3CCSF

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ccsF00
2LBWA 3VMFB 1S72F 3J7AR 1PXWA 2OZBA 5GIPC 3OBYA 1Q82H 3WXMB 5G4VC 1KQSF 1NJIH 1VQMF 3N4YA 3NMUC 2FC3A 3O85A 5EWRA 5DCVA 3CCEF 1M90H 5A2QM 4LCKA 2CZWA 3G4SF 2QI2A 4BW0B 1E7KA 3E1YA 1YI2F 2WALA 3NVIB 3PAFA 3OBWA 3LWQC 1ZWZA 3CPWF 3CCSF 3OW2F 3V7QA 2VGMA 3RA6A 3RA5A 1T0KB 3FFMA 1YITF 3CMAF 3CC7F 3I56F 3CXCF 1IPAA 4C4WC 3VI6A 3CCVF 2AIFA 1Q7YH 2VGNA 3CMEF 1W40A 1Q86H 3SIVA 1W2BF 2I6DA 2JNBA 5FJ4C 1CK2A 1W42A 3CCJF 3CPQA 3LWOC 2KG4A 3J81M 1YJNF 3JAMM 1QVGF 1VQOF 1YJ9F 3V7EA 1Q81H 3N4ZA 1K9MH 3GYQA 1VQ9F 1N8RH 5IT9M 1CN7A 2OTJF 5G4UC 3LWPC 3CCRF 1VQLF 3CD6F 1K73H 1RA4A 3NK6A 1KC8H 2ALEA 5GANK 3CCQF 3CCLF 1K8AH 1VQPF 1W41A 3HJWC 3PLAC 1YIJF 3LWRC 1RLGA 3I55F 1X52A 3IR9A 1DT9A 1KD1H 1W3EX 1X7PA 2KTVA 5GIOC 1VQ8F 3LWVC 3SIUA 5GINC 1QVFF 2BO1A 2OTLF 3ON1A 1VQ5F 2QA4F 3LFOA 2LBXA 1VQNF 3CC4F 2HVYD 2KTUA 3NVKE 4X3LA 1M1KH 4BY9D 3J80M 1VQKF 3JCMM 5GAPK 2QEXF 3CCMF 3G71F 1SDSA 1VQ6F 1XBIA 1H7MA 3CC2F 3MCAB 1GZ0A 1NMUB 3NK7A 3HAXD 5FLXM 1GO0A 1JJ2F 3E20B 3CG6A 1GO1A 1YHQF 3CCUF 1YJWF 4X3MA 1VQ7F 3AGKA 1X7OA 5EO3A 2OHWA 1VQ4F 4TZZA 4NUTA 3G6EF
chains in the Genus database with same CATH superfamily
1UI9A 3N2GB 3J7AR 1X25A 2K1SA 3V4DA 2LCAA 3QUWA 1FSZA 2AMTA 3WXMB 2RHHA 1VQMF 3NMUC 1PF5A 3RYIA 4X20A 5DCVA 4LCKA 2V9YA 5HWEA 1E7KA 2UYJA 3GHZA 1YI2F 1XV2A 3PAFA 4O2AA 3IEQA 3LWQC 2ZVZA 2H6LA 3CCSF 3WJPA 3V7QA 3CMAF 3CC7F 5FNVA 3HKBA 1IPAA 4C4WC 4I55A 3JAWA 3S0HA 1NQ3A 1W40A 1Q86H 1W2BF 2JNBA 4DXDA 5FJ4C 5IYZA 3JVHA 4IHJB 3MCQA 1ONIA 1YJNF 5LP6B 2ZODA 4ZK7A 4YJ2B 3N2KB 3V7EA 2VXYA 2Z1FA 3JATA 3FD6A 3GYQA 1VQ9F 1QD9A 5IJ9B 5LXTA 3IEWA 3S0WA 4G4VA 1W59A 2GLZA 2UYNB 3FPIA 1VQLF 3JARB 3CD6F 5GONB 4PWTA 4G88A 1VK3A 2ALEA 1TUBB 2F9ZC 2CWJA 2ZAUA 3CYPB 2UYPA 3WGMA 1VQPF 2KGWA 1GX1A 2VAPA 1YIJF 1OAPA 3DDNA 3I55F 4I4TB 1YQNA 4ZOLB 3E22B 4TV8B 5ITZA 2UYKA 4G4ZA 5HY2A 2YXZA 3KJJA 2RHLA 4IHJA 2Q1YA 3HWUA 5J2TB 3SIUA 5BMVB 2OTLF 3I7TA 3IMPA 1VQ5F 1W57A 2LBXA 2HVYD 1KNJA 5JQGA 4ERHA 3C9TA 5CA1B 2HP0B 3J80M 1VQKF 4O4HA 3ZP4A 5LOVB 3G71F 1FNJA 4X1IA 4LNUB 1R1MA 5FLXM 1JFFB 1GO0A 4I50A 4KWEA 5EIBD 1FFXB 3CG6A 3RYCA 1H47A 3C8LA 3GTZA 4X3MA 1VQ7F 1COMA 1VQ4F 3E22A 4TZZA 3WGLA 1U43A 1XHOA 4X20B 2CHSA 1OFUA 4BT4A 3OBYA 4O4LA 2VAWA 3D00A 2FC3A 1H48A 3IKFA 3O85A 4O2AB 3CCEF 1M90H 3G4SF 4B45A 4RHAA 4G4WA 5HXUA 3HKBB 3OBWA 4I55B 3JAWB 3S02A 3CPWF 3OW2F 3RYHA 4LNUA 1T0KB 1YITF 1RLUA 4EI7A 3CXCF 3CYQA 5IYZB 3VI6A 4B46A 2L26A 3CCVF 3LYBA 3VTIC 4G4XA 4BVRA 2PMPA 2R751 3V3TA 2I6DA 2GVIA 4EI9A 3JATB 5LA6A 3LMEA 2BTOA 5LXTB 1FNKA 1VH8A 2CSLA 3J81M 1U3PA 4ZHQB 2HRYA 1VQOF 2NMUA 1SZQA 4WBNA 5HP7A 2B33A 2DT4A 2EWCA 5HY1A 4B62A 4O4JA 2IG8A 4EB6A 2G9IA 1YGYA 4C8EA 1RA4A 3K14A 2I6RA 4HNAA 4TV9A 3WPWA 3JASA 3B6NA 3TD3A 3HJWC 5ITZB 1QAHA 3UT5A 3LWRC 1RLGA 2H8EA 3C9RA 3VCZA 5CB4A 1X52A 3WJRA 3IR9A 3CB2A 2VAMA 4ZHYB 2N48A 2YYEA 3TD4A 4EI8A 5JQGB 4ZHWA 3RYFA 4ZHQA 1KNKA 3K0TA 1IV4A 4O4HB 5EAZA 3ON1A 2QA4F 3VOAA 3CC4F 3NVKE 4R40B 2CHTA 4C8IA 4X1IB 1M1KH 3JALA 4BY9D 3KHNA 1UFYA 3JCMM 2QEXF 3CCMF 3FD5A 1SDSA 1XBIA 4G4YA 4I50B 3ZP7A 3RYCB 3NK7A 1SA0A 2CVLA 1QU9A 2BTQB 1W5BA 5EYPA 4XCQA 3LDTA 1JY8A 3EORA 5LYJA 3WGKA 3FBAA 4RQOA 3L7QA 1X7OA 2OHWA 3K2XA 2R6R1 4O4LB 3R0PA 2QTPA 5C8YA 5MN5A 3F0EA 4U3JA 5HXZA 2LBWA 2HX0A 1S72F 1PXWA 3K12A 3MDOA 5KMGB 1JD1A 4YJ3A 5GIPC 1Q82H 5G4VC 1KQSF 4BVTA 4BT2A 2PHNA 3N4YA 3S03A 1W5AA 2HQSC 2FGYA 5A2QM 2QI2A 1XRGA 3HKDA 3RYHB 5EZYA 4NQ3A 5B8FA 3F0DA 4F6RA 3KJKA 3F0FA 3TD5A 5KX5A 4IIJB 4O2BA 1ZWZA 4X1KA 3RA5A 1IV1A 3FFMA 5LA6B 4TUYA 3RE3A 2VGNA 3CMEF 3ELCA 3C9UA 1W42A 3OONA 4WBNB 1W5EA 3LWOC 2LBTA 4ZI7A 2IAFA 4U39A 5KMGA 1QVGF 1YJ9F 5AVMA 2P6YA 3U0OA 1Q81H 3F6MA 3N4ZA 4O4JB 1K9MH 4EB6B 1N8RH 2GZLA 5G4UC 1CLIA 3M4SA 2W8BC 3LWPC 2Z01A 1TVKA 1Z5VA 4FFBA 4HNAB 4TV9B 5MN4A 3JASB 1J7HA 2RB9A 4IIJA 3NK6A 1K73H 1KC8H 3UT5B 3VIUA 3CCQF 1Z5WA 5CB4B 3KE1A 4O4IA 1W41A 3PLAC 1RQ7A 3HKCA 3RYFB 2OTMA 5IJ0A 1VQ8F 1W581 3WGJA 3JALB 2RHOA 3M84A 5CA0A 5JH7A 3HKEA 2HS4A 2HS0A 3LFOA 1VQNF 4C8GA 3S0YA 3M1XA 5JVDA 2Z1TA 1VQVA 3VYUC 1SA0B 3F0GA 1ODEA 3HTNA 3JAKA 3MBMA 5GAPK 5EYPB 2HP3A 1JN1A 2MQEA 1GZ0A 5LYJB 4X1YA 3KIZA 5J2UA 1RQ2A 3ERNA 5JCOC 3HAXD 5C8YB 1DBFA 4U3JB 3AGKA 3IKEA 3ZO8A 4YJ3B 2ZVYA 4NWOB 2CW4A 3G6EF 2Z1EA 5EB1B 2BTUA 5JCOA 5MN6A 3VMFB 4BT5A 3HKDB 3ZOPA 4DRXA 2OZBA 5EZYB 1T0AA 1NJIH 4F6RB 5KX5B 3N2GA 5EWRA 4O2BB 3WJQA 1U3LA 2AIZP 1IV2A 2CZWA 4X1KB 3ESJA 4BW0B 1Q8RA 3E1YA 3NVIB 2WALA 2ZOVA 4TUYB 2VGMA 3RA6A 2H8CA 3I56F 3T80A 2AIFA 3DC2A 1Q7YH 4ZI7B 3VYTC 3SIVA 3QTYA 3P0ZA 2Q1XA 3S06A 5LP6C 1CK2A 4C82A 3CCJF 4BT3A 2DYYA 3CPQA 3VO8A 2UZHA 4E6EA 2KG4A 3VOBA 1W55A 3JAMM 1U40A 5EIBC 3WPXA 1TVKB 4BVQA 4FFBB 4ZHVA 5IT9M 1CN7A 2OTJF 4B5CA 5LP6A 3P4EA 5HP8A 4YJ2A 3N2KA 3CCRF 2RHJA 4O4IB 5IJ9A 5GANK 3HKCB 3VYSC 4BT7A 3MQWA 3CCLF 4C81A 1K8AH 2UYNA 3JARA 5GONA 2IQQA 5IJ0B 1TUBA 3D54A 1VHAA 5HY4A 1DT9A 5CA0B 5JH7B 1KD1H 3HKEB 1W3EX 1X7PA 2KTVA 3C9SA 1W5FA 5GIOC 3Q8HA 5JVDB 4I4TA 3LWVC 5GINC 1QVFF 2BO1A 4ZOLA 3JAKB 4TV8A 4M8IA 3I3FA 2HS3A 3RYIB 2KTUA 4X3LA 5J2TA 4X1YB 5BMVA 5J2UB 2ZF8A 5EB0A 5HY0A 1IV3A 1VQ6F 1H7MA 3CC2F 3MCAB 5CA1A 1NMUB 2HP0A 5FNVB 5LOVA 3QHDA 1JJ2F 2Z1UA 3E20B 4BVSA 1GO1A 3BYQA 3P10A 1YHQF 3CCUF 1YJWF 3D01A 5EO3A 4DRXB 3WGNA 1JFFA 4BT6A 4NUTA 2HRUA 1FFXA
chains in the Genus database with same CATH topology
5HXZA 2LBWA 3VMFB 1S72F 3J7AR 1PXWA 2OZBA 5GIPC 3OBYA 1Q82H 3WXMB 5G4VC 4BVTA 1NJIH 1KQSF 1VQMF 3N4YA 3NMUC 3D00A 2FC3A 3O85A 5EWRA 5DCVA 2FGYA 3CCEF 1M90H 5A2QM 4LCKA 2CZWA 3G4SF 2QI2A 4NQ3A 4BW0B 5HWEA 1E7KA 5HXUA 3E1YA 1YI2F 2WALA 3NVIB 3PAFA 3OBWA 3LWQC 1ZWZA 3CPWF 3CCSF 3OW2F 3V7QA 2VGMA 3RA6A 3RA5A 1T0KB 3FFMA 1YITF 4EI7A 3CMAF 3CC7F 3I56F 3CXCF 1IPAA 4C4WC 3VI6A 3CCVF 2AIFA 1Q7YH 2VGNA 3CMEF 1W40A 1Q86H 3SIVA 4BVRA 1W2BF 3V3TA 2I6DA 2JNBA 4EI9A 1CK2A 1W42A 3CCJF 5FJ4C 3CPQA 3LWOC 2KG4A 3J81M 1YJNF 3JAMM 1QVGF 1VQOF 1YJ9F 4BVQA 3V7EA 1Q81H 3N4ZA 1K9MH 3GYQA 1VQ9F 1N8RH 5IT9M 1CN7A 2OTJF 5G4UC 5HY1A 3LWPC 3CCRF 2GLZA 1VQLF 3CD6F 1K73H 1RA4A 3NK6A 1KC8H 2ALEA 5GANK 2F9ZC 3CCQF 3CCLF 1K8AH 1VQPF 1W41A 3HJWC 3PLAC 1YIJF 3LWRC 1RLGA 3I55F 1X52A 5HY4A 3IR9A 1DT9A 1KD1H 4EI8A 5HY2A 1W3EX 1X7PA 2KTVA 5GIOC 1VQ8F 3LWVC 3SIUA 5GINC 1QVFF 2BO1A 2OTLF 3ON1A 1VQ5F 2QA4F 3LFOA 2LBXA 1VQNF 3CC4F 2HVYD 2KTUA 3NVKE 4X3LA 1M1KH 4BY9D 3J80M 1VQKF 3JCMM 5GAPK 2QEXF 5HY0A 3CCMF 3G71F 1SDSA 1VQ6F 1XBIA 1H7MA 3CC2F 3MCAB 1GZ0A 1NMUB 3NK7A 3HAXD 4XCQA 5FLXM 1GO0A 1JJ2F 3E20B 3CG6A 4BVSA 1GO1A 1YHQF 3CCUF 1YJWF 4X3MA 1VQ7F 3AGKA 1X7OA 5EO3A 2OHWA 1VQ4F 4TZZA 4NUTA 3G6EF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LBW A;  3VMF B;  1S72 F;  3J7A R;  1PXW A;  2OZB A;  5GIP C;  3OBY A;  1Q82 H;  3WXM B;  5G4V C;  1KQS F;  1NJI H;  1VQM F;  3N4Y A;  3NMU C;  2FC3 A;  3O85 A;  5EWR A;  5DCV A;  3CCE F;  1M90 H;  5A2Q M;  4LCK A;  2CZW A;  3G4S F;  2QI2 A;  4BW0 B;  1E7K A;  3E1Y A;  1YI2 F;  2WAL A;  3NVI B;  3PAF A;  3OBW A;  3LWQ C;  1ZWZ A;  3CPW F;  3CCS F;  3OW2 F;  3V7Q A;  2VGM A;  3RA6 A;  3RA5 A;  1T0K B;  3FFM A;  1YIT F;  3CMA F;  3CC7 F;  3I56 F;  3CXC F;  1IPA A;  4C4W C;  3VI6 A;  3CCV F;  2AIF A;  1Q7Y H;  2VGN A;  3CME F;  1W40 A;  1Q86 H;  3SIV A;  1W2B F;  2I6D A;  2JNB A;  5FJ4 C;  1CK2 A;  1W42 A;  3CCJ F;  3CPQ A;  3LWO C;  2KG4 A;  3J81 M;  1YJN F;  3JAM M;  1QVG F;  1VQO F;  1YJ9 F;  3V7E A;  1Q81 H;  3N4Z A;  1K9M H;  3GYQ A;  1VQ9 F;  1N8R H;  5IT9 M;  1CN7 A;  2OTJ F;  5G4U C;  3LWP C;  3CCR F;  1VQL F;  3CD6 F;  1K73 H;  1RA4 A;  3NK6 A;  1KC8 H;  2ALE A;  5GAN K;  3CCQ F;  3CCL F;  1K8A H;  1VQP F;  1W41 A;  3HJW C;  3PLA C;  1YIJ F;  3LWR C;  1RLG A;  3I55 F;  1X52 A;  3IR9 A;  1DT9 A;  1KD1 H;  1W3E X;  1X7P A;  2KTV A;  5GIO C;  1VQ8 F;  3LWV C;  3SIU A;  5GIN C;  1QVF F;  2BO1 A;  2OTL F;  3ON1 A;  1VQ5 F;  2QA4 F;  3LFO A;  2LBX A;  1VQN F;  3CC4 F;  2HVY D;  2KTU A;  3NVK E;  4X3L A;  1M1K H;  4BY9 D;  3J80 M;  1VQK F;  3JCM M;  5GAP K;  2QEX F;  3CCM F;  3G71 F;  1SDS A;  1VQ6 F;  1XBI A;  1H7M A;  3CC2 F;  3MCA B;  1GZ0 A;  1NMU B;  3NK7 A;  3HAX D;  5FLX M;  1GO0 A;  1JJ2 F;  3E20 B;  3CG6 A;  1GO1 A;  1YHQ F;  3CCU F;  1YJW F;  4X3M A;  1VQ7 F;  3AGK A;  1X7O A;  5EO3 A;  2OHW A;  1VQ4 F;  4TZZ A;  4NUT A;  3G6E F; 
#chains in the Genus database with same CATH topology
 1UI9 A;  3N2G B;  3J7A R;  1X25 A;  2K1S A;  3V4D A;  2LCA A;  3QUW A;  1FSZ A;  2AMT A;  3WXM B;  2RHH A;  1VQM F;  3NMU C;  1PF5 A;  3RYI A;  4X20 A;  5DCV A;  4LCK A;  2V9Y A;  5HWE A;  1E7K A;  2UYJ A;  3GHZ A;  1YI2 F;  1XV2 A;  3PAF A;  4O2A A;  3IEQ A;  3LWQ C;  2ZVZ A;  2H6L A;  3CCS F;  3WJP A;  3V7Q A;  3CMA F;  3CC7 F;  5FNV A;  3HKB A;  1IPA A;  4C4W C;  4I55 A;  3JAW A;  3S0H A;  1NQ3 A;  1W40 A;  1Q86 H;  1W2B F;  2JNB A;  4DXD A;  5FJ4 C;  5IYZ A;  3JVH A;  4IHJ B;  3MCQ A;  1ONI A;  1YJN F;  5LP6 B;  2ZOD A;  4ZK7 A;  4YJ2 B;  3N2K B;  3V7E A;  2VXY A;  2Z1F A;  3JAT A;  3FD6 A;  3GYQ A;  1VQ9 F;  1QD9 A;  5IJ9 B;  5LXT A;  3IEW A;  3S0W A;  4G4V A;  1W59 A;  2GLZ A;  2UYN B;  3FPI A;  1VQL F;  3JAR B;  3CD6 F;  5GON B;  4PWT A;  4G88 A;  1VK3 A;  2ALE A;  1TUB B;  2F9Z C;  2CWJ A;  2ZAU A;  3CYP B;  2UYP A;  3WGM A;  1VQP F;  2KGW A;  1GX1 A;  2VAP A;  1YIJ F;  1OAP A;  3DDN A;  3I55 F;  4I4T B;  1YQN A;  4ZOL B;  3E22 B;  4TV8 B;  5ITZ A;  2UYK A;  4G4Z A;  5HY2 A;  2YXZ A;  3KJJ A;  2RHL A;  4IHJ A;  2Q1Y A;  3HWU A;  5J2T B;  3SIU A;  5BMV B;  2OTL F;  3I7T A;  3IMP A;  1VQ5 F;  1W57 A;  2LBX A;  2HVY D;  1KNJ A;  5JQG A;  4ERH A;  3C9T A;  5CA1 B;  2HP0 B;  3J80 M;  1VQK F;  4O4H A;  3ZP4 A;  5LOV B;  3G71 F;  1FNJ A;  4X1I A;  4LNU B;  1R1M A;  5FLX M;  1JFF B;  1GO0 A;  4I50 A;  4KWE A;  5EIB D;  1FFX B;  3CG6 A;  3RYC A;  1H47 A;  3C8L A;  3GTZ A;  4X3M A;  1VQ7 F;  1COM A;  1VQ4 F;  3E22 A;  4TZZ A;  3WGL A;  1U43 A;  1XHO A;  4X20 B;  2CHS A;  1OFU A;  4BT4 A;  3OBY A;  4O4L A;  2VAW A;  3D00 A;  2FC3 A;  1H48 A;  3IKF A;  3O85 A;  4O2A B;  3CCE F;  1M90 H;  3G4S F;  4B45 A;  4RHA A;  4G4W A;  5HXU A;  3HKB B;  3OBW A;  4I55 B;  3JAW B;  3S02 A;  3CPW F;  3OW2 F;  3RYH A;  4LNU A;  1T0K B;  1YIT F;  1RLU A;  4EI7 A;  3CXC F;  3CYQ A;  5IYZ B;  3VI6 A;  4B46 A;  2L26 A;  3CCV F;  3LYB A;  3VTI C;  4G4X A;  4BVR A;  2PMP A;  2R75 1;  3V3T A;  2I6D A;  2GVI A;  4EI9 A;  3JAT B;  5LA6 A;  3LME A;  2BTO A;  5LXT B;  1FNK A;  1VH8 A;  2CSL A;  3J81 M;  1U3P A;  4ZHQ B;  2HRY A;  1VQO F;  2NMU A;  1SZQ A;  4WBN A;  5HP7 A;  2B33 A;  2DT4 A;  2EWC A;  5HY1 A;  4B62 A;  4O4J A;  2IG8 A;  4EB6 A;  2G9I A;  1YGY A;  4C8E A;  1RA4 A;  3K14 A;  2I6R A;  4HNA A;  4TV9 A;  3WPW A;  3JAS A;  3B6N A;  3TD3 A;  3HJW C;  5ITZ B;  1QAH A;  3UT5 A;  3LWR C;  1RLG A;  2H8E A;  3C9R A;  3VCZ A;  5CB4 A;  1X52 A;  3WJR A;  3IR9 A;  3CB2 A;  2VAM A;  4ZHY B;  2N48 A;  2YYE A;  3TD4 A;  4EI8 A;  5JQG B;  4ZHW A;  3RYF A;  4ZHQ A;  1KNK A;  3K0T A;  1IV4 A;  4O4H B;  5EAZ A;  3ON1 A;  2QA4 F;  3VOA A;  3CC4 F;  3NVK E;  4R40 B;  2CHT A;  4C8I A;  4X1I B;  1M1K H;  3JAL A;  4BY9 D;  3KHN A;  1UFY A;  3JCM M;  2QEX F;  3CCM F;  3FD5 A;  1SDS A;  1XBI A;  4G4Y A;  4I50 B;  3ZP7 A;  3RYC B;  3NK7 A;  1SA0 A;  2CVL A;  1QU9 A;  2BTQ B;  1W5B A;  5EYP A;  4XCQ A;  3LDT A;  1JY8 A;  3EOR A;  5LYJ A;  3WGK A;  3FBA A;  4RQO A;  3L7Q A;  1X7O A;  2OHW A;  3K2X A;  2R6R 1;  4O4L B;  3R0P A;  2QTP A;  5C8Y A;  5MN5 A;  3F0E A;  4U3J A;  5HXZ A;  2LBW A;  2HX0 A;  1S72 F;  1PXW A;  3K12 A;  3MDO A;  5KMG B;  1JD1 A;  4YJ3 A;  5GIP C;  1Q82 H;  5G4V C;  1KQS F;  4BVT A;  4BT2 A;  2PHN A;  3N4Y A;  3S03 A;  1W5A A;  2HQS C;  2FGY A;  5A2Q M;  2QI2 A;  1XRG A;  3HKD A;  3RYH B;  5EZY A;  4NQ3 A;  5B8F A;  3F0D A;  4F6R A;  3KJK A;  3F0F A;  3TD5 A;  5KX5 A;  4IIJ B;  4O2B A;  1ZWZ A;  4X1K A;  3RA5 A;  1IV1 A;  3FFM A;  5LA6 B;  4TUY A;  3RE3 A;  2VGN A;  3CME F;  3ELC A;  3C9U A;  1W42 A;  3OON A;  4WBN B;  1W5E A;  3LWO C;  2LBT A;  4ZI7 A;  2IAF A;  4U39 A;  5KMG A;  1QVG F;  1YJ9 F;  5AVM A;  2P6Y A;  3U0O A;  1Q81 H;  3F6M A;  3N4Z A;  4O4J B;  1K9M H;  4EB6 B;  1N8R H;  2GZL A;  5G4U C;  1CLI A;  3M4S A;  2W8B C;  3LWP C;  2Z01 A;  1TVK A;  1Z5V A;  4FFB A;  4HNA B;  4TV9 B;  5MN4 A;  3JAS B;  1J7H A;  2RB9 A;  4IIJ A;  3NK6 A;  1K73 H;  1KC8 H;  3UT5 B;  3VIU A;  3CCQ F;  1Z5W A;  5CB4 B;  3KE1 A;  4O4I A;  1W41 A;  3PLA C;  1RQ7 A;  3HKC A;  3RYF B;  2OTM A;  5IJ0 A;  1VQ8 F;  1W58 1;  3WGJ A;  3JAL B;  2RHO A;  3M84 A;  5CA0 A;  5JH7 A;  3HKE A;  2HS4 A;  2HS0 A;  3LFO A;  1VQN F;  4C8G A;  3S0Y A;  3M1X A;  5JVD A;  2Z1T A;  1VQV A;  3VYU C;  1SA0 B;  3F0G A;  1ODE A;  3HTN A;  3JAK A;  3MBM A;  5GAP K;  5EYP B;  2HP3 A;  1JN1 A;  2MQE A;  1GZ0 A;  5LYJ B;  4X1Y A;  3KIZ A;  5J2U A;  1RQ2 A;  3ERN A;  5JCO C;  3HAX D;  5C8Y B;  1DBF A;  4U3J B;  3AGK A;  3IKE A;  3ZO8 A;  4YJ3 B;  2ZVY A;  4NWO B;  2CW4 A;  3G6E F;  2Z1E A;  5EB1 B;  2BTU A;  5JCO A;  5MN6 A;  3VMF B;  4BT5 A;  3HKD B;  3ZOP A;  4DRX A;  2OZB A;  5EZY B;  1T0A A;  1NJI H;  4F6R B;  5KX5 B;  3N2G A;  5EWR A;  4O2B B;  3WJQ A;  1U3L A;  2AIZ P;  1IV2 A;  2CZW A;  4X1K B;  3ESJ A;  4BW0 B;  1Q8R A;  3E1Y A;  3NVI B;  2WAL A;  2ZOV A;  4TUY B;  2VGM A;  3RA6 A;  2H8C A;  3I56 F;  3T80 A;  2AIF A;  3DC2 A;  1Q7Y H;  4ZI7 B;  3VYT C;  3SIV A;  3QTY A;  3P0Z A;  2Q1X A;  3S06 A;  5LP6 C;  1CK2 A;  4C82 A;  3CCJ F;  4BT3 A;  2DYY A;  3CPQ A;  3VO8 A;  2UZH A;  4E6E A;  2KG4 A;  3VOB A;  1W55 A;  3JAM M;  1U40 A;  5EIB C;  3WPX A;  1TVK B;  4BVQ A;  4FFB B;  4ZHV A;  5IT9 M;  1CN7 A;  2OTJ F;  4B5C A;  5LP6 A;  3P4E A;  5HP8 A;  4YJ2 A;  3N2K A;  3CCR F;  2RHJ A;  4O4I B;  5IJ9 A;  5GAN K;  3HKC B;  3VYS C;  4BT7 A;  3MQW A;  3CCL F;  4C81 A;  1K8A H;  2UYN A;  3JAR A;  5GON A;  2IQQ A;  5IJ0 B;  1TUB A;  3D54 A;  1VHA A;  5HY4 A;  1DT9 A;  5CA0 B;  5JH7 B;  1KD1 H;  3HKE B;  1W3E X;  1X7P A;  2KTV A;  3C9S A;  1W5F A;  5GIO C;  3Q8H A;  5JVD B;  4I4T A;  3LWV C;  5GIN C;  1QVF F;  2BO1 A;  4ZOL A;  3JAK B;  4TV8 A;  4M8I A;  3I3F A;  2HS3 A;  3RYI B;  2KTU A;  4X3L A;  5J2T A;  4X1Y B;  5BMV A;  5J2U B;  2ZF8 A;  5EB0 A;  5HY0 A;  1IV3 A;  1VQ6 F;  1H7M A;  3CC2 F;  3MCA B;  5CA1 A;  1NMU B;  2HP0 A;  5FNV B;  5LOV A;  3QHD A;  1JJ2 F;  2Z1U A;  3E20 B;  4BVS A;  1GO1 A;  3BYQ A;  3P10 A;  1YHQ F;  3CCU F;  1YJW F;  3D01 A;  5EO3 A;  4DRX B;  3WGN A;  1JFF A;  4BT6 A;  4NUT A;  2HRU A;  1FFX A; 
#chains in the Genus database with same CATH homology
 5HXZ A;  2LBW A;  3VMF B;  1S72 F;  3J7A R;  1PXW A;  2OZB A;  5GIP C;  3OBY A;  1Q82 H;  3WXM B;  5G4V C;  4BVT A;  1NJI H;  1KQS F;  1VQM F;  3N4Y A;  3NMU C;  3D00 A;  2FC3 A;  3O85 A;  5EWR A;  5DCV A;  2FGY A;  3CCE F;  1M90 H;  5A2Q M;  4LCK A;  2CZW A;  3G4S F;  2QI2 A;  4NQ3 A;  4BW0 B;  5HWE A;  1E7K A;  5HXU A;  3E1Y A;  1YI2 F;  2WAL A;  3NVI B;  3PAF A;  3OBW A;  3LWQ C;  1ZWZ A;  3CPW F;  3CCS F;  3OW2 F;  3V7Q A;  2VGM A;  3RA6 A;  3RA5 A;  1T0K B;  3FFM A;  1YIT F;  4EI7 A;  3CMA F;  3CC7 F;  3I56 F;  3CXC F;  1IPA A;  4C4W C;  3VI6 A;  3CCV F;  2AIF A;  1Q7Y H;  2VGN A;  3CME F;  1W40 A;  1Q86 H;  3SIV A;  4BVR A;  1W2B F;  3V3T A;  2I6D A;  2JNB A;  4EI9 A;  1CK2 A;  1W42 A;  3CCJ F;  5FJ4 C;  3CPQ A;  3LWO C;  2KG4 A;  3J81 M;  1YJN F;  3JAM M;  1QVG F;  1VQO F;  1YJ9 F;  4BVQ A;  3V7E A;  1Q81 H;  3N4Z A;  1K9M H;  3GYQ A;  1VQ9 F;  1N8R H;  5IT9 M;  1CN7 A;  2OTJ F;  5G4U C;  5HY1 A;  3LWP C;  3CCR F;  2GLZ A;  1VQL F;  3CD6 F;  1K73 H;  1RA4 A;  3NK6 A;  1KC8 H;  2ALE A;  5GAN K;  2F9Z C;  3CCQ F;  3CCL F;  1K8A H;  1VQP F;  1W41 A;  3HJW C;  3PLA C;  1YIJ F;  3LWR C;  1RLG A;  3I55 F;  1X52 A;  5HY4 A;  3IR9 A;  1DT9 A;  1KD1 H;  4EI8 A;  5HY2 A;  1W3E X;  1X7P A;  2KTV A;  5GIO C;  1VQ8 F;  3LWV C;  3SIU A;  5GIN C;  1QVF F;  2BO1 A;  2OTL F;  3ON1 A;  1VQ5 F;  2QA4 F;  3LFO A;  2LBX A;  1VQN F;  3CC4 F;  2HVY D;  2KTU A;  3NVK E;  4X3L A;  1M1K H;  4BY9 D;  3J80 M;  1VQK F;  3JCM M;  5GAP K;  2QEX F;  5HY0 A;  3CCM F;  3G71 F;  1SDS A;  1VQ6 F;  1XBI A;  1H7M A;  3CC2 F;  3MCA B;  1GZ0 A;  1NMU B;  3NK7 A;  3HAX D;  4XCQ A;  5FLX M;  1GO0 A;  1JJ2 F;  3E20 B;  3CG6 A;  4BVS A;  1GO1 A;  1YHQ F;  3CCU F;  1YJW F;  4X3M A;  1VQ7 F;  3AGK A;  1X7O A;  5EO3 A;  2OHW A;  1VQ4 F;  4TZZ A;  4NUT A;  3G6E F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...