3CCSF

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ccsF00
3NMUC 2VGNA 1GO0A 2OHWA 2QEXF 3CPQA 3CCSF 3LWRC 1VQMF 1W2BF 2AIFA 4LCKA 3CCJF 1W41A 5GIOC 1Q81H 3FFMA 3CMEF 3CD6F 3AGKA 5G4VC 4X3MA 1T0KB 3JAMM 3HAXD 3NVIB 5GAPK 3CCEF 1IPAA 3SIUA 3CCVF 5DCVA 1KD1H 3I56F 1K9MH 3CMAF 3I55F 5EWRA 3CCQF 1GO1A 2ALEA 3ON1A 1VQ4F 2WALA 3V7QA 3CCRF 1K8AH 2KG4A 1X7OA 1VQOF 5FJ4C 2OTJF 1W40A 1SDSA 1JJ2F 2OTLF 1NMUB 4TZZA 1VQNF 3RA6A 5EO3A 3LWPC 3GYQA 1CK2A 3G6EF 1S72F 2OZBA 3G71F 4BW0B 2BO1A 3MCAB 1RA4A 3LWOC 3CPWF 3CCLF 3VMFB 3CCMF 1YI2F 1KQSF 1M90H 5GANK 1E7KA 1YIJF 2I6DA 4BY9D 1QVFF 3NK6A 3J81M 5FLXM 2QA4F 1VQ6F 3V7EA 1YJNF 1X52A 1VQ8F 3CXCF 3LFOA 1K73H 2HVYD 1YJ9F 3JCMM 3VI6A 3OBWA 3WXMB 2KTVA 1VQ7F 3PLAC 3CC4F 1VQ5F 3IR9A 1VQLF 3CC2F 1NJIH 3N4YA 2KTUA 4C4WC 2FC3A 3J80M 3OW2F 2JNBA 3N4ZA 1W3EX 3O85A 1YJWF 1M1KH 1VQ9F 3J7AR 2VGMA 5GIPC 3RA5A 1GZ0A 3SIVA 1CN7A 1KC8H 3LWQC 3LWVC 5A2QM 1YHQF 1H7MA 1PXWA 3E1YA 3PAFA 4X3LA 1QVGF 3CC7F 3NVKE 3E20B 3G4SF 1YITF 2QI2A 2LBWA 2LBXA 3HJWC 3NK7A 4NUTA 5IT9M 1VQPF 1N8RH 1RLGA 1DT9A 3OBYA 1Q82H 3CG6A 5GINC 2CZWA 1XBIA 3CCUF 1W42A 1Q7YH 1VQKF 1ZWZA 5G4UC 1Q86H 1X7PA
chains in the Genus database with same CATH superfamily
2AIZP 2ZAUA 1GO0A 3JVHA 3UT5B 2UYNA 4I50B 3RYCA 5J2TB 5IJ9B 4YJ3B 3HWUA 1TVKA 4ZHVA 4C82A 1TUBA 3LDTA 3QUWA 1KNKA 1W581 2CW4A 5AVMA 3RYFA 5HP8A 4G4XA 2NMUA 3VIUA 4IIJA 4YJ2B 5G4VC 5KMGA 4G4YA 4RHAA 5IJ0A 3CCEF 3IKFA 3SIUA 2K1SA 5JH7B 3HKEB 2GLZA 3I55F 2HS0A 1XRGA 5LP6C 3ZP4A 3F0FA 5HY2A 3TD4A 2H6LA 5LYJA 2ALEA 2N48A 3ON1A 1VQ4F 4DRXA 4IHJA 3K12A 2B33A 2VAPA 3V7QA 2FGYA 2KG4A 4O4LB 1X7OA 5LOVB 1VQOF 2VAMA 1W40A 3GHZA 1SDSA 1KNJA 4TZZA 2EWCA 5EO3A 3WGNA 3GYQA 4R40B 1S72F 1OAPA 3L7QA 2OZBA 3LMEA 3JAWB 3CPWF 2H8EA 5IYZA 5GANK 1YIJF 4BY9D 3WPWA 5BMVA 2QA4F 1IV1A 2Q1XA 1YJNF 3V7EA 3HKDA 1VQ8F 2HRUA 2Z1TA 3BYQA 5EIBD 3IKEA 1YJ9F 3VI6A 4B62A 3F0EA 2KTVA 3JAKA 3PLAC 3WGMA 4BVTA 3EORA 3IR9A 3CC2F 3JALB 5CA0A 2KTUA 5CA1B 4C4WC 3OONA 3J80M 3JARB 4TUYB 2JNBA 1YQNA 1FNKA 1JY8A 4KWEA 4ZI7A 3J7AR 2VGMA 5GIPC 2GZLA 3C8LA 3LWQC 3C9RA 1YHQF 1H7MA 3PAFA 2HP3A 4O4IB 3VOAA 1QVGF 3F0GA 3CC7F 3NVKE 2HS4A 4BVRA 1YITF 1ODEA 5HY0A 3V4DA 2UYNB 3RYCB 3ZOPA 1W5FA 3ZO8A 3TD3A 5IT9M 1VQPF 1TVKB 1QAHA 1TUBB 1DT9A 3VYUC 4G4ZA 3T80A 3RYFB 5B8FA 1XBIA 3S0YA 1W42A 4X1IA 3FD5A 4IIJB 2VAWA 1PF5A 5KMGB 1ZWZA 5GONA 1Q86H 4X20B 5IJ0B 4C8EA 4X1YA 2OHWA 2I6RA 2YYEA 3CPQA 3JATA 1VQMF 2CHTA 5LYJB 1Q8RA 4DRXB 2AIFA 4IHJB 1IV2A 5J2UA 2ZODA 3I3FA 1YGYA 3CMEF 3DDNA 3QTYA 3AGKA 1W5BA 3P0ZA 3WJRA 4X3MA 1VK3A 4C81A 5GAPK 2UYJA 2V9YA 3IMPA 1COMA 2HQSC 4ZHYB 4B45A 3JASA 5EWRA 1GO1A 3KHNA 3K0TA 4O2AA 5FNVA 2WALA 5IYZB 4EI8A 5BMVB 3HKDB 3RYIA 5JCOA 5LXTA 3S02A 1JJ2F 5MN6A 2OTLF 2UYKA 2IG8A 3G6EF 3JAKB 3G71F 4O4JA 4BT6A 4BW0B 3U0OA 2RHLA 2BO1A 4X20A 5C8YA 5CA0B 5CB4A 3F0DA 3CCLF 3HKCA 4M8IA 1M90H 5EZYA 5FLXM 4ZI7B 1ONIA 4EB6A 5MN5A 5HY4A 3V3TA 3CYQA 3LFOA 3CXCF 3ESJA 2BTOA 3MBMA 3QHDA 2RHJA 1Z5VA 3WXMB 1VQLF 1NJIH 3WJQA 3N4YA 3C9SA 1W55A 4ZOLA 3VYTC 3WPXA 3N4ZA 2HRYA 1W3EX 3O85A 1YJWF 3M1XA 1VQ9F 2ZVYA 3RA5A 4X1IB 5KX5A 4C8IA 3D01A 5A2QM 2RHHA 5GONB 2LBTA 3HKBA 3CYPB 3RYHA 4X1YB 2QI2A 4RQOA 3S06A 3F6MA 3JATB 4G88A 4BVQA 5HXUA 5HY1A 5HP7A 3VYSC 1Q82H 2CZWA 1GX1A 1U43A 5J2UB 4BT4A 3FBAA 4BT7A 2IQQA 3E22B 1VQKF 3VTIC 1X7PA 3NMUC 3M84A 3KJJA 5ITZA 3JASB 4I55A 4B46A 3C9UA 3MQWA 3LWRC 1W2BF 4O2AB 5FNVB 1RQ2A 5LA6A 1J7HA 3CCJF 1W41A 1Z5WA 4FFBA 1Q81H 1FFXA 2Z1FA 3FFMA 1X25A 3RYIB 3CD6F 5LXTB 2BTUA 3N2GB 1DBFA 3IEQA 3FPIA 4HNAA 1FSZA 2HX0A 4F6RA 3GTZA 3Q8HA 4O4JB 3I56F 1K9MH 4WBNA 3CCQF 3DC2A 5C8YB 5CB4B 5JVDA 5LP6A 4I4TB 2H8CA 3HKCB 4PWTA 1T0AA 2OTMA 1UI9A 5EZYB 3CCRF 4ZHQA 2R751 4EB6B 5EB1B 2CVLA 3M4SA 2HP0A 3S0HA 1NMUB 3RA6A 3WGJA 3LWPC 1SZQA 2CWJA 3P10A 3E22A 4G4VA 5EYPA 3MCAB 2Z1UA 3LWOC 4B5CA 2DT4A 2PMPA 4ZOLB 3VMFB 1YI2F 5MN4A 2G9IA 1KQSF 1E7KA 1QVFF 3NK6A 3J81M 1X52A 3VCZA 1K73H 5KX5B 2HVYD 1JN1A 2VXYA 3HKBB 2UZHA 3RYHB 4O2BA 3N2GA 1VQ5F 2ZF8A 4TV9A 2QTPA 1R1MA 4BT3A 3MDOA 2FC3A 1W59A 1W5EA 2L26A 4TV8A 3K14A 2CSLA 1M1KH 4I4TA 3VOBA 3R0PA 2F9ZC 2W8BC 4ZK7A 1QU9A 1PXWA 4LNUA 3WGKA 3ERNA 3N2KA 3B6NA 5ITZB 3HJWC 1H47A 4I55B 4U39A 4BT5A 1JFFA 1VH8A 3I7TA 2GVIA 1N8RH 5EB0A 4NWOB 3MCQA 3LYBA 3OBYA 3CG6A 5LA6B 5GINC 2IAFA 3KJKA 4FFBB 4BVSA 1FFXB 3CCUF 5JQGB 2UYPA 3WJPA 5G4UC 1XHOA 4HNAB 3C9TA 2VGNA 4F6RB 2QEXF 4WBNB 1H48A 4EI7A 4O4HA 5JVDB 4X1KA 5LP6B 3CCSF 3CB2A 2RB9A 2CHSA 4LCKA 3ELCA 2BTQB 1NQ3A 4ZHQB 2LCAA 5GIOC 1SA0B 2Z1EA 3FD6A 1T0KB 4U3JA 2HP0B 3JAMM 3HAXD 3NVIB 4DXDA 1RLUA 1IPAA 1U3PA 2HS3A 3CCVF 5DCVA 1KD1H 3KIZA 3UT5A 1FNJA 1RQ7A 4I50A 5EYPB 3CMAF 2ZVZA 5J2TA 5IJ9A 4YJ3A 1IV3A 5HWEA 3K2XA 1K8AH 5JCOC 5FJ4C 4YJ2A 2OTJF 3IEWA 5EIBC 2RHOA 1VQNF 3HTNA 4ERHA 1U40A 1CK2A 2R6R1 1VHAA 4O2BB 5JH7A 5JQGA 3HKEA 3D00A 1UFYA 4TV9B 2P6YA 1RA4A 4E6EA 1CLIA 3CCMF 2Z01A 4TV8B 3RE3A 4BT2A 2I6DA 1VQ6F 2MQEA 1IV4A 4ZHWA 4O4LA 5LOVA 3JCMM 1U3LA 1W57A 3OBWA 1VQ7F 4LNUB 1JD1A 1SA0A 3CC4F 2ZOVA 3N2KB 1XV2A 1JFFB 4G4WA 3JAWA 3KE1A 3TD5A 3OW2F 3S03A 4NQ3A 5EAZA 3P4EA 1GZ0A 2PHNA 3SIVA 1CN7A 3D54A 1KC8H 3LWVC 4X3LA 3E1YA 1VQVA 3E20B 3G4SF 2LBWA 2LBXA 3WGLA 3VO8A 3NK7A 3JALA 4NUTA 3S0WA 4O4HB 5CA1A 4X1KB 4EI9A 1QD9A 2Q1YA 3JARA 4TUYA 1RLGA 2DYYA 1OFUA 3ZP7A 4C8GA 2KGWA 1Q7YH 1W5AA 2AMTA 2YXZA 4XCQA 4U3JB 5HXZA 4O4IA
chains in the Genus database with same CATH topology
3NMUC 2VGNA 1GO0A 2OHWA 2QEXF 3CPQA 4EI7A 3CCSF 3LWRC 1VQMF 1W2BF 2AIFA 4LCKA 3CCJF 1W41A 5GIOC 1Q81H 3FFMA 3CMEF 3CD6F 3AGKA 5G4VC 4X3MA 1T0KB 3JAMM 3HAXD 3NVIB 5GAPK 3CCEF 1IPAA 3SIUA 3CCVF 5DCVA 1KD1H 3I56F 1K9MH 3CMAF 2GLZA 3I55F 5EWRA 3CCQF 1GO1A 5HY2A 5HWEA 2ALEA 3ON1A 1VQ4F 2WALA 3V7QA 4EI8A 2FGYA 3CCRF 1K8AH 2KG4A 1X7OA 1VQOF 5FJ4C 2OTJF 1W40A 1SDSA 1JJ2F 2OTLF 1NMUB 4TZZA 1VQNF 3RA6A 5EO3A 3LWPC 3GYQA 1CK2A 3G6EF 1S72F 2OZBA 3G71F 4BW0B 3D00A 2BO1A 3MCAB 1RA4A 3LWOC 3CPWF 3CCLF 3VMFB 3CCMF 1YI2F 1KQSF 1M90H 5GANK 1E7KA 1YIJF 2I6DA 4BY9D 1QVFF 3NK6A 3J81M 5FLXM 2QA4F 1VQ6F 3V7EA 1YJNF 1X52A 1VQ8F 5HY4A 3V3TA 3CXCF 3LFOA 1K73H 2HVYD 1YJ9F 3JCMM 3VI6A 3OBWA 3WXMB 2KTVA 1VQ7F 3PLAC 3CC4F 4BVTA 1VQ5F 3IR9A 1VQLF 3CC2F 1NJIH 3N4YA 2KTUA 4C4WC 2FC3A 3J80M 3OW2F 2JNBA 3N4ZA 4NQ3A 1W3EX 3O85A 1YJWF 1M1KH 1VQ9F 3J7AR 2VGMA 5GIPC 3RA5A 1GZ0A 3SIVA 1CN7A 1KC8H 3LWQC 2F9ZC 3LWVC 5A2QM 1YHQF 1H7MA 1PXWA 3E1YA 3PAFA 4X3LA 1QVGF 3CC7F 3NVKE 3E20B 4BVRA 3G4SF 1YITF 2QI2A 2LBWA 5HY0A 2LBXA 3HJWC 3NK7A 4NUTA 5IT9M 1VQPF 4BVQA 5HXUA 1N8RH 4EI9A 5HY1A 1RLGA 1DT9A 3OBYA 1Q82H 3CG6A 5GINC 2CZWA 1XBIA 4BVSA 3CCUF 1W42A 1Q7YH 1VQKF 1ZWZA 4XCQA 5HXZA 5G4UC 1Q86H 1X7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NMU C;  2VGN A;  1GO0 A;  2OHW A;  2QEX F;  3CPQ A;  3CCS F;  3LWR C;  1VQM F;  1W2B F;  2AIF A;  4LCK A;  3CCJ F;  1W41 A;  5GIO C;  1Q81 H;  3FFM A;  3CME F;  3CD6 F;  3AGK A;  5G4V C;  4X3M A;  1T0K B;  3JAM M;  3HAX D;  3NVI B;  5GAP K;  3CCE F;  1IPA A;  3SIU A;  3CCV F;  5DCV A;  1KD1 H;  3I56 F;  1K9M H;  3CMA F;  3I55 F;  5EWR A;  3CCQ F;  1GO1 A;  2ALE A;  3ON1 A;  1VQ4 F;  2WAL A;  3V7Q A;  3CCR F;  1K8A H;  2KG4 A;  1X7O A;  1VQO F;  5FJ4 C;  2OTJ F;  1W40 A;  1SDS A;  1JJ2 F;  2OTL F;  1NMU B;  4TZZ A;  1VQN F;  3RA6 A;  5EO3 A;  3LWP C;  3GYQ A;  1CK2 A;  3G6E F;  1S72 F;  2OZB A;  3G71 F;  4BW0 B;  2BO1 A;  3MCA B;  1RA4 A;  3LWO C;  3CPW F;  3CCL F;  3VMF B;  3CCM F;  1YI2 F;  1KQS F;  1M90 H;  5GAN K;  1E7K A;  1YIJ F;  2I6D A;  4BY9 D;  1QVF F;  3NK6 A;  3J81 M;  5FLX M;  2QA4 F;  1VQ6 F;  3V7E A;  1YJN F;  1X52 A;  1VQ8 F;  3CXC F;  3LFO A;  1K73 H;  2HVY D;  1YJ9 F;  3JCM M;  3VI6 A;  3OBW A;  3WXM B;  2KTV A;  1VQ7 F;  3PLA C;  3CC4 F;  1VQ5 F;  3IR9 A;  1VQL F;  3CC2 F;  1NJI H;  3N4Y A;  2KTU A;  4C4W C;  2FC3 A;  3J80 M;  3OW2 F;  2JNB A;  3N4Z A;  1W3E X;  3O85 A;  1YJW F;  1M1K H;  1VQ9 F;  3J7A R;  2VGM A;  5GIP C;  3RA5 A;  1GZ0 A;  3SIV A;  1CN7 A;  1KC8 H;  3LWQ C;  3LWV C;  5A2Q M;  1YHQ F;  1H7M A;  1PXW A;  3E1Y A;  3PAF A;  4X3L A;  1QVG F;  3CC7 F;  3NVK E;  3E20 B;  3G4S F;  1YIT F;  2QI2 A;  2LBW A;  2LBX A;  3HJW C;  3NK7 A;  4NUT A;  5IT9 M;  1VQP F;  1N8R H;  1RLG A;  1DT9 A;  3OBY A;  1Q82 H;  3CG6 A;  5GIN C;  2CZW A;  1XBI A;  3CCU F;  1W42 A;  1Q7Y H;  1VQK F;  1ZWZ A;  5G4U C;  1Q86 H;  1X7P A; 
#chains in the Genus database with same CATH topology
 2AIZ P;  2ZAU A;  1GO0 A;  3JVH A;  3UT5 B;  2UYN A;  4I50 B;  3RYC A;  5J2T B;  5IJ9 B;  4YJ3 B;  3HWU A;  1TVK A;  4ZHV A;  4C82 A;  1TUB A;  3LDT A;  3QUW A;  1KNK A;  1W58 1;  2CW4 A;  5AVM A;  3RYF A;  5HP8 A;  4G4X A;  2NMU A;  3VIU A;  4IIJ A;  4YJ2 B;  5G4V C;  5KMG A;  4G4Y A;  4RHA A;  5IJ0 A;  3CCE F;  3IKF A;  3SIU A;  2K1S A;  5JH7 B;  3HKE B;  2GLZ A;  3I55 F;  2HS0 A;  1XRG A;  5LP6 C;  3ZP4 A;  3F0F A;  5HY2 A;  3TD4 A;  2H6L A;  5LYJ A;  2ALE A;  2N48 A;  3ON1 A;  1VQ4 F;  4DRX A;  4IHJ A;  3K12 A;  2B33 A;  2VAP A;  3V7Q A;  2FGY A;  2KG4 A;  4O4L B;  1X7O A;  5LOV B;  1VQO F;  2VAM A;  1W40 A;  3GHZ A;  1SDS A;  1KNJ A;  4TZZ A;  2EWC A;  5EO3 A;  3WGN A;  3GYQ A;  4R40 B;  1S72 F;  1OAP A;  3L7Q A;  2OZB A;  3LME A;  3JAW B;  3CPW F;  2H8E A;  5IYZ A;  5GAN K;  1YIJ F;  4BY9 D;  3WPW A;  5BMV A;  2QA4 F;  1IV1 A;  2Q1X A;  1YJN F;  3V7E A;  3HKD A;  1VQ8 F;  2HRU A;  2Z1T A;  3BYQ A;  5EIB D;  3IKE A;  1YJ9 F;  3VI6 A;  4B62 A;  3F0E A;  2KTV A;  3JAK A;  3PLA C;  3WGM A;  4BVT A;  3EOR A;  3IR9 A;  3CC2 F;  3JAL B;  5CA0 A;  2KTU A;  5CA1 B;  4C4W C;  3OON A;  3J80 M;  3JAR B;  4TUY B;  2JNB A;  1YQN A;  1FNK A;  1JY8 A;  4KWE A;  4ZI7 A;  3J7A R;  2VGM A;  5GIP C;  2GZL A;  3C8L A;  3LWQ C;  3C9R A;  1YHQ F;  1H7M A;  3PAF A;  2HP3 A;  4O4I B;  3VOA A;  1QVG F;  3F0G A;  3CC7 F;  3NVK E;  2HS4 A;  4BVR A;  1YIT F;  1ODE A;  5HY0 A;  3V4D A;  2UYN B;  3RYC B;  3ZOP A;  1W5F A;  3ZO8 A;  3TD3 A;  5IT9 M;  1VQP F;  1TVK B;  1QAH A;  1TUB B;  1DT9 A;  3VYU C;  4G4Z A;  3T80 A;  3RYF B;  5B8F A;  1XBI A;  3S0Y A;  1W42 A;  4X1I A;  3FD5 A;  4IIJ B;  2VAW A;  1PF5 A;  5KMG B;  1ZWZ A;  5GON A;  1Q86 H;  4X20 B;  5IJ0 B;  4C8E A;  4X1Y A;  2OHW A;  2I6R A;  2YYE A;  3CPQ A;  3JAT A;  1VQM F;  2CHT A;  5LYJ B;  1Q8R A;  4DRX B;  2AIF A;  4IHJ B;  1IV2 A;  5J2U A;  2ZOD A;  3I3F A;  1YGY A;  3CME F;  3DDN A;  3QTY A;  3AGK A;  1W5B A;  3P0Z A;  3WJR A;  4X3M A;  1VK3 A;  4C81 A;  5GAP K;  2UYJ A;  2V9Y A;  3IMP A;  1COM A;  2HQS C;  4ZHY B;  4B45 A;  3JAS A;  5EWR A;  1GO1 A;  3KHN A;  3K0T A;  4O2A A;  5FNV A;  2WAL A;  5IYZ B;  4EI8 A;  5BMV B;  3HKD B;  3RYI A;  5JCO A;  5LXT A;  3S02 A;  1JJ2 F;  5MN6 A;  2OTL F;  2UYK A;  2IG8 A;  3G6E F;  3JAK B;  3G71 F;  4O4J A;  4BT6 A;  4BW0 B;  3U0O A;  2RHL A;  2BO1 A;  4X20 A;  5C8Y A;  5CA0 B;  5CB4 A;  3F0D A;  3CCL F;  3HKC A;  4M8I A;  1M90 H;  5EZY A;  5FLX M;  4ZI7 B;  1ONI A;  4EB6 A;  5MN5 A;  5HY4 A;  3V3T A;  3CYQ A;  3LFO A;  3CXC F;  3ESJ A;  2BTO A;  3MBM A;  3QHD A;  2RHJ A;  1Z5V A;  3WXM B;  1VQL F;  1NJI H;  3WJQ A;  3N4Y A;  3C9S A;  1W55 A;  4ZOL A;  3VYT C;  3WPX A;  3N4Z A;  2HRY A;  1W3E X;  3O85 A;  1YJW F;  3M1X A;  1VQ9 F;  2ZVY A;  3RA5 A;  4X1I B;  5KX5 A;  4C8I A;  3D01 A;  5A2Q M;  2RHH A;  5GON B;  2LBT A;  3HKB A;  3CYP B;  3RYH A;  4X1Y B;  2QI2 A;  4RQO A;  3S06 A;  3F6M A;  3JAT B;  4G88 A;  4BVQ A;  5HXU A;  5HY1 A;  5HP7 A;  3VYS C;  1Q82 H;  2CZW A;  1GX1 A;  1U43 A;  5J2U B;  4BT4 A;  3FBA A;  4BT7 A;  2IQQ A;  3E22 B;  1VQK F;  3VTI C;  1X7P A;  3NMU C;  3M84 A;  3KJJ A;  5ITZ A;  3JAS B;  4I55 A;  4B46 A;  3C9U A;  3MQW A;  3LWR C;  1W2B F;  4O2A B;  5FNV B;  1RQ2 A;  5LA6 A;  1J7H A;  3CCJ F;  1W41 A;  1Z5W A;  4FFB A;  1Q81 H;  1FFX A;  2Z1F A;  3FFM A;  1X25 A;  3RYI B;  3CD6 F;  5LXT B;  2BTU A;  3N2G B;  1DBF A;  3IEQ A;  3FPI A;  4HNA A;  1FSZ A;  2HX0 A;  4F6R A;  3GTZ A;  3Q8H A;  4O4J B;  3I56 F;  1K9M H;  4WBN A;  3CCQ F;  3DC2 A;  5C8Y B;  5CB4 B;  5JVD A;  5LP6 A;  4I4T B;  2H8C A;  3HKC B;  4PWT A;  1T0A A;  2OTM A;  1UI9 A;  5EZY B;  3CCR F;  4ZHQ A;  2R75 1;  4EB6 B;  5EB1 B;  2CVL A;  3M4S A;  2HP0 A;  3S0H A;  1NMU B;  3RA6 A;  3WGJ A;  3LWP C;  1SZQ A;  2CWJ A;  3P10 A;  3E22 A;  4G4V A;  5EYP A;  3MCA B;  2Z1U A;  3LWO C;  4B5C A;  2DT4 A;  2PMP A;  4ZOL B;  3VMF B;  1YI2 F;  5MN4 A;  2G9I A;  1KQS F;  1E7K A;  1QVF F;  3NK6 A;  3J81 M;  1X52 A;  3VCZ A;  1K73 H;  5KX5 B;  2HVY D;  1JN1 A;  2VXY A;  3HKB B;  2UZH A;  3RYH B;  4O2B A;  3N2G A;  1VQ5 F;  2ZF8 A;  4TV9 A;  2QTP A;  1R1M A;  4BT3 A;  3MDO A;  2FC3 A;  1W59 A;  1W5E A;  2L26 A;  4TV8 A;  3K14 A;  2CSL A;  1M1K H;  4I4T A;  3VOB A;  3R0P A;  2F9Z C;  2W8B C;  4ZK7 A;  1QU9 A;  1PXW A;  4LNU A;  3WGK A;  3ERN A;  3N2K A;  3B6N A;  5ITZ B;  3HJW C;  1H47 A;  4I55 B;  4U39 A;  4BT5 A;  1JFF A;  1VH8 A;  3I7T A;  2GVI A;  1N8R H;  5EB0 A;  4NWO B;  3MCQ A;  3LYB A;  3OBY A;  3CG6 A;  5LA6 B;  5GIN C;  2IAF A;  3KJK A;  4FFB B;  4BVS A;  1FFX B;  3CCU F;  5JQG B;  2UYP A;  3WJP A;  5G4U C;  1XHO A;  4HNA B;  3C9T A;  2VGN A;  4F6R B;  2QEX F;  4WBN B;  1H48 A;  4EI7 A;  4O4H A;  5JVD B;  4X1K A;  5LP6 B;  3CCS F;  3CB2 A;  2RB9 A;  2CHS A;  4LCK A;  3ELC A;  2BTQ B;  1NQ3 A;  4ZHQ B;  2LCA A;  5GIO C;  1SA0 B;  2Z1E A;  3FD6 A;  1T0K B;  4U3J A;  2HP0 B;  3JAM M;  3HAX D;  3NVI B;  4DXD A;  1RLU A;  1IPA A;  1U3P A;  2HS3 A;  3CCV F;  5DCV A;  1KD1 H;  3KIZ A;  3UT5 A;  1FNJ A;  1RQ7 A;  4I50 A;  5EYP B;  3CMA F;  2ZVZ A;  5J2T A;  5IJ9 A;  4YJ3 A;  1IV3 A;  5HWE A;  3K2X A;  1K8A H;  5JCO C;  5FJ4 C;  4YJ2 A;  2OTJ F;  3IEW A;  5EIB C;  2RHO A;  1VQN F;  3HTN A;  4ERH A;  1U40 A;  1CK2 A;  2R6R 1;  1VHA A;  4O2B B;  5JH7 A;  5JQG A;  3HKE A;  3D00 A;  1UFY A;  4TV9 B;  2P6Y A;  1RA4 A;  4E6E A;  1CLI A;  3CCM F;  2Z01 A;  4TV8 B;  3RE3 A;  4BT2 A;  2I6D A;  1VQ6 F;  2MQE A;  1IV4 A;  4ZHW A;  4O4L A;  5LOV A;  3JCM M;  1U3L A;  1W57 A;  3OBW A;  1VQ7 F;  4LNU B;  1JD1 A;  1SA0 A;  3CC4 F;  2ZOV A;  3N2K B;  1XV2 A;  1JFF B;  4G4W A;  3JAW A;  3KE1 A;  3TD5 A;  3OW2 F;  3S03 A;  4NQ3 A;  5EAZ A;  3P4E A;  1GZ0 A;  2PHN A;  3SIV A;  1CN7 A;  3D54 A;  1KC8 H;  3LWV C;  4X3L A;  3E1Y A;  1VQV A;  3E20 B;  3G4S F;  2LBW A;  2LBX A;  3WGL A;  3VO8 A;  3NK7 A;  3JAL A;  4NUT A;  3S0W A;  4O4H B;  5CA1 A;  4X1K B;  4EI9 A;  1QD9 A;  2Q1Y A;  3JAR A;  4TUY A;  1RLG A;  2DYY A;  1OFU A;  3ZP7 A;  4C8G A;  2KGW A;  1Q7Y H;  1W5A A;  2AMT A;  2YXZ A;  4XCQ A;  4U3J B;  5HXZ A;  4O4I A; 
#chains in the Genus database with same CATH homology
 3NMU C;  2VGN A;  1GO0 A;  2OHW A;  2QEX F;  3CPQ A;  4EI7 A;  3CCS F;  3LWR C;  1VQM F;  1W2B F;  2AIF A;  4LCK A;  3CCJ F;  1W41 A;  5GIO C;  1Q81 H;  3FFM A;  3CME F;  3CD6 F;  3AGK A;  5G4V C;  4X3M A;  1T0K B;  3JAM M;  3HAX D;  3NVI B;  5GAP K;  3CCE F;  1IPA A;  3SIU A;  3CCV F;  5DCV A;  1KD1 H;  3I56 F;  1K9M H;  3CMA F;  2GLZ A;  3I55 F;  5EWR A;  3CCQ F;  1GO1 A;  5HY2 A;  5HWE A;  2ALE A;  3ON1 A;  1VQ4 F;  2WAL A;  3V7Q A;  4EI8 A;  2FGY A;  3CCR F;  1K8A H;  2KG4 A;  1X7O A;  1VQO F;  5FJ4 C;  2OTJ F;  1W40 A;  1SDS A;  1JJ2 F;  2OTL F;  1NMU B;  4TZZ A;  1VQN F;  3RA6 A;  5EO3 A;  3LWP C;  3GYQ A;  1CK2 A;  3G6E F;  1S72 F;  2OZB A;  3G71 F;  4BW0 B;  3D00 A;  2BO1 A;  3MCA B;  1RA4 A;  3LWO C;  3CPW F;  3CCL F;  3VMF B;  3CCM F;  1YI2 F;  1KQS F;  1M90 H;  5GAN K;  1E7K A;  1YIJ F;  2I6D A;  4BY9 D;  1QVF F;  3NK6 A;  3J81 M;  5FLX M;  2QA4 F;  1VQ6 F;  3V7E A;  1YJN F;  1X52 A;  1VQ8 F;  5HY4 A;  3V3T A;  3CXC F;  3LFO A;  1K73 H;  2HVY D;  1YJ9 F;  3JCM M;  3VI6 A;  3OBW A;  3WXM B;  2KTV A;  1VQ7 F;  3PLA C;  3CC4 F;  4BVT A;  1VQ5 F;  3IR9 A;  1VQL F;  3CC2 F;  1NJI H;  3N4Y A;  2KTU A;  4C4W C;  2FC3 A;  3J80 M;  3OW2 F;  2JNB A;  3N4Z A;  4NQ3 A;  1W3E X;  3O85 A;  1YJW F;  1M1K H;  1VQ9 F;  3J7A R;  2VGM A;  5GIP C;  3RA5 A;  1GZ0 A;  3SIV A;  1CN7 A;  1KC8 H;  3LWQ C;  2F9Z C;  3LWV C;  5A2Q M;  1YHQ F;  1H7M A;  1PXW A;  3E1Y A;  3PAF A;  4X3L A;  1QVG F;  3CC7 F;  3NVK E;  3E20 B;  4BVR A;  3G4S F;  1YIT F;  2QI2 A;  2LBW A;  5HY0 A;  2LBX A;  3HJW C;  3NK7 A;  4NUT A;  5IT9 M;  1VQP F;  4BVQ A;  5HXU A;  1N8R H;  4EI9 A;  5HY1 A;  1RLG A;  1DT9 A;  3OBY A;  1Q82 H;  3CG6 A;  5GIN C;  2CZW A;  1XBI A;  4BVS A;  3CCU F;  1W42 A;  1Q7Y H;  1VQK F;  1ZWZ A;  4XCQ A;  5HXZ A;  5G4U C;  1Q86 H;  1X7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...