UZHA 3P4EA 1TUBB 3ELCA 1X7PA 3D01A 3CYPB 3CPQA 3HTNA 3HJWC 2LBXA 3K0TA 5G4UC 3J81M 4BW0B 3LYBA 1KC8H 4X1IA 3NMUC 4IIJB 3QUWA 1Q81H 3S06A 1FFXB 5KX5B 5GANK 1YJ9F 5HP7A 5J2TA 1VQ8F 4TV9A 4FFBB 2OTJF 1VQVA 2CWJA 5EB1B 4M8IA 3JARA 2Q1XA 4X1KB 5EYPA 5FNVB 3P10A 1QVFF 2AIFA 3RYIA 4BT4A 1W40A 5EIBD 1VQLF 2UYPA 2RHHA 3CB2A 1XBIA 4IHJB 4G4YA 4LNUB 4NWOB 5FLXM 3VIUA 3LWVC 3HKDA 5MN5A 5GINC 3VI6A 3ZP7A 2HX0A 5HY2A 4G88A 3WGJA 2KTUA 3G71F 3E22A 5J2UB 5EB0A 2IG8A 3RA6A 3HAXD 4C8EA 4B46A 1X7OA 5AVMA 2HP3A 3V4DA 3CCEF 4DXDA 5JCOA 4EI8A 2Q1YA 4I50B 5LA6A 1UI9A 2GVIA 4DRXB 5LP6C 3I56F 1SDSA 4C4WC 2H8EA 4O4IA 3IMPA 1JD1A 1VQ4F 5DCVA 3T80A 1X25A 2G9IA 3WGNA 2ZF8A 3J80M 5G4VC 2UYNA 1Z5VA 2CHTA 1VQPF 1W59A 3E20B 1GO1A 1K8AH 1YI2F 4O4JB 5HY0A 1IPAA 1IV2A 3MBMA 3LWRC 4I50A 3PAFA 5GIOC 3HKEB 1M1KH 3JATB 3KIZA 3OBYA 1ZWZA 3D00A 1U3LA 5IJ0A 2HP0A 4WBNA 1H7MA 2OTLF 3K2XA 3JASA 3WJRA 4U3JA 1H47A 3CCUF 1W5EA 3CCJF 4TV8B 4EB6B 1OAPA 3CD6F 5JH7B 2GLZA 3MQWA 5EZYB 1UFYA 1KNKA 3N4YA 3VYUC 1YGYA 3N2KA 3FFMA 1Q86H 3DC2A 1W57A 3UT5A 3DDNA 5HP8A 5BMVA 4XCQA 3IEQA 1JJ2F 2BTOA 3GHZA 4X1KA 2I6DA 2H6LA 3V3TA 3JARB 2RB9A 3JAMM 4EB6A 2N48A 3J7AR 2I6RA 1SZQA 1RQ2A 1IV4A 3F0DA 5CA1A 1QVGF 2ALEA 1R1MA 2IAFA 3OONA 3HWUA 2RHLA 2HS3A 5IT9M 1Q8RA 2Z1UA 5EO3A 1SA0A 1TUBA 2PHNA 4B62A 3V7QA 5EAZA
chains in the Genus database with same CATH topology
5GIPC 2LBWA 1S72F 3LWOC 1CN7A 4LCKA 1YITF 3CG6A 1T0KB 3PLAC 1X52A 1N8RH 1QVFF 2AIFA 3CC2F 1W40A 4NUTA 3MCAB 4X3MA 3AGKA 1VQLF 3JCMM 1XBIA 3RA5A 3SIVA 2JNBA 3OW2F 1VQ7F 2F9ZC 5HXUA 1Q7YH 5FLXM 3LWVC 1W2BF 3NK7A 5GINC 3VI6A 1VQKF 5HY2A 2OTJF 5FJ4C 2KTVA 1VQ6F 2KTUA 2KG4A 3G71F 1W42A 4X3LA 3RA6A 1RA4A 3CC4F 4NQ3A 2QEXF 3HAXD 5GAPK 4BVTA 1X7OA 1YHQF 5EWRA 2OHWA 3CCEF 2QA4F 4EI8A 4BVQA 1VQMF 1W41A 1M90H 1SDSA 3I56F 3WXMB 4BY9D 1VQOF 3CCLF 1KD1H 2HVYD 4C4WC 2CZWA 3CCVF 1VQ4F 4EI7A 5DCVA 1GZ0A 3J80M 2VGNA 2OZBA 5G4VC 3NVIB 3LFOA 5HY1A 3V7EA 5HY4A 3CC7F 3E1YA 1VQPF 3E20B 1GO1A 3LWPC 1Q82H 1K8AH 1NMUB 1YI2F 5HY0A 1IPAA 3NK6A 1E7KA 3LWRC 1VQNF 3PAFA 2BO1A 5GIOC 4BVSA 1M1KH 1GO0A 3OBYA 1ZWZA 3D00A 2FC3A 4TZZA 1H7MA 3IR9A 2OTLF 3LWQC 3CCUF 3NVKE 3CCJF 1VQ5F 3CD6F 1KQSF 2GLZA 5A2QM 1CK2A 3VMFB 1VQ9F 1RLGA 3N4YA 3CCQF 3FFMA 3O85A 1Q86H 5HWEA 1K73H 3G6EF 3CPWF 3CCMF 4XCQA 4BVRA 1JJ2F 3CXCF 2I6DA 3I55F 3SIUA 3V3TA 1YIJF 2WALA 3JAMM 3J7AR 3CCSF 1YJWF 1K9MH 3CCRF 2QI2A 3OBWA 4EI9A 3CMAF 3G4SF 1QVGF 2ALEA 3CMEF 1PXWA 1X7PA 2VGMA 3CPQA 2FGYA 3HJWC 1DT9A 5IT9M 2LBXA 5G4UC 3J81M 1YJNF 4BW0B 5EO3A 1KC8H 3NMUC 3GYQA 1Q81H 5GANK 1YJ9F 1W3EX 1NJIH 1VQ8F 3N4ZA 3V7QA 5HXZA 3ON1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GIP C;  2LBW A;  1S72 F;  3LWO C;  1CN7 A;  4LCK A;  1YIT F;  3CG6 A;  1T0K B;  3PLA C;  1X52 A;  1N8R H;  1QVF F;  2AIF A;  3CC2 F;  1W40 A;  4NUT A;  3MCA B;  4X3M A;  3AGK A;  1VQL F;  3JCM M;  1XBI A;  3RA5 A;  3SIV A;  2JNB A;  3OW2 F;  1VQ7 F;  1Q7Y H;  5FLX M;  3LWV C;  1W2B F;  3NK7 A;  5GIN C;  3VI6 A;  1VQK F;  2OTJ F;  5FJ4 C;  2KTV A;  1VQ6 F;  2KTU A;  2KG4 A;  3G71 F;  1W42 A;  4X3L A;  3RA6 A;  1RA4 A;  3CC4 F;  2QEX F;  3HAX D;  5GAP K;  1X7O A;  1YHQ F;  5EWR A;  2OHW A;  3CCE F;  2QA4 F;  1VQM F;  1W41 A;  1M90 H;  1SDS A;  3I56 F;  3WXM B;  4BY9 D;  1VQO F;  3CCL F;  1KD1 H;  2HVY D;  4C4W C;  2CZW A;  3CCV F;  1VQ4 F;  5DCV A;  1GZ0 A;  3J80 M;  2VGN A;  2OZB A;  5G4V C;  3NVI B;  3LFO A;  3V7E A;  3CC7 F;  3E1Y A;  1VQP F;  3E20 B;  1GO1 A;  3LWP C;  1Q82 H;  1K8A H;  1NMU B;  1YI2 F;  1IPA A;  3NK6 A;  1E7K A;  3LWR C;  1VQN F;  3PAF A;  2BO1 A;  5GIO C;  1M1K H;  1GO0 A;  3OBY A;  1ZWZ A;  2FC3 A;  4TZZ A;  1H7M A;  3IR9 A;  2OTL F;  3LWQ C;  3CCU F;  3NVK E;  3CCJ F;  1VQ5 F;  3CD6 F;  1KQS F;  5A2Q M;  1CK2 A;  3VMF B;  1VQ9 F;  1RLG A;  3N4Y A;  3CCQ F;  3FFM A;  3O85 A;  1Q86 H;  1K73 H;  3G6E F;  3CPW F;  3CCM F;  1JJ2 F;  3CXC F;  2I6D A;  3I55 F;  3SIU A;  1YIJ F;  2WAL A;  3JAM M;  3J7A R;  3CCS F;  1YJW F;  1K9M H;  3CCR F;  2QI2 A;  3OBW A;  3CMA F;  3G4S F;  1QVG F;  2ALE A;  3CME F;  1PXW A;  1X7P A;  2VGM A;  3CPQ A;  3HJW C;  1DT9 A;  5IT9 M;  2LBX A;  5G4U C;  3J81 M;  1YJN F;  4BW0 B;  5EO3 A;  1KC8 H;  3NMU C;  3GYQ A;  1Q81 H;  5GAN K;  1YJ9 F;  1W3E X;  1NJI H;  1VQ8 F;  3N4Z A;  3V7Q A;  3ON1 A; 
#chains in the Genus database with same CATH topology
 3LWO C;  5MN6 A;  1CN7 A;  4LCK A;  1JFF B;  4I4T B;  3CG6 A;  3BYQ A;  3F6M A;  3MDO A;  3F0F A;  3CC2 F;  4NUT A;  3JAW A;  2ZOV A;  3VCZ A;  4BT6 A;  3ZO8 A;  5MN4 A;  5LA6 B;  1Q7Y H;  1JFF A;  2IQQ A;  3F0E A;  3L7Q A;  5EIB C;  1VK3 A;  1XHO A;  3S02 A;  4TUY A;  4BT5 A;  1VQ6 F;  3S0H A;  3HKC B;  1JY8 A;  4X3L A;  3FPI A;  3HKD B;  3M4S A;  4HNA B;  1ONI A;  5EWR A;  4O2A A;  5KMG B;  1VHA A;  4FFB A;  4BVQ A;  3WXM B;  4BY9 D;  3JAK B;  4WBN B;  4TUY B;  3VO8 A;  3KJK A;  3ZOP A;  2DYY A;  1OFU A;  5JCO C;  2VGN A;  5EYP B;  2GZL A;  3NVI B;  5HY1 A;  3V7E A;  4TV8 A;  3CC7 F;  3E1Y A;  3IEW A;  5LP6 B;  3LWP C;  4YJ3 A;  1Q82 H;  1FNJ A;  4X20 A;  2HQS C;  3NK6 A;  3ERN A;  1VQN F;  2DT4 A;  3VOB A;  4BVS A;  2CHS A;  1J7H A;  3I3F A;  1GO0 A;  5LYJ A;  1RQ7 A;  2FC3 A;  1XV2 A;  4I55 A;  4TZZ A;  4RHA A;  3IR9 A;  4YJ2 A;  3N2G B;  5ITZ B;  1Z5W A;  3ZP4 A;  3WJQ A;  1FNK A;  2HP0 B;  5A2Q M;  3JAT A;  3O85 A;  4YJ3 B;  3RYC A;  4O4I B;  5CA0 B;  4YJ2 B;  3CCM F;  1PF5 A;  4I4T A;  3U0O A;  1YIJ F;  5BMV B;  2WAL A;  4C8G A;  4PWT A;  3JAK A;  3CCS F;  1K9M H;  2OTM A;  2ZVY A;  4EI9 A;  1U3P A;  3CMA F;  2UYJ A;  3K12 A;  3CME F;  4G4X A;  3TD5 A;  4ZK7 A;  2B33 A;  2VGM A;  2FGY A;  3QHD A;  1GX1 A;  1DT9 A;  5LOV B;  5GON B;  2H8C A;  5J2T B;  3K14 A;  2AMT A;  2V9Y A;  4IIJ A;  2QTP A;  2ZOD A;  3GYQ A;  3JAS B;  3FD6 A;  4X20 B;  1U43 A;  2CVL A;  3F0G A;  3Q8H A;  3VYT C;  3WPW A;  3ON1 A;  5FNV A;  5GIP C;  2LBW A;  1S72 F;  4ZOL A;  3C9U A;  1YIT F;  3PLA C;  1T0K B;  1X52 A;  1N8R H;  3FBA A;  4IHJ A;  4X3M A;  3AGK A;  4KWE A;  3JCM M;  5CB4 B;  4G4Z A;  3C8L A;  1RLU A;  3RA5 A;  2JNB A;  2HRY A;  3WGL A;  2F9Z C;  5JVD A;  3NK7 A;  1VQK F;  3CYQ A;  3VYS C;  3RYC B;  5FJ4 C;  2KTV A;  2PMP A;  4ZHQ A;  1FFX A;  2KG4 A;  5KX5 A;  1W42 A;  2QEX F;  5GAP K;  3VOA A;  1YHQ F;  4G4V A;  2R75 1;  5GON A;  3TD3 A;  3C9T A;  4B5C A;  1VQM F;  4ZI7 B;  5IYZ B;  4ZHV A;  1VQO F;  3CCL F;  2Z01 A;  1KD1 H;  2HVY D;  3RYH B;  1IV3 A;  5JVD B;  4EI7 A;  2UYN B;  1GZ0 A;  1VH8 A;  3C9S A;  3LFO A;  5HY4 A;  3UT5 B;  4ERH A;  3HKB B;  4F6R A;  5CA0 A;  3M1X A;  1E7K A;  1T0A A;  5IYZ A;  4ZI7 A;  2BO1 A;  2RHO A;  3LDT A;  2CSL A;  1CLI A;  5LYJ B;  3RYF A;  3IKF A;  4ZHQ B;  5CA1 B;  3LWQ C;  4O4L A;  5LP6 A;  1VQ5 F;  3LME A;  2ZVZ A;  4HNA A;  2HS4 A;  2LCA A;  4I55 B;  2L26 A;  1VQ9 F;  3HKC A;  2AIZ P;  4F6R B;  4R40 B;  2ZAU A;  4ZHY B;  5HWE A;  4E6E A;  3S0W A;  1QU9 A;  5B8F A;  3IKE A;  3RYI B;  4BVR A;  3RYF B;  2HS0 A;  3S0Y A;  3I55 F;  3SIU A;  4C8I A;  5LXT A;  3M84 A;  3WJP A;  1YJW F;  3CCR F;  2QI2 A;  3OBW A;  3P0Z A;  1YQN A;  4U3J B;  4X1I B;  5IJ9 B;  1PXW A;  5LOV A;  1W5B A;  3JAL A;  2EWC A;  2K1S A;  3D54 A;  3ESJ A;  1YJN F;  3B6N A;  2BTU A;  5ITZ A;  2P6Y A;  1W58 1;  1W3E X;  3HKB A;  1NJI H;  3N4Z A;  1KNJ A;  5HXZ A;  2YXZ A;  2KGW A;  1TVK A;  1XRG A;  5C8Y B;  3C9R A;  1DBF A;  3E22 B;  5J2U A;  3KJJ A;  2Z1F A;  2Z1E A;  3MCA B;  3R0P A;  3SIV A;  2LBT A;  4DRX A;  3OW2 F;  3S03 A;  1JN1 A;  2VAP A;  3JAL B;  4LNU A;  1VQ7 F;  2VXY A;  5HXU A;  3KHN A;  4TV9 B;  5JQG A;  1W2B F;  5CB4 A;  1TVK B;  5C8Y A;  3GTZ A;  3N2G A;  5EZY A;  3CC4 F;  1RA4 A;  4O2A B;  4U39 A;  1SA0 B;  1W55 A;  4NQ3 A;  5KMG A;  5LXT B;  4BVT A;  3FD5 A;  1IV1 A;  2OHW A;  2QA4 F;  4G4W A;  1W41 A;  1M90 H;  4C81 A;  4RQO A;  2MQE A;  5IJ9 A;  3QTY A;  1W5A A;  4ZHW A;  4C82 A;  5IJ0 B;  2CZW A;  2VAM A;  3CCV F;  3N2K B;  2NMU A;  2VAW A;  2OZB A;  4ZOL B;  4O4J A;  3KE1 A;  3JAW B;  3MCQ A;  2UYK A;  4BT3 A;  1NMU B;  3RE3 A;  3WGK A;  2BTQ B;  1H48 A;  3JVH A;  3TD4 A;  2CW4 A;  2HRU A;  2RHJ A;  4O2B A;  3VTI C;  5JH7 A;  2YYE A;  3NVK E;  3I7T A;  4O4L B;  1COM A;  3WGM A;  4O4H A;  5JQG B;  4O2B B;  1KQS F;  1CK2 A;  1NQ3 A;  1U40 A;  3VMF B;  1RLG A;  1W5F A;  2R6R 1;  4X1Y A;  3HKE A;  3CCQ F;  4BT2 A;  1K73 H;  3RYH A;  3G6E F;  4B45 A;  3CPW F;  2W8B C;  1ODE A;  4X1Y B;  3CXC F;  3WPX A;  1QD9 A;  1QAH A;  1FSZ A;  4O4H B;  3EOR A;  4BT7 A;  2Z1T A;  3G4S F;  2UZH A;  3P4E A;  1TUB B;  3ELC A;  1X7P A;  3D01 A;  3CYP B;  3CPQ A;  3HTN A;  3HJW C;  2LBX A;  3K0T A;  5G4U C;  3J81 M;  4BW0 B;  3LYB A;  1KC8 H;  4X1I A;  3NMU C;  4IIJ B;  3QUW A;  1Q81 H;  3S06 A;  1FFX B;  5KX5 B;  5GAN K;  1YJ9 F;  5HP7 A;  5J2T A;  1VQ8 F;  4TV9 A;  4FFB B;  2OTJ F;  1VQV A;  2CWJ A;  5EB1 B;  4M8I A;  3JAR A;  2Q1X A;  4X1K B;  5EYP A;  5FNV B;  3P10 A;  1QVF F;  2AIF A;  3RYI A;  4BT4 A;  1W40 A;  5EIB D;  1VQL F;  2UYP A;  2RHH A;  3CB2 A;  1XBI A;  4IHJ B;  4G4Y A;  4LNU B;  4NWO B;  5FLX M;  3VIU A;  3LWV C;  3HKD A;  5MN5 A;  5GIN C;  3VI6 A;  3ZP7 A;  2HX0 A;  5HY2 A;  4G88 A;  3WGJ A;  2KTU A;  3G71 F;  3E22 A;  5J2U B;  5EB0 A;  2IG8 A;  3RA6 A;  3HAX D;  4C8E A;  4B46 A;  1X7O A;  5AVM A;  2HP3 A;  3V4D A;  3CCE F;  4DXD A;  5JCO A;  4EI8 A;  2Q1Y A;  4I50 B;  5LA6 A;  1UI9 A;  2GVI A;  4DRX B;  5LP6 C;  3I56 F;  1SDS A;  4C4W C;  2H8E A;  4O4I A;  3IMP A;  1JD1 A;  1VQ4 F;  5DCV A;  3T80 A;  1X25 A;  2G9I A;  3WGN A;  2ZF8 A;  3J80 M;  5G4V C;  2UYN A;  1Z5V A;  2CHT A;  1VQP F;  1W59 A;  3E20 B;  1GO1 A;  1K8A H;  1YI2 F;  4O4J B;  5HY0 A;  1IPA A;  1IV2 A;  3MBM A;  3LWR C;  4I50 A;  3PAF A;  5GIO C;  3HKE B;  1M1K H;  3JAT B;  3KIZ A;  3OBY A;  1ZWZ A;  3D00 A;  1U3L A;  5IJ0 A;  2HP0 A;  4WBN A;  1H7M A;  2OTL F;  3K2X A;  3JAS A;  3WJR A;  4U3J A;  1H47 A;  3CCU F;  1W5E A;  3CCJ F;  4TV8 B;  4EB6 B;  1OAP A;  3CD6 F;  5JH7 B;  2GLZ A;  3MQW A;  5EZY B;  1UFY A;  1KNK A;  3N4Y A;  3VYU C;  1YGY A;  3N2K A;  3FFM A;  1Q86 H;  3DC2 A;  1W57 A;  3UT5 A;  3DDN A;  5HP8 A;  5BMV A;  4XCQ A;  3IEQ A;  1JJ2 F;  2BTO A;  3GHZ A;  4X1K A;  2I6D A;  2H6L A;  3V3T A;  3JAR B;  2RB9 A;  3JAM M;  4EB6 A;  2N48 A;  3J7A R;  2I6R A;  1SZQ A;  1RQ2 A;  1IV4 A;  3F0D A;  5CA1 A;  1QVG F;  2ALE A;  1R1M A;  2IAF A;  3OON A;  3HWU A;  2RHL A;  2HS3 A;  5IT9 M;  1Q8R A;  2Z1U A;  5EO3 A;  1SA0 A;  1TUB A;  2PHN A;  4B62 A;  3V7Q A;  5EAZ A; 
#chains in the Genus database with same CATH homology
 5GIP C;  2LBW A;  1S72 F;  3LWO C;  1CN7 A;  4LCK A;  1YIT F;  3CG6 A;  1T0K B;  3PLA C;  1X52 A;  1N8R H;  1QVF F;  2AIF A;  3CC2 F;  1W40 A;  4NUT A;  3MCA B;  4X3M A;  3AGK A;  1VQL F;  3JCM M;  1XBI A;  3RA5 A;  3SIV A;  2JNB A;  3OW2 F;  1VQ7 F;  2F9Z C;  5HXU A;  1Q7Y H;  5FLX M;  3LWV C;  1W2B F;  3NK7 A;  5GIN C;  3VI6 A;  1VQK F;  5HY2 A;  2OTJ F;  5FJ4 C;  2KTV A;  1VQ6 F;  2KTU A;  2KG4 A;  3G71 F;  1W42 A;  4X3L A;  3RA6 A;  1RA4 A;  3CC4 F;  4NQ3 A;  2QEX F;  3HAX D;  5GAP K;  4BVT A;  1X7O A;  1YHQ F;  5EWR A;  2OHW A;  3CCE F;  2QA4 F;  4EI8 A;  4BVQ A;  1VQM F;  1W41 A;  1M90 H;  1SDS A;  3I56 F;  3WXM B;  4BY9 D;  1VQO F;  3CCL F;  1KD1 H;  2HVY D;  4C4W C;  2CZW A;  3CCV F;  1VQ4 F;  4EI7 A;  5DCV A;  1GZ0 A;  3J80 M;  2VGN A;  2OZB A;  5G4V C;  3NVI B;  3LFO A;  5HY1 A;  3V7E A;  5HY4 A;  3CC7 F;  3E1Y A;  1VQP F;  3E20 B;  1GO1 A;  3LWP C;  1Q82 H;  1K8A H;  1NMU B;  1YI2 F;  5HY0 A;  1IPA A;  3NK6 A;  1E7K A;  3LWR C;  1VQN F;  3PAF A;  2BO1 A;  5GIO C;  4BVS A;  1M1K H;  1GO0 A;  3OBY A;  1ZWZ A;  3D00 A;  2FC3 A;  4TZZ A;  1H7M A;  3IR9 A;  2OTL F;  3LWQ C;  3CCU F;  3NVK E;  3CCJ F;  1VQ5 F;  3CD6 F;  1KQS F;  2GLZ A;  5A2Q M;  1CK2 A;  3VMF B;  1VQ9 F;  1RLG A;  3N4Y A;  3CCQ F;  3FFM A;  3O85 A;  1Q86 H;  5HWE A;  1K73 H;  3G6E F;  3CPW F;  3CCM F;  4XCQ A;  4BVR A;  1JJ2 F;  3CXC F;  2I6D A;  3I55 F;  3SIU A;  3V3T A;  1YIJ F;  2WAL A;  3JAM M;  3J7A R;  3CCS F;  1YJW F;  1K9M H;  3CCR F;  2QI2 A;  3OBW A;  4EI9 A;  3CMA F;  3G4S F;  1QVG F;  2ALE A;  3CME F;  1PXW A;  1X7P A;  2VGM A;  3CPQ A;  2FGY A;  3HJW C;  1DT9 A;  5IT9 M;  2LBX A;  5G4U C;  3J81 M;  1YJN F;  4BW0 B;  5EO3 A;  1KC8 H;  3NMU C;  3GYQ A;  1Q81 H;  5GAN K;  1YJ9 F;  1W3E X;  1NJI H;  1VQ8 F;  3N4Z A;  3V7Q A;  5HXZ A;  3ON1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...