3CCSF

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule keywords 50S ribosomal protein L2P
molecule tags Ribosome
total genus 32
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ccsF00
1X52A 3PAFA 1CK2A 3CCEF 4BY9D 1E7KA 2HVYD 3E20B 1X7PA 4BW0B 3G4SF 3RA5A 3CXCF 1W41A 5FJ4C 2BO1A 2OZBA 3OBWA 3CD6F 3RA6A 2QA4F 1K8AH 1K9MH 3OBYA 2FC3A 2QI2A 3FFMA 1Q82H 5G4VC 2KTUA 3NK7A 1CN7A 1VQ6F 3CCVF 4TZZA 1GZ0A 1T0KB 5GIOC 2OTLF 1H7MA 2JNBA 2VGNA 1W3EX 2OHWA 3CCRF 1Q81H 1GO0A 5GIPC 3WXMB 3SIVA 1RLGA 2LBXA 3V7QA 1K73H 3IR9A 3LFOA 1N8RH 1NMUB 3AGKA 3J7AR 1QVFF 3HJWC 5G4UC 1KQSF 2KTVA 3E1YA 1W40A 3G6EF 1VQKF 1RA4A 3CC4F 3CMAF 1W2BF 3LWOC 1W42A 5FLXM 3CCQF 1XBIA 1SDSA 3NVKE 1VQNF 3LWRC 2ALEA 3I55F 1VQ9F 2LBWA 3ON1A 3CCSF 3I56F 1YIJF 1M90H 1X7OA 3N4ZA 3LWPC 1S72F 3NK6A 5GINC 5DCVA 1VQOF 3HAXD 3CC2F 1VQLF 3SIUA 5EO3A 1NJIH 1JJ2F 3O85A 5GAPK 2QEXF 1YITF 3V7EA 3CC7F 3JCMM 1GO1A 3CMEF 4X3MA 3OW2F 4NUTA 1VQ8F 1M1KH 3NVIB 1YJNF 3PLAC 3CG6A 2AIFA 4LCKA 1VQPF 1YJ9F 2I6DA 3CPQA 5EWRA 1YJWF 3N4YA 1VQ4F 3JAMM 3GYQA 1Q7YH 1ZWZA 1IPAA 2WALA 5A2QM 1YI2F 1YHQF 4X3LA 3CCJF 2CZWA 1VQ7F 3VI6A 3CPWF 1Q86H 5IT9M 1DT9A 3LWVC 3CCUF 1PXWA 1KC8H 2OTJF 3J80M 3G71F 1KD1H 4C4WC 3J81M 3CCLF 1QVGF 3NMUC 2KG4A 3VMFB 2VGMA 3MCAB 3CCMF 5GANK 1VQMF 3LWQC 1VQ5F
chains in the Genus database with same CATH superfamily
1X52A 2HVYD 1X7PA 3B6NA 2YXZA 3JALB 4X20A 2VAMA 5EB1B 5MN5A 1W581 2FC3A 3MQWA 3FFMA 1CN7A 2YYEA 2UYJA 3WJRA 3TD4A 2VAPA 2L26A 5J2TB 5GIOC 2H8EA 2H8CA 3Q8HA 2VGNA 2QTPA 1W3EX 2OHWA 2B33A 5KMGA 4O2AB 5JQGA 3SIVA 3EORA 3IEQA 4O4HA 3KJKA 2UYKA 5LOVA 3IR9A 3VTIC 5EAZA 3LFOA 4O2BA 3AGKA 4X1YB 3GTZA 3HJWC 5JVDA 4EB6B 2VXYA 4DRXB 1VQKF 3WGKA 3JAKA 5MN6A 4NQ3A 3JAWB 3VOBA 3CCQF 5FLXM 3C9UA 1SDSA 1RQ7A 5HWEA 3HWUA 1TUBA 2BTQB 2Z1FA 5EB0A 2Z01A 2HS4A 2RB9A 5AVMA 4G4XA 2HP0B 3HKEA 3LWPC 5LP6B 5HP7A 2PMPA 1JFFA 1VQLF 2CW4A 3F0EA 4BVQA 1NJIH 1XHOA 5CA0A 5IJ0A 2V9YA 4E6EA 4U39A 4YJ2B 4RQOA 3JCMM 3KE1A 5IYZB 3P10A 3MCQA 4IHJB 1YJNF 1IV4A 2Q1YA 1VQPF 3HKBB 3N2GB 4F6RB 1YJWF 4C8EA 1W57A 4EI7A 3HKCA 1RQ2A 1IPAA 3LYBA 3JATB 2HRUA 4I50A 1YHQF 1ODEA 3F6MA 2RHJA 3V3TA 1Q86H 1DT9A 3LMEA 3QHDA 3D01A 1SA0B 1FNKA 1PXWA 1W5AA 1OFUA 3J80M 1QU9A 3J81M 3HTNA 3CCLF 4TV9A 5CA1A 1YGYA 5FNVA 1VK3A 5HY0A 3PAFA 4FFBB 5CB4B 1OAPA 4BW0B 3G4SF 4I55B 3RYIB 1VH8A 1W41A 2BO1A 4WBNA 1U43A 3CD6F 3WPXA 1UFYA 3DDNA 5KX5A 3IMPA 3JARB 2MQEA 4O4IB 3BYQA 1Q82H 5EIBC 4ZK7A 2HS0A 4G4WA 3C9TA 1T0KB 4I4TB 5EYPB 2OTLF 1H7MA 1XV2A 3MDOA 1T0AA 2JNBA 3S02A 5LA6B 5LYJB 3CCRF 4ZHWA 1GO0A 5EIBD 5GIPC 1QAHA 3WXMB 3V7QA 3N2KB 2IAFA 3MBMA 5GONA 1JN1A 4ZI7A 4O4JA 2N48A 1FSZA 3E1YA 2CVLA 1RA4A 3CC4F 2HP3A 4ZHVA 1W2BF 4ZHQB 4PWTA 1W42A 2Z1TA 1U40A 2GVIA 2DYYA 5HY4A 3CYPB 2LBWA 3CCSF 2CHSA 4X1IA 3CYQA 3JASB 3QTYA 3VO8A 1R1MA 4ZOLB 2ZOVA 1M90H 3WGJA 3HKDA 3WPWA 4HNAA 3RYFA 1Q8RA 3TD3A 2AMTA 1UI9A 1JJ2F 4TUYA 5GAPK 1YITF 3V7EA 4TV8A 5C8YA 4BVTA 1GO1A 5ITZB 5BMVA 3TD5A 1W55A 4NUTA 1VQ8F 3IKEA 3NVIB 2R751 3CG6A 2AIFA 5IJ9A 2I6DA 4XCQA 4X1KA 3UT5A 3JAMM 2UZHA 4BT4A 2BTUA 3GYQA 2HQSC 2BTOA 4U3JA 1Q7YH 3QUWA 3RYCA 1ZWZA 2CSLA 2WALA 3GHZA 3K2XA 4B46A 4DXDA 2UYNB 3JALA 2K1SA 3VI6A 1KNKA 3FD6A 3WGMA 3LWVC 5HP8A 1TVKB 3S0YA 5JH7B 4LNUB 3G71F 1KD1H 1H47A 1QVGF 3RYCB 5J2TA 1DBFA 5LP6C 3NMUC 2GZLA 2ZF8A 3MCAB 3VMFB 3K14A 4O2AA 4BT7A 3LWQC 3CCEF 1CK2A 1E7KA 4YJ3B 2IG8A 3IEWA 2AIZP 4IIJB 3RA5A 2Q1XA 3VYTC 1IV3A 4BVSA 5MN4A 2Z1EA 5LXTB 3I7TA 4X1YA 1VQVA 1FFXB 3M84A 3RYHB 2DT4A 3ZP7A 4EB6A 1K9MH 1H48A 3E22B 3OBYA 4DRXA 1W5EA 2RHHA 2QI2A 3CCVF 1XRGA 1IV2A 2HRYA 3JAWA 3ELCA 4G4ZA 5J2UB 2ZVZA 3DC2A 5EZYB 3KIZA 2GLZA 2LCAA 2LBXA 2ZVYA 1JY8A 1K73H 2HX0A 2HP0A 5JCOC 1COMA 1RLUA 4X20B 5LP6A 3J7AR 2HS3A 4EI8A 1QVFF 4C8GA 3JVHA 1ONIA 3VOAA 1W40A 3G6EF 3CMAF 4EI9A 4YJ2A 3IKFA 5IYZA 3M1XA 3LWOC 1X25A 4IHJA 3M4SA 3HKBA 3N2GA 4F6RA 5KMGB 3ON1A 5JQGB 4B45A 1Z5VA 2Z1UA 4KWEA 1YIJF 3FBAA 1KNJA 4O4HB 2VAWA 5LOVB 3ZOPA 3N4ZA 3F0GA 4O2BB 4C81A 3S03A 1S72F 1PF5A 3KJJA 2UYPA 3VYUC 5GINC 4BVRA 3JATA 3HAXD 5JVDB 5DCVA 5EO3A 5HY2A 3P0ZA 3JAKB 3O85A 2QEXF 4R40B 3CMEF 1SA0A 4G88A 5JCOA 3U0OA 4LCKA 2H6LA 1YJ9F 3CPQA 1TUBB 5EWRA 3N4YA 1VQ4F 3L7QA 1JD1A 3HKEB 2ZAUA 4FFBA 1YI2F 2ZODA 5CB4A 2NMUA 3V4DA 1JFFB 4O4LB 4I55A 3RYIA 5CA0B 2CZWA 5IJ0B 3VCZA 1VQ7F 3CPWF 5IT9M 3S0HA 3CCUF 1W5FA 3JARA 3ZO8A 3VYSC 4O4IA 3FPIA 4G4YA 4C4WC 4BT3A 4RHAA 4I4TA 5EYPA 3RE3A 1W59A 2KG4A 3CCMF 5LA6A 3HKCB 5LYJA 2I6RA 2P6YA 3F0DA 3F0FA 3E20B 2RHOA 4BY9D 3N2KA 4I50B 3CXCF 5FJ4C 2OZBA 3OBWA 3RA6A 2QA4F 1K8AH 3WGNA 3LDTA 1GX1A 3C9RA 2W8BC 5G4VC 2KTUA 3NK7A 1W5BA 4B5CA 1VQ6F 4ZHQA 4TZZA 2RHLA 4G4VA 1GZ0A 4TV9B 3K0TA 5CA1B 2KGWA 3CB2A 5FNVB 3ERNA 1Q81H 1RLGA 3D00A 2OTMA 1QD9A 3JASA 3KHNA 3OONA 2CHTA 2FGYA 4ZOLA 5HXZA 3FD5A 1N8RH 1NMUB 4O4LA 4WBNB 2CWJA 5KX5B 5G4UC 1KQSF 2KTVA 2EWCA 2LBTA 5ITZA 3I3FA 4C82A 4BT5A 1XBIA 5HXUA 2F9ZC 3NVKE 1VQNF 3LWRC 2ALEA 3I55F 1VQ9F 1FNJA 3C9SA 2R6R1 3I56F 2IQQA 4BT2A 5GONB 1X7OA 4B62A 3S0WA 4ZI7B 4C8IA 4O4JB 3NK6A 1VQOF 1J7HA 3CC2F 3SIUA 2UYNA 3WGLA 3CC7F 1TVKA 4X3MA 3OW2F 4ZHYB 1U3PA 3K12A 5JH7A 1M1KH 3PLAC 3WJPA 4LNUA 1SZQA 3S06A 1Z5WA 5B8FA 4X1IB 3ESJA 3VIUA 1U3LA 3C8LA 3HKDB 4M8IA 4HNAB 4YJ3A 5A2QM 3RYFB 1CLIA 4IIJA 4X3LA 3T80A 3CCJF 4TUYB 3P4EA 1IV1A 1YQNA 3WJQA 4ERHA 5HY1A 5LXTA 4TV8B 5C8YB 3R0PA 1FFXA 3RYHA 1NQ3A 5BMVB 3E22A 4BT6A 1KC8H 2OTJF 5IJ9B 3D54A 4X1KB 3UT5B 1VHAA 2PHNA 2VGMA 4NWOB 4U3JB 5J2UA 5GANK 1VQMF 5EZYA 3ZP4A 2G9IA 1VQ5F
chains in the Genus database with same CATH topology
1X52A 3PAFA 1CK2A 3CCEF 4BY9D 1E7KA 2HVYD 3E20B 1X7PA 4BW0B 3G4SF 3RA5A 3CXCF 1W41A 4BVSA 5FJ4C 2BO1A 2OZBA 3OBWA 3CD6F 3RA6A 2QA4F 1K8AH 1K9MH 3OBYA 2FC3A 2QI2A 3FFMA 1Q82H 5G4VC 2KTUA 3NK7A 1CN7A 1VQ6F 3CCVF 4TZZA 1GZ0A 1T0KB 5GIOC 2OTLF 1H7MA 2JNBA 2VGNA 1W3EX 2OHWA 3CCRF 1Q81H 2GLZA 1GO0A 5GIPC 3WXMB 3SIVA 1RLGA 2LBXA 3D00A 3V7QA 1K73H 3IR9A 3LFOA 5HXZA 2FGYA 1N8RH 1NMUB 3AGKA 3J7AR 4EI8A 1QVFF 3HJWC 5G4UC 1KQSF 2KTVA 3E1YA 1W40A 3G6EF 1VQKF 1RA4A 3CC4F 3CMAF 4EI9A 4NQ3A 1W2BF 3LWOC 1W42A 5FLXM 3CCQF 1XBIA 5HXUA 2F9ZC 1SDSA 3NVKE 1VQNF 3LWRC 5HWEA 2ALEA 3I55F 1VQ9F 5HY4A 2LBWA 3ON1A 3CCSF 3I56F 1YIJF 1M90H 1X7OA 3N4ZA 3LWPC 1S72F 3NK6A 5GINC 5DCVA 4BVRA 1VQOF 3HAXD 3CC2F 1VQLF 3SIUA 5EO3A 4BVQA 5HY2A 1NJIH 1JJ2F 3O85A 5GAPK 2QEXF 1YITF 3V7EA 3CC7F 4BVTA 3JCMM 1GO1A 3CMEF 4X3MA 3OW2F 4NUTA 1VQ8F 1M1KH 3NVIB 1YJNF 3PLAC 3CG6A 2AIFA 4LCKA 1VQPF 1YJ9F 2I6DA 4XCQA 3CPQA 5EWRA 1YJWF 3N4YA 1VQ4F 3JAMM 3GYQA 4EI7A 1Q7YH 1ZWZA 1IPAA 2WALA 5A2QM 1YI2F 1YHQF 4X3LA 3CCJF 2CZWA 1VQ7F 3V3TA 5HY1A 3VI6A 3CPWF 1Q86H 5IT9M 1DT9A 3LWVC 3CCUF 1PXWA 1KC8H 2OTJF 3J80M 3G71F 1KD1H 4C4WC 3J81M 3CCLF 1QVGF 3NMUC 2KG4A 3VMFB 2VGMA 3MCAB 3CCMF 5GANK 1VQMF 5HY0A 3LWQC 1VQ5F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X52 A;  3PAF A;  1CK2 A;  3CCE F;  4BY9 D;  1E7K A;  2HVY D;  3E20 B;  1X7P A;  4BW0 B;  3G4S F;  3RA5 A;  3CXC F;  1W41 A;  5FJ4 C;  2BO1 A;  2OZB A;  3OBW A;  3CD6 F;  3RA6 A;  2QA4 F;  1K8A H;  1K9M H;  3OBY A;  2FC3 A;  2QI2 A;  3FFM A;  1Q82 H;  5G4V C;  2KTU A;  3NK7 A;  1CN7 A;  1VQ6 F;  3CCV F;  4TZZ A;  1GZ0 A;  1T0K B;  5GIO C;  2OTL F;  1H7M A;  2JNB A;  2VGN A;  1W3E X;  2OHW A;  3CCR F;  1Q81 H;  1GO0 A;  5GIP C;  3WXM B;  3SIV A;  1RLG A;  2LBX A;  3V7Q A;  1K73 H;  3IR9 A;  3LFO A;  1N8R H;  1NMU B;  3AGK A;  3J7A R;  1QVF F;  3HJW C;  5G4U C;  1KQS F;  2KTV A;  3E1Y A;  1W40 A;  3G6E F;  1VQK F;  1RA4 A;  3CC4 F;  3CMA F;  1W2B F;  3LWO C;  1W42 A;  5FLX M;  3CCQ F;  1XBI A;  1SDS A;  3NVK E;  1VQN F;  3LWR C;  2ALE A;  3I55 F;  1VQ9 F;  2LBW A;  3ON1 A;  3CCS F;  3I56 F;  1YIJ F;  1M90 H;  1X7O A;  3N4Z A;  3LWP C;  1S72 F;  3NK6 A;  5GIN C;  5DCV A;  1VQO F;  3HAX D;  3CC2 F;  1VQL F;  3SIU A;  5EO3 A;  1NJI H;  1JJ2 F;  3O85 A;  5GAP K;  2QEX F;  1YIT F;  3V7E A;  3CC7 F;  3JCM M;  1GO1 A;  3CME F;  4X3M A;  3OW2 F;  4NUT A;  1VQ8 F;  1M1K H;  3NVI B;  1YJN F;  3PLA C;  3CG6 A;  2AIF A;  4LCK A;  1VQP F;  1YJ9 F;  2I6D A;  3CPQ A;  5EWR A;  1YJW F;  3N4Y A;  1VQ4 F;  3JAM M;  3GYQ A;  1Q7Y H;  1ZWZ A;  1IPA A;  2WAL A;  5A2Q M;  1YI2 F;  1YHQ F;  4X3L A;  3CCJ F;  2CZW A;  1VQ7 F;  3VI6 A;  3CPW F;  1Q86 H;  5IT9 M;  1DT9 A;  3LWV C;  3CCU F;  1PXW A;  1KC8 H;  2OTJ F;  3J80 M;  3G71 F;  1KD1 H;  4C4W C;  3J81 M;  3CCL F;  1QVG F;  3NMU C;  2KG4 A;  3VMF B;  2VGM A;  3MCA B;  3CCM F;  5GAN K;  1VQM F;  3LWQ C;  1VQ5 F; 
#chains in the Genus database with same CATH topology
 1X52 A;  2HVY D;  1X7P A;  3B6N A;  2YXZ A;  3JAL B;  4X20 A;  2VAM A;  5EB1 B;  5MN5 A;  1W58 1;  2FC3 A;  3MQW A;  3FFM A;  1CN7 A;  2YYE A;  2UYJ A;  3WJR A;  3TD4 A;  2VAP A;  2L26 A;  5J2T B;  5GIO C;  2H8E A;  2H8C A;  3Q8H A;  2VGN A;  2QTP A;  1W3E X;  2OHW A;  2B33 A;  5KMG A;  4O2A B;  5JQG A;  3SIV A;  3EOR A;  3IEQ A;  4O4H A;  3KJK A;  2UYK A;  5LOV A;  3IR9 A;  3VTI C;  5EAZ A;  3LFO A;  4O2B A;  3AGK A;  4X1Y B;  3GTZ A;  3HJW C;  5JVD A;  4EB6 B;  2VXY A;  4DRX B;  1VQK F;  3WGK A;  3JAK A;  5MN6 A;  4NQ3 A;  3JAW B;  3VOB A;  3CCQ F;  5FLX M;  3C9U A;  1SDS A;  1RQ7 A;  5HWE A;  3HWU A;  1TUB A;  2BTQ B;  2Z1F A;  5EB0 A;  2Z01 A;  2HS4 A;  2RB9 A;  5AVM A;  4G4X A;  2HP0 B;  3HKE A;  3LWP C;  5LP6 B;  5HP7 A;  2PMP A;  1JFF A;  1VQL F;  2CW4 A;  3F0E A;  4BVQ A;  1NJI H;  1XHO A;  5CA0 A;  5IJ0 A;  2V9Y A;  4E6E A;  4U39 A;  4YJ2 B;  4RQO A;  3JCM M;  3KE1 A;  5IYZ B;  3P10 A;  3MCQ A;  4IHJ B;  1YJN F;  1IV4 A;  2Q1Y A;  1VQP F;  3HKB B;  3N2G B;  4F6R B;  1YJW F;  4C8E A;  1W57 A;  4EI7 A;  3HKC A;  1RQ2 A;  1IPA A;  3LYB A;  3JAT B;  2HRU A;  4I50 A;  1YHQ F;  1ODE A;  3F6M A;  2RHJ A;  3V3T A;  1Q86 H;  1DT9 A;  3LME A;  3QHD A;  3D01 A;  1SA0 B;  1FNK A;  1PXW A;  1W5A A;  1OFU A;  3J80 M;  1QU9 A;  3J81 M;  3HTN A;  3CCL F;  4TV9 A;  5CA1 A;  1YGY A;  5FNV A;  1VK3 A;  5HY0 A;  3PAF A;  4FFB B;  5CB4 B;  1OAP A;  4BW0 B;  3G4S F;  4I55 B;  3RYI B;  1VH8 A;  1W41 A;  2BO1 A;  4WBN A;  1U43 A;  3CD6 F;  3WPX A;  1UFY A;  3DDN A;  5KX5 A;  3IMP A;  3JAR B;  2MQE A;  4O4I B;  3BYQ A;  1Q82 H;  5EIB C;  4ZK7 A;  2HS0 A;  4G4W A;  3C9T A;  1T0K B;  4I4T B;  5EYP B;  2OTL F;  1H7M A;  1XV2 A;  3MDO A;  1T0A A;  2JNB A;  3S02 A;  5LA6 B;  5LYJ B;  3CCR F;  4ZHW A;  1GO0 A;  5EIB D;  5GIP C;  1QAH A;  3WXM B;  3V7Q A;  3N2K B;  2IAF A;  3MBM A;  5GON A;  1JN1 A;  4ZI7 A;  4O4J A;  2N48 A;  1FSZ A;  3E1Y A;  2CVL A;  1RA4 A;  3CC4 F;  2HP3 A;  4ZHV A;  1W2B F;  4ZHQ B;  4PWT A;  1W42 A;  2Z1T A;  1U40 A;  2GVI A;  2DYY A;  5HY4 A;  3CYP B;  2LBW A;  3CCS F;  2CHS A;  4X1I A;  3CYQ A;  3JAS B;  3QTY A;  3VO8 A;  1R1M A;  4ZOL B;  2ZOV A;  1M90 H;  3WGJ A;  3HKD A;  3WPW A;  4HNA A;  3RYF A;  1Q8R A;  3TD3 A;  2AMT A;  1UI9 A;  1JJ2 F;  4TUY A;  5GAP K;  1YIT F;  3V7E A;  4TV8 A;  5C8Y A;  4BVT A;  1GO1 A;  5ITZ B;  5BMV A;  3TD5 A;  1W55 A;  4NUT A;  1VQ8 F;  3IKE A;  3NVI B;  2R75 1;  3CG6 A;  2AIF A;  5IJ9 A;  2I6D A;  4XCQ A;  4X1K A;  3UT5 A;  3JAM M;  2UZH A;  4BT4 A;  2BTU A;  3GYQ A;  2HQS C;  2BTO A;  4U3J A;  1Q7Y H;  3QUW A;  3RYC A;  1ZWZ A;  2CSL A;  2WAL A;  3GHZ A;  3K2X A;  4B46 A;  4DXD A;  2UYN B;  3JAL A;  2K1S A;  3VI6 A;  1KNK A;  3FD6 A;  3WGM A;  3LWV C;  5HP8 A;  1TVK B;  3S0Y A;  5JH7 B;  4LNU B;  3G71 F;  1KD1 H;  1H47 A;  1QVG F;  3RYC B;  5J2T A;  1DBF A;  5LP6 C;  3NMU C;  2GZL A;  2ZF8 A;  3MCA B;  3VMF B;  3K14 A;  4O2A A;  4BT7 A;  3LWQ C;  3CCE F;  1CK2 A;  1E7K A;  4YJ3 B;  2IG8 A;  3IEW A;  2AIZ P;  4IIJ B;  3RA5 A;  2Q1X A;  3VYT C;  1IV3 A;  4BVS A;  5MN4 A;  2Z1E A;  5LXT B;  3I7T A;  4X1Y A;  1VQV A;  1FFX B;  3M84 A;  3RYH B;  2DT4 A;  3ZP7 A;  4EB6 A;  1K9M H;  1H48 A;  3E22 B;  3OBY A;  4DRX A;  1W5E A;  2RHH A;  2QI2 A;  3CCV F;  1XRG A;  1IV2 A;  2HRY A;  3JAW A;  3ELC A;  4G4Z A;  5J2U B;  2ZVZ A;  3DC2 A;  5EZY B;  3KIZ A;  2GLZ A;  2LCA A;  2LBX A;  2ZVY A;  1JY8 A;  1K73 H;  2HX0 A;  2HP0 A;  5JCO C;  1COM A;  1RLU A;  4X20 B;  5LP6 A;  3J7A R;  2HS3 A;  4EI8 A;  1QVF F;  4C8G A;  3JVH A;  1ONI A;  3VOA A;  1W40 A;  3G6E F;  3CMA F;  4EI9 A;  4YJ2 A;  3IKF A;  5IYZ A;  3M1X A;  3LWO C;  1X25 A;  4IHJ A;  3M4S A;  3HKB A;  3N2G A;  4F6R A;  5KMG B;  3ON1 A;  5JQG B;  4B45 A;  1Z5V A;  2Z1U A;  4KWE A;  1YIJ F;  3FBA A;  1KNJ A;  4O4H B;  2VAW A;  5LOV B;  3ZOP A;  3N4Z A;  3F0G A;  4O2B B;  4C81 A;  3S03 A;  1S72 F;  1PF5 A;  3KJJ A;  2UYP A;  3VYU C;  5GIN C;  4BVR A;  3JAT A;  3HAX D;  5JVD B;  5DCV A;  5EO3 A;  5HY2 A;  3P0Z A;  3JAK B;  3O85 A;  2QEX F;  4R40 B;  3CME F;  1SA0 A;  4G88 A;  5JCO A;  3U0O A;  4LCK A;  2H6L A;  1YJ9 F;  3CPQ A;  1TUB B;  5EWR A;  3N4Y A;  1VQ4 F;  3L7Q A;  1JD1 A;  3HKE B;  2ZAU A;  4FFB A;  1YI2 F;  2ZOD A;  5CB4 A;  2NMU A;  3V4D A;  1JFF B;  4O4L B;  4I55 A;  3RYI A;  5CA0 B;  2CZW A;  5IJ0 B;  3VCZ A;  1VQ7 F;  3CPW F;  5IT9 M;  3S0H A;  3CCU F;  1W5F A;  3JAR A;  3ZO8 A;  3VYS C;  4O4I A;  3FPI A;  4G4Y A;  4C4W C;  4BT3 A;  4RHA A;  4I4T A;  5EYP A;  3RE3 A;  1W59 A;  2KG4 A;  3CCM F;  5LA6 A;  3HKC B;  5LYJ A;  2I6R A;  2P6Y A;  3F0D A;  3F0F A;  3E20 B;  2RHO A;  4BY9 D;  3N2K A;  4I50 B;  3CXC F;  5FJ4 C;  2OZB A;  3OBW A;  3RA6 A;  2QA4 F;  1K8A H;  3WGN A;  3LDT A;  1GX1 A;  3C9R A;  2W8B C;  5G4V C;  2KTU A;  3NK7 A;  1W5B A;  4B5C A;  1VQ6 F;  4ZHQ A;  4TZZ A;  2RHL A;  4G4V A;  1GZ0 A;  4TV9 B;  3K0T A;  5CA1 B;  2KGW A;  3CB2 A;  5FNV B;  3ERN A;  1Q81 H;  1RLG A;  3D00 A;  2OTM A;  1QD9 A;  3JAS A;  3KHN A;  3OON A;  2CHT A;  2FGY A;  4ZOL A;  5HXZ A;  3FD5 A;  1N8R H;  1NMU B;  4O4L A;  4WBN B;  2CWJ A;  5KX5 B;  5G4U C;  1KQS F;  2KTV A;  2EWC A;  2LBT A;  5ITZ A;  3I3F A;  4C82 A;  4BT5 A;  1XBI A;  5HXU A;  2F9Z C;  3NVK E;  1VQN F;  3LWR C;  2ALE A;  3I55 F;  1VQ9 F;  1FNJ A;  3C9S A;  2R6R 1;  3I56 F;  2IQQ A;  4BT2 A;  5GON B;  1X7O A;  4B62 A;  3S0W A;  4ZI7 B;  4C8I A;  4O4J B;  3NK6 A;  1VQO F;  1J7H A;  3CC2 F;  3SIU A;  2UYN A;  3WGL A;  3CC7 F;  1TVK A;  4X3M A;  3OW2 F;  4ZHY B;  1U3P A;  3K12 A;  5JH7 A;  1M1K H;  3PLA C;  3WJP A;  4LNU A;  1SZQ A;  3S06 A;  1Z5W A;  5B8F A;  4X1I B;  3ESJ A;  3VIU A;  1U3L A;  3C8L A;  3HKD B;  4M8I A;  4HNA B;  4YJ3 A;  5A2Q M;  3RYF B;  1CLI A;  4IIJ A;  4X3L A;  3T80 A;  3CCJ F;  4TUY B;  3P4E A;  1IV1 A;  1YQN A;  3WJQ A;  4ERH A;  5HY1 A;  5LXT A;  4TV8 B;  5C8Y B;  3R0P A;  1FFX A;  3RYH A;  1NQ3 A;  5BMV B;  3E22 A;  4BT6 A;  1KC8 H;  2OTJ F;  5IJ9 B;  3D54 A;  4X1K B;  3UT5 B;  1VHA A;  2PHN A;  2VGM A;  4NWO B;  4U3J B;  5J2U A;  5GAN K;  1VQM F;  5EZY A;  3ZP4 A;  2G9I A;  1VQ5 F; 
#chains in the Genus database with same CATH homology
 1X52 A;  3PAF A;  1CK2 A;  3CCE F;  4BY9 D;  1E7K A;  2HVY D;  3E20 B;  1X7P A;  4BW0 B;  3G4S F;  3RA5 A;  3CXC F;  1W41 A;  4BVS A;  5FJ4 C;  2BO1 A;  2OZB A;  3OBW A;  3CD6 F;  3RA6 A;  2QA4 F;  1K8A H;  1K9M H;  3OBY A;  2FC3 A;  2QI2 A;  3FFM A;  1Q82 H;  5G4V C;  2KTU A;  3NK7 A;  1CN7 A;  1VQ6 F;  3CCV F;  4TZZ A;  1GZ0 A;  1T0K B;  5GIO C;  2OTL F;  1H7M A;  2JNB A;  2VGN A;  1W3E X;  2OHW A;  3CCR F;  1Q81 H;  2GLZ A;  1GO0 A;  5GIP C;  3WXM B;  3SIV A;  1RLG A;  2LBX A;  3D00 A;  3V7Q A;  1K73 H;  3IR9 A;  3LFO A;  5HXZ A;  2FGY A;  1N8R H;  1NMU B;  3AGK A;  3J7A R;  4EI8 A;  1QVF F;  3HJW C;  5G4U C;  1KQS F;  2KTV A;  3E1Y A;  1W40 A;  3G6E F;  1VQK F;  1RA4 A;  3CC4 F;  3CMA F;  4EI9 A;  4NQ3 A;  1W2B F;  3LWO C;  1W42 A;  5FLX M;  3CCQ F;  1XBI A;  5HXU A;  2F9Z C;  1SDS A;  3NVK E;  1VQN F;  3LWR C;  5HWE A;  2ALE A;  3I55 F;  1VQ9 F;  5HY4 A;  2LBW A;  3ON1 A;  3CCS F;  3I56 F;  1YIJ F;  1M90 H;  1X7O A;  3N4Z A;  3LWP C;  1S72 F;  3NK6 A;  5GIN C;  5DCV A;  4BVR A;  1VQO F;  3HAX D;  3CC2 F;  1VQL F;  3SIU A;  5EO3 A;  4BVQ A;  5HY2 A;  1NJI H;  1JJ2 F;  3O85 A;  5GAP K;  2QEX F;  1YIT F;  3V7E A;  3CC7 F;  4BVT A;  3JCM M;  1GO1 A;  3CME F;  4X3M A;  3OW2 F;  4NUT A;  1VQ8 F;  1M1K H;  3NVI B;  1YJN F;  3PLA C;  3CG6 A;  2AIF A;  4LCK A;  1VQP F;  1YJ9 F;  2I6D A;  4XCQ A;  3CPQ A;  5EWR A;  1YJW F;  3N4Y A;  1VQ4 F;  3JAM M;  3GYQ A;  4EI7 A;  1Q7Y H;  1ZWZ A;  1IPA A;  2WAL A;  5A2Q M;  1YI2 F;  1YHQ F;  4X3L A;  3CCJ F;  2CZW A;  1VQ7 F;  3V3T A;  5HY1 A;  3VI6 A;  3CPW F;  1Q86 H;  5IT9 M;  1DT9 A;  3LWV C;  3CCU F;  1PXW A;  1KC8 H;  2OTJ F;  3J80 M;  3G71 F;  1KD1 H;  4C4W C;  3J81 M;  3CCL F;  1QVG F;  3NMU C;  2KG4 A;  3VMF B;  2VGM A;  3MCA B;  3CCM F;  5GAN K;  1VQM F;  5HY0 A;  3LWQ C;  1VQ5 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...