3CCSS

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
b'SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ccsS00
4FXVA 1U1NA 1N52B 1X4GA 1WHVA 2RRAA 2QEXS 2LXUA 2WBRA 5GAGU 2CQIA 1QVGR 2MYFA 2DO4A 3SXLA 2V94A 4TU9A 3NNHA 1FXLA 2RS2A 4ZKAA 2FPHX 5DM7Q 2LECA 2YKAA 1WF1A 2AYGA 1FT8A 1DBDA 2LMIA 2MSTA 4FXWA 3VF0B 2DB1A 2MGZB 3CC2S 4V19X 2F3JA 3PIPQ 1U1QA 1S79A 1YHQS 3Q2TC 4LIRA 1M5VC 5MLCV 1K8AT 3MI7X 5LXYA 2DIVA 5DDRC 2M88A 4QPTA 1WF2A 1N54B 2KG1A 3G9CA 4YOEA 2X1GA 5ITHA 3UD4P 1L3KA 2CQ0A 5HO4A 5DDQC 5IQQA 2MKKA 2N7CA 2QA4S 2XS5A 2D9PA 1VBYA 2CPHA 1X4DA 2RRBA 1Q81T 1YJNS 3U1LA 4WF9Q 1K73T 3U1MA 1SXLA 2VOOA 3IRWP 1FHTA 2LCWA 3UE2A 4F25A 2CQ3A 2DGVA 1WI8A 2DH9A 2DNMA 2G4BA 2LEBA 2AYBA 3SMZA 3TYTA 2DIUA 1KOOA 4WCEQ 2MKHA 5LJ3Y 1VQLS 1F9FA 5FJ4A 3VAHA 3MOJB 1WHXA 2DGOA 2M52A 2DNNA 2KRBA 1SJ3P 3MURP 3R27A 1Q86T 1HA1A 1H2VZ 1WHWA 4OZ1A 3EGZA 1PGZA 2MJNA 2L9WA 1YTYA 3R1LA 2DNKA 1WEZA 3N9UC 4WFAQ 2BOPA 2DH8A 2CPXA 1X4FA 4OZ0A 2FHOB 2CQHA 4U67Q 4TLQA 3CCRS 1H6KX 1U1PA 4C0OC 1D9AA 1WI6A 2EVZA 2CQCA 2HVZA 3SDEA 4TU7A 1VQ9S 1X5TA 3FEYB 1WHYA 1XN9A 1VQ7S 1KOHA 2QFJA 1YI2S 1FNXH 1VQ8S 1WG4A 2RVJA 3TP2A 1AUDA 2MKJA 2KN4A 2DHGA 3P6YC 2YTCA 4IOCQ 2M4MA 1WEYA 2OIHA 2O3DA 1VQPS 3EGNA 3THPA 1KQSR 2DNRA 3R1HA 3MDFA 4Y0FA 1X0FA 4WIIA 4Z2XA 2RS8A 5LJ5Y 1JMTA 4ED5A 4PKDB 1W2BR 3SDEB 2HZCA 2LA6A 2HGLA 4CH1A 4UY8T 2CQ1A 3S01A 3RW6A 5DDOC 2K3KA 2DNOA 5IM0A 3CCLS 2SXLA 5GVQA 5GADU 2MKIA 2KM8B 3L3CA 1URNA 1QVFR 3MD3A 3JB9k 2MHNA 2KI2A 2RT3A 1WWHA 3MUTP 2A3JA 2MZTA 2ZJPQ 1VBZA 3S7RA 1PO6A 2GHPA 1VQMS 2MZJA 4RU2A 2ZJQQ 2MZQA 4A8XA 3NNAA 2I2YA 1UP1A 2N82B 1WG5A 2FC8A 2M2BA 1P1TA 2OSRA 2CPEA 1H2TZ 2E5IA 2RU3A 1R8HA 2LYVA 3D2WA 1KC8T 2M8DB 1WG1A 3VAGA 2MB0B 3CCJS 3DLLQ 5IM0B 1JJ2R 2EK6A 3ULHA 3CPWR 3EX7B 2RUGA 3S6EA 2ZJRQ 3CCQS 2MMYA 2B0GA 3BO3A 2MQLA 1U6BA 3H2UB 1SJQA 3US5A 3P3DA 2AD9A 1DRZA 2N3OA 1UAWA 1YWXA 2OTLS 3K0JA 2JVRA 1B7FA 1Q82T 1CVJA 3VAJA 1X4HA 1U1RA 1OIAA 2DISA 3G71S 2CQ4A 5GMKa 2KU7A 3G96A 3LPYA 1U2FA 2ADBA 1U1MA 2XS7A 2XS2A 1U6FA 2DGQA 1M5OC 2CPJA 5HL7Q 1U1OA 2NZ4A 1SJ4P 2U2FA 2MSSA 2KVIA 2ERRA 3HHNB 1YIJS 2ADCA 2CJKA 1SJFA 2KG0A 4C4WA 5JVHQ 3IWNC 3CD6S 3FEXB 3CCVS 3I55S 4P6QA 1FJCA 1P27B 1X4CA 2KM8C 2KH9A 2MQNA 4IO9Q 2RQ4A 3G8SA 2DNPA 5LSLA 2JX2A 2CPYA 1SJRA 3H2VE 1U1LA 2MQQA 2DNYA 4QU6A 2LKZA 1DHMA 2CPZA 2J8AA 5BJRA 2LXIA 1ZH5A 2Q79A 3CTRA 1FJEB 1OO0B 1VBXA 2XSFA 3UD3P 2LQ5A 3UWTA 3NS5A 4C7QA 3RW7A 2CQ2A 2M70A 2G1DA 2AYEA 4CQ1A 2E5HA 3G6ES 3VAFA 1FJ7A 2CQBA 2LEAA 3BO4A 3BEGB 2MQMA 3P5TL 1YJ9S 3UCZP 3G8TA 3VALA 1VQOS 5IFMA 4F02A 2MY8A 2J0QD 2XB2D 3J7YU 2F9DA 3UCUP 2KXNB 2E44A 1RKJA 5JVGQ 1G2EA 2DHSA 1X4AA 5CYJA 3CUNA 1N88A 4W92B 2M8HA 2DO0A 3THTA 4CIOA 1NO8A 2KXFA 3VAKA 2KXHA 3HI9A 1O0PA 3LQVA 1ZZFA 2F9JA 4WFBQ 3OW2R 2HGNA 1VC5A 3CXCR 1X5OA 2KHCA 3CCES 2KT5A 2OJ3A 1ZZNA 1QM9A 5LXRA 3B4DA 5D78A 2X1BA 2J76E 1FO1A 2CPDA 2E5JA 5DM6Q 1JJHA 4ERDA 4QQBA 1YJWS 1HD0A 1KD1T 2L41A 2VODA 4LJMA 1UFWA 2CPFA 1X4EA 1M5PC 2J0SD 4PR6A 2DNGA 2U1AA 3CC7S 3PIOQ 1X4BA 4WFNQ 1YITS 2DGTA 2HYIB 2RNEA 5DETA 2UP1A 1VQNS 2MZRA 2YH1A 1UW4A 5CA5A 2M9KA 4EGLA 2I38A 1DZ5A 4YUDA 4WKRA 2YH0A 3S8SA 1Q7YT 2BZ2A 3CCUS 1WELA 1M5KC 2KYXA 3CF5Q 3BS9A 5GAHU 2DNHA 2DHXA 2MY7A 1NU4A 5EN1A 2JWNA 1BY9A 1M1KT 2X1FA 4YB1P 3BO2A 2PEHA 2KFYA 2CQDA 5CXTA 1RK8A 2FC9A 2DNQA 3CMAS 3P49B 3NNCA 2FY1A 2DGXA 2LA4A 3NS6A 2VOPA 1VC0A 1A7GE 2DGUA 3VAIA 2MZSA 3I56S 3ZZZA 4UQTA 5DDPC 2CPIA 4Y00A 2MQOA 2K8GA 3TO8A 2MKCA 1JJ4A 3MXHP 2DITA 3VAMA 1HD1A 1HL6A 2DHAA 2JRSA 3MUMP 3Q2SC 2N3LA 2KRRA 4J5OA 3J7ZT 5D77A 2YWKA 2M7SA 1VC6A 3CCMS 2M0GB 1S72S 1OPIA 1H2UX 4M5DB 3NMRA 3UCGA 4QU7A 5GAEU 2OTJS 1U1KA 5LSOA 4F26A 4W90B 1A9NB 2MXYA 3B4MA 2DH7A 1WTBA 2MJUA 1VQKS 2X1AA 2XNQA 1N8RT 2EK1A 2RQCA 2DGWA 2AYMA 4TU8A 1VQ4S 3CMES 3ZZYA 1VQ6S 1VQ5S 2D9OA 3CCSS 2DNZA 2OSQA 2CQGA 2L08A 2MPUA 2GO9A 2E5GA 2DNLA 3G4SS 4IOAQ 2MQPA 1X5SA 2D3OR 4BS2A 2DGSA 4LMZA 4IUFA 1OWXA 2VONA 2PE8A 2CQPA 3MUVP 2G0CA 1M90T 2NLWA 2MGZA 4CH0S 1IQTA 4PRFA 3CULA 1WF0A 1WEXA 1D8ZA 3V4MA 1NJIT 1R8PA 1K9MT 5H1SV 2MKSA 1X5PA 2DK2A 2HGMA 3CC4S 3MD1A 2JVOA 2XNRA 2MZ1A 3DXBA
chains in the Genus database with same CATH superfamily
1TUWA 2W2MP 2ZC4A 2MYFA 4ZDNA 3SCKE 2VDHA 2H9ZA 5LM7E 5FD1A 3SCLE 1LQ9A 3MM7B 1RAFB 4IOBA 5B7WA 3TZXA 4LIRA 3TNVA 4ANCA 2ZH7A 3D28A 2PSZA 4U9RA 4U95A 4HHHA 2R2RA 1B0TA 2CG4A 3LUYA 4KV8B 5B0CA 3UD4P 4DJBA 5DG7A 1NDLA 4RUCA 1VQSA 1TL3B 3LTOA 2DH9A 4KIAA 3RB6A 2BJDA 2Y0BB 3A3PB 1MNEA 5LL6d 4NZ6A 1GQEA 3MOJB 5CCMA 4I2QA 2PO4A 2I8EA 3T1HJ 3HKWA 1Q86T 5D0HA 3MPDA 3AQPA 3PG9A 4Q45A 5EWEA 1YTYA 2W2PP 2AEJA 1WDTA 3DRPB 4OZ0A 3R5CA 4CO2A 1Q8LA 2IRUA 2HHPA 4C0OC 4U6PA 3L95X 1OQ6A 4NI2B 2AX0A 4B9MA 1KOHA 2QFJA 3TWZA 3LGMA 1SV5A 4LR7A 2VFVA 1F2HA 4FYWB 3KK3B 3E3XA 3DOKB 2MKIA 3M8ZA 3FSYA 1SUQA 3TA0A 2KFNA 2QA2A 4C3KA 5CYMA 2B4OA 4LRFA 4R0JA 3U27A 3GWCA 1VDHA 4L6V3 4RZRA 3C2PA 2EFQA 4NL5A 1N4LA 3KLEA 1RU2A 1T95A 3UN5A 2OP5A 4KE5A 1JK9B 2V2KA 5D0GA 3HSGA 3GYXB 1YK9A 3CO0P 4OHZA 2ADBA 2HNYA 1MWQA 1APSA 4YR2A 1YIJS 4WKYA 3PHTA 3BREA 4ZVSB 1TKZB 2B8PA 3HFZB 3W2WB 3DM2B 2C3OA 2BYCA 2QN6B 2QL9B 5J2MA 2IDEA 3MMBA 3SV4A 2ZZNA 3M8RA 3EVOA 4USWA 1ZH5A 2W7OA 2B4UA 2CJYB 2M70A 3GYNA 3G6ES 3BEGB 3MTJA 3GLJA 4Y2KA 2MY8A 4IRDA 1CJUA 4Q2LA 4NYPA 1TL1A 4OJGA 5IV4A 3CUNA 1M5HA 2CDRB 1NO8A 2OPSA 3DYAA 4ELUA 4LF8J 3IBWA 3BH6B 2KXFA 3UDCA 4OYZA 3GSDA 5H9EJ 3BZQA 4UTGA 1AFJA 4JOUA 4O23A 4WFBQ 5JJBA 5FLXU 1XNQF 1J2VA 4DL4A 3LF0A 5D78A 4FKYA 4R0EA 2C2MB 1HD0A 1X4EA 1DTQB 4PG4A 4CYUB 3GMGA 3V4IB 3T5HA 1S6QA 1H98A 4O0IA 1RAEB 3H59A 4EU0A 3T1HF 1UW4A 4K0KF 4UOFA 2ZH5A 1RAJA 1TMJA 5DRKA 4CLLA 2XMAA 3CCUS 3BKUA 1M5KC 3J7AN 2BOAA 4I69A 1KNZA 2DT9A 3F41A 5K8NA 1U8SA 3W1YC 2PEHA 4JI6F 3KMQA 3QQCD 1YSJA 2VDIA 2AJ0A 3DHXA 4ZVOB 2AU0A 3MM8B 2VOPA 2NR0A 1ZPWX 4HTIA 3I82A 1T03B 1NHKL 4USJC 1YG0A 2DKOB 1N32J 3HK2A 3FDSA 1VC6A 2NSCA 2FDNA 4CCHA 2VJUA 3KJQB 2GIQA 1DLOA 2XNQA 1N8RT 5ETMA 4YS2A 2RDJA 3L9ZA 2XI2A 4YDXA 3ENWA 3J81j 2XULA 4X64J 1X5SA 1RT1A 4OHVA 2M5YA 3DCAA 2FVCA 1VRTA 4RJVA 2G13A 2C42A 1IKXA 5AJ3J 2BJ9A 3CD0A 4RBVA 1YDLA 4FXVA 1N36F 1PBAA 2CQIA 2DO4A 4ZN1A 5E5NA 1F3FA 4O3RA 2HNDB 2HQDA 2OPQA 4H54A 1FT8A 1H0HB 5DZ7A 2XO7A 3V5RA 1K0VA 1FERA 2DXDA 4KFBB 2XY7A 4DZ6A 1FTRA 5H9FJ 5E41A 3EUNA 4FS1A 5B0BA 2BANB 4XIUA 2ZH8A 2IVYA 3OTBA 3K8VA 1LEOA 4DL0C 2QA1A 2AZ1A 1SXLA 1VR6A 3CJTA 5C5JA 5C24A 4R5PA 2LEBA 5LJ3Y 1F3VA 2XTJP 4GRSA 2JLEA 2VFSA 2M52A 4NLOA 2X51A 4GC7A 2ASJA 2H65B 2XZWA 5L8RC 2P9CA 4NXMJ 3V6DB 3KLIB 4OMFG 3SIPB 3ISND 1JLBA 3R1LA 2FHOB 2CQHA 1EJ7L 2CKWA 1M1HA 3SSQA 2BKNA 3ETMA 2EXUA 2QMUB 5HROA 2NZCA 3AQOA 4FDFA 2MKJA 4KC5A 3AOBA 1QY7A 2O3DA 5BR8J 4OL8A 3PFOA 1KQSR 3R1HA 3RAQA 2UUAF 3FSIA 2AX1A 2KT3A 2DPJA 4L3NA 4DOZA 1W2BR 4C0HA 4UY8T 4QPXA 3FRYA 4C6AA 3ZZRA 5ETRA 4DV3F 3Q0AA 1ZBTA 1URNA 2MHNA 3HT0A 2IYGA 1PO6A 2O66A 1UL3A 3PXGa 3NNAA 4ED3A 2ZH4A 1YX2A 1PILA 5F8IA 1CPZA 1F0XA 2DR7A 1HQEB 4ECQA 2Q6BA 4HTJA 4ICLB 3DDKA 3RB0A 1N32F 4Y2IA 3FEZA 3FBFA 3FCVA 3DC2A 4OYXA 2FJBB 4F50A 3D67A 1PJ6A 4I2PB 4N5SA 3P45B 3D6HB 4MMOA 4DR3J 1RTZA 1U2CA 4K4SA 4E98A 1X0PA 2J6SA 2CDQA 4ZA1A 2OEMA 3CGIA 4HH1A 4P6QA 2P9EA 3V81A 2KM8C 1EZZB 1CULB 1RWPB 9RUBA 2ZEJA 5L39A 3VVTA 1AYEA 1U47A 3BGFA 3QSIA 3FMBA 2AYEA 2CNKB 3WZ0A 1NHUA 2LP4A 1VOMA 2ROPA 3L7UA 2EC2A 3ETOA 3RB4A 1ICEB 1S1WB 3MM5A 1N88A 2BJ8A 2M8HA 3CB4A 4HHJA 1FVQA 2K1RA 4DLEA 2H4YB 4ID8A 2PN6A 4W4MA 2XZDB 1NJYA 3MEDB 1EIYB 4NPOA 4CLKA 2FZGB 4OX9J 3AH6A 1AT1B 1KVIA 3KNAA 3CEDA 2X1BA 1FEEA 1UEUA 2UU9J 3MECA 3H20A 1UFWA 4CNZA 5KFKA 3KJFB 2R42A 2JHEA 1RP5A 2HBQB 2B7BB 3TQ1A 2IC3A 5ETTA 2ZHOA 2H3EB 3DGPA 4TKTA 1TR0A 1FRKA 4IFVA 1KSPA 2ZWOA 4ES3A 2HFSA 2D3O1 4EBEA 1IKYB 1T9WA 3PW0A 2KFZA 3QGGA 4ZCLA 5I42A 1BC6A 3O8WA 2DNQA 1SQGA 5B0GA 3DU6A 2DEJA 2PFFB 4PQUA 1VC0A 2DGUA 2YKNA 5ADZA 2VQEJ 4J9SA 2R8KA 3VGTA 5KT4A 3MUMP 2N3LA 2NYHA 4M94A 3SSSA 1S1XA 3CCMS 1S72S 2UXDF 1OPIA 4M5DB 2ACYA 1U1KA 4F4WA 4RR5A 2BRLA 2W8KA 2KL8A 3OHAA 2MJUA 1LW0B 1TUGB 2DGWA 4ES1A 4UOCA 4TU8A 2BJ7A 1FNMA 3FVYA 3ITHB 3QO9B 2GO9A 5C42A 4RW9B 2XMMA 2F8HA 2PI5A 1WC4A 1M90T 4EBDA 5AT1B 4FZVA 3VTIA 2W9CA 1JLQB 1D8ZA 1AW0A 1NJIT 1R8PA 3CJ2A 2HGMA 1S6PA 1Y5NB 3CJ4A 3LPEA 3VGSA 2BJEA 4EYIB 3SCIE 5DG8A 1MU2B 4QYRA 3GP9A 4O3QA 1S48A 4WFXA 2ROGA 4MH8A 4ZHRB 4Q7AA 4ZVTB 4MKVA 2R2TA 1SIZA 3MFHA 4TN2A 2B8QA 2DIVA 4KH0B 1N54B 3BV8A 1KHVA 5J2NB 2B51A 5HO4A 1GMWD 3ELHA 2FLLA 1RXOB 2VBZA 3TW0A 3RZAA 1PC5A 4ED4A 1BWEA 3M8SA 4CLPA 4C8KA 1Q53A 3EE3A 1S12A 1Y11A 2KZMA 4FF1A 2RDDA 4HYKA 3AOAA 2EFVA 3VAHA 4NWBA 4RU9A 2B3TB 2BQ3A 2YX7A 3D5MA 1YJVA 1TL7A 4L75A 1P6TA 3O3LA 1RKIA 1PGZA 1NM2A 3M32B 2XLJA 2YKQA 1JX4A 4ZCMA 4F36A 3GQCA 3G82B 4EYHB 3MZIA 4FKXA 4PYAA 2M3DA 2HVZA 3SDEA 1HBNB 1WHYA 3QRRA 4ZMMA 2E7XA 3CJRA 2RVJA 1AUDA 3AY0A 1OJ4A 1HBMB 2FJXA 5IWAJ 4J9RA 3CD5A 4NLVA 3DLEA 4Y0FA 1DQ9A 2RS8A 3JXOA 4P2SA 5E3AA 4JUZA 1SC1B 2HFOA 3H40A 3CCLS 3FSXA 2VA2A 3KJVB 1QVFR 1SL1A 4M5IA 2E66A 4QWAA 2ZJPQ 3W62A 3MR2A 3GJRB 1HMVA 3AJ2A 4M5HA 5EHHA 4AQYF 4I56A 4M5GA 3BQ2A 1H2TZ 2GX8A 2E9RX 2IBKA 2Y8WA 4URQU 3CPWR 3EX7B 5KG6A 3CCQS 4NZ0A 3JTNA 4B9SA 4X66J 3M30A 4NYOA 3EM1A 1FVSA 1RADB 4DEZA 1UVNA 4MTPA 3VAJA 1FNOA 4ZVGA 2OD4A 2BX6A 2VQFF 4YN3B 1U1MA 2JNJA 1M5OC 2OPRA 1WKLA 1LWCB 2NQPA 4IG3B 3QRQA 1OS5A 1N5VA 3D4JA 4LSLA 1SQFA 4FBUA 1PIEA 4KHPJ 2PMZD 2ZHBA 2Z4PA 2CPYA 3DLKB 3H2VE 3R5GA 3MCMA 4V1Ak 4EWTA 5K8PA 2XSFA 4C2MA 3NS5A 3U02A 2X3GA 3L4BC 2YKPA 1UVKA 2LXFA 2HNZA 4USMA 1U0HA 1YBUA 1C0TB 4QZVB 2WOMB 2ZM6J 3DU5A 2GZOA 4KRWA 2A18A 1EAYC 4DV7J 3PO4A 4RW6A 1QM9A 7FD1A 1Q4RA 4NX9A 3OVSA 1DTTB 4I4BA 1M5PC 2XLKA 2JEGA 3K89A 4WFNQ 2OI2A 2YVSA 3GJSB 2RNEA 5A6PA 1S6UA 2AGQA 1L3VA 3HPOA 5KFIA 4P7VA 4HDHA 3CO9A 4PWDA 1LWEA 3CF5Q 2CXEA 1Z2ZA 5DO2A 1XMBA 4BWJA 3CMAS 3O1LA 2FY1A 3R7NB 5J2QB 1A7GE 4PUOA 1Q8BA 3MMCB 1XMQF 4ELTA 2DCLA 5DDPC 4L72B 2KJVA 1FXDA 3TR5A 4IFYB 1RTIA 2M0GB 3MMAB 2ALYB 4QU7A 3PX0A 2WW8A 3W7BA 3QBCA 4H4OA 1B0VA 3NWRA 1IBLF 4ZPDA 3BPSP 4F4YA 3V2UC 5HLFB 2QMWA 2MDAA 1KHWA 3UVJB 3GIIA 2WB4A 2DNLA 3LP0A 2QGFB 1JJCB 2DGSA 1MWZA 4GMKA 2VONA 2PE8A 3MOZA 4NLUA 3G6VA 4NOHA 4NA1A 4JI7J 5HK4A 2V2QA 1AZSB 5THWA 2Y0SD 4ZCKA 2XYHB 4M5LA 2VG6A 5HQMA 2FB0A 3FRZA 1QD1A 1HNVA 2AZ3A 2RS2A 2GJ2A 4DR2J 2F65A 4MAKA 2K7JA 2RF2A 2F3JA 3PIPQ 2RJZA 5IT0A 1TKTA 3J7Z5 1RYSA 1C1BA 5ETOA 2CG8A 4PG5A 4JI8J 3T41A 5LXYA 3PFEA 4QYZJ 3OTOJ 1Y5LB 4FN5A 1NZAA 1S49A 3C16A 2QA4S 5CYQB 1J5OB 2G1HA 4WF9Q 3O44A 1K73T 2W9BB 4B3RJ 1Q1KA 1HHQA 5IQ6A 3V6KA 4ID5A 5HQLA 1H72C 1WUUA 4PEOA 1CQNA 1ZA1B 4ETXA 3UNGC 3M6VA 5C7PA 4DSFA 3RAXA 4U96A 4DR6J 1UJ4A 4QWEA 4I64A 3HVRA 4J9OA 3T1YJ 1IWGA 4WE1B 3HX9A 2XHWA 4DS4A 4F04B 2DH8A 2HFVA 1X4FA 1S7HA 4JI0F 1QUVA 1U1PA 3HM9A 4DN9A 2L48A 4WYLA 4JP8A 1LV5A 1T9YA 3A8KA 2UXBJ 4LR8A 4DN0A 2J9DA 2W2OP 3KLFB 4KY3A 2DNRA 3BGRB 3HHLD 2AHOB 2POKA 1T3NA 1RT3B 3BF4A 2SXLA 4NZ7A 5D0EA 4ED2A 1N5YA 3I31A 2R7XA 3CSKA 3EPIA 2LDYA 2ASLA 2I2YA 4K4VA 2QC3A 1K47A 2RE1A 2RU3A 4X65J 1Y10A 2ZOFA 1RAAB 1R31A 3SV3A 3NCRA 4A4JA 4ECUA 3H2UB 1DRZA 2WBMA 4ZJOA 1CVJA 1OIAA 3D7SB 1FE4A 4YMEA 1J27A 2RHSB 2HVIA 2DGQA 1U26A 4OV6A 2AV5A 3W3SA 2LLZA 1UFKA 3G6YA 4KTQA 3W2VA 4DUTA 1N6QA 4JI5J 3DDIA 3CCVS 2QLWA 2YNIA 4DV2F 3IA0A 4NA3A 3RYLA 3R7SB 3QT6A 4DDFA 8ATCB 3OHBA 4C9DA 4MK8A 3MM9B 1SJRA 1DHMA 4ZLNA 5DQHA 1Y3KA 4LSZB 4K4WA 3AAWB 5KFQA 2H5EA 4DR2F 4DFPA 1FJ7A 1A6LA 4RW7A 3EWGA 4X4UA 2MQMA 2QO3A 1UVLA 1E6YB 4N76A 2HLTA 1NDKA 3TAMA 4A8FA 4RW4A 3A4TA 1S10A 3NBPA 1HNZJ 4KGZB 2BE7D 2XG8A 4P9SA 1GXLA 3HF5A 5D6GA 1NAQA 3IGNA 3RBXA 2KT5A 1O8BA 1J5EJ 3B4DA 1URRA 4QQBA 1YJWS 1NK9A 4PR6A 4WP9A 5A8KA 3ICLA 3GIKA 2RD5C 4OX7A 1TK8A 2WK4A 4DR6F 5IC4B 4EGLA 2UUCJ 5KG4A 3R2DJ 2YH0A 4A8MP 2XQCA 2RB7A 2HSEB 1PSDA 4LIWA 4LF7J 1BY9A 4RBUA 4F0MA 4R8UA 4YB1P 3KLHA 1B0PA 1NMEB 3KLGB 3IFEA 4ATNA 3H5XA 1JLFA 2I5JA 3KLEB 1Z2LA 2BE2A 1NK8A 1F5BA 3QT8A 3QLHA 3MXHP 4O44B 5E3QA 3VAMA 2BM0A 1LW2B 1F60B 1RWXB 1FFWB 5D77A 2M7SA 1AROP 2HNYB 1CJVB 4WXOA 3UCGA 2OTJS 2ZUAA 4W90B 1NHVA 1K0TA 3M7VA 4DL2A 2IM0A 1ZTWA 5F9NA 3O2IA 1TK0A 5I3QA 2RQMA 2OSQA 4LFBF 4OLPA 3IWLA 4FF2A 1S1TA 3RAMA 2MQPA 2L9NA 4KKOB 2EFPA 4DR7J 2NLWA 5L1LA 4JV5J 3IS9A 3LP1A 4HDGA 4NCGA 1IQTA 4JI3F 3WBZA 3WX4A 3BSNA 4TY8A 5H1SV 1TVRA 5L38A 4ZJQA 1VYAA 3OFHA 4QIGA 1WHVA 2LXUA 5D4NA 4DUYJ 2PMWA 4TLRA 4ZLPA 2FPHX 1KTVA 2OPSB 3NXZA 3Q83A 3Q22A 1F9HA 4C8YA 1VHFA 2Z58B 4DPXA 3OFEA 5CZXA 1JWWA 1TL4A 4ZPCA 3H0PA 1PKUA 4QPTA 1GX5A 4C0BA 4RNOA 4J91A 4DS5A 2BUNA 3TUZC 1FX2A 2OO4A 2ZD1A 2C22A 3U1MA 2B5JA 2MEWA 4OJ1A 4P75A 5F8MA 2LVWA 3PV8A 3CIZA 4WCEQ 1IWAA 4DV4F 1C4AA 5GMEA 3I0SA 4CI0B 4A8YA 4OZ1A 1SI9A 1KDNA 5A2QY 2V8DA 5JMNA 2AP6A 3DKDA 2CPXA 4HACA 4NLTA 1N5SA 3AD7C 4OZ2A 2N4CA 1EETA 3DI6A 1C1CA 4TU7A 1GMVA 1HWLA 3IR6B 3PW2A 4IDKA 4LF9J 4YY3J 2RU9A 2JC1A 3BR9A 1RWVB 2P8IA 1QAYA 2PA3A 1X9SA 3RB3A 2UUCF 1RT1B 1YJTA 1XQIA 2CQ1A 3B78A 3S01A 2XLIA 4Q8FA 4ZPVR 3N79A 3LOUA 1VRTB 3SYZA 4QWBA 2UVVA 4BHQA 2MZTA 1PBUA 3DMJB 1L3TA 2ZH3A 4K4YA 2MZQA 1WC1A 1WG5A 2GS8A 2Q6CA 2CIMA 2OSRA 2LYVA 3VAGA 1LXNA 4O4RA 1R8AA 4B3SF 3FCWA 1BQXA 3WHIA 4FNIA 1SJQA 4RW8A 2CVIA 3SBMA 2N3OA 2HVHA 1B7FA 1FKPA 4ED7A 3GPAA 3HDSA 4DI6A 3GCXP 2PD1A 1HLWA 5KFPA 5B09A 2VICA 4KO0A 4KGKA 2FZKB 1OY8A 3GJQB 2B4VA 2VASA 3OR1A 3M8YA 1EB0A 3FEXB 4RWXA 3I55S 2OD6A 3H5UA 5G4DA 4EEYA 1RWKB 4ZP6A 2R4FA 2JX2A 5KG0A 2GQQA 4ZIWA 4DV1J 4EFAC 3QMQA 3N0VA 4C7QA 3RW7A 3Q8QB 2E5HA 2FIUA 1IBMF 4FF3A 3HHLA 1QSSA 4MT1A 5LT5A 4AYBD 4DPTA 3J7YU 2CZ4A 2EEYA 2RKIA 3TRGA 1JXVA 1Q8KA 3OW2R 2L3MA 2OJ3A 5LXRA 3E51A 4ZIVA 2VODA 2HWIA 1SJ1A 1V5IB 2U1AA 4UF4A 1LFPA 1HWIA 4U8VA 4DV0J 3OFGA 3DRRB 2FY8A 3T5JA 1OMSA 5DQIA 4USKA 2NCKL 2ZZTA 4BCAA 3K7RA 3LWLA 2I38A 3OT9A 4OLOA 1RT5B 4YUDA 2R2SA 2DR8A 2HHWA 4CO4A 4ALZA 3LANA 1NJXA 4NE9C 4G1PA 3J80Y 3GFYA 2FD2A 2V9KA 1JKHA 2IM2A 3N6LA 4DPOA 2HS3A 3OBIA 1NH8A 4PXEA 3MEKA 3U1NA 2HHXA 4GO5X 4Y34A 4OYOA 3ENAA 3TOQA 1BQMA 2AEFA 4F3OA 4DR5F 3G86A 3B4MA 4KPCA 2QZ8A 1VQ4S 2BW2A 3CMES 3D9BA 2DNZA 3RBZA 2DYAA 3ILLA 4OYAA 4DHVA 1RWWB 2DR9A 1RI7A 4YHHF 2K7KA 2QSWA 4DQIA 4DR1J 3NAIA 1TQLA 3PJWA 2MKSA 5A0YB 2GAGC 2MZ1A 1N34F 2BBEA 3TEHB 2XY6A 2AF6A 2QEXS 2F4VJ 3DLGB 1PYOB 3ENVA 4ZP7A 2NXNA 2YWFA 1S0OA 3MM5B 2R8JA 1N0UA 4FXWA 2DB1A 2K1RB 3PR5B 4Q43A 4J9NA 1T94A 3Q2TC 2IJNA 4ZVQB 1I3OB 5E33A 5E3PA 1RHKB 3HJFA 5KT2A 3IBFB 4WZMA 3QATA 2HHVA 1KR4A 3DGPB 5HMYA 2OPPB 2QV6A 2YQ1A 3WC0A 2Z57B 1OY9A 4JYAF 1HBUA 2V68A 3GFZA 3I9ZA 4WTOB 3IAS9 1VRQC 4BDPA 4A47A 2XMTA 3C6UB 1NBEB 4Z7CA 3E2EA 2MKHA 2E1CA 3BGLA 1RWUA 1HA1A 3POTA 1H2VZ 3JTPA 1WHWA 2YKNB 3L7OA 5LOQA 4A46A 2GVZB 2L9WA 1V5VA 3V6HA 4B3MF 4G1QA 4EZ6A 3O6QA 2DNKA 3QIPB 4TY9A 3BKFA 4U67Q 4EO6A 2DR6A 3CCRS 3KK1B 4ZVUB 3OPKA 2XGPA 1ZTTA 3BB5A 3KLVA 2ASYA 2HAIA 1KRPA 4RX6A 1XN9A 2XY5A 2VL1A 1S9EB 3I0RA 2P2CB 1VQPS 4PWUA 3THPA 1RAHB 1RWNB 5C42B 3KUHA 4NXNF 2J0WA 5F8JA 1FTCA 5K9FA 2LQBA 2V8PA 5LMUF 4WWSA 5IM0A 5ETKA 3KK2A 3OV7A 5HBMB 3F56A 2W9CB 2QL5B 1HI0P 2ZE2A 5KFJA 1FDNA 2DBBA 2I9SA 3D68A 4OFZA 4F4KA 4G1IA 4AXIA 2N82B 2M8DB 1E6VB 4MKAA 1JJ2R 3ULHA 6FD1A 2RUGA 4IH7A 1TAUA 1PG5B 2VZ9A 3R9LA 3EJMA 1UWBB 4FVCA 3HSJA 2BACA 3DLBA 2HHHF 4M5KA 1HNWJ 4OI0A 1HBOB 1RA6A 5HAOA 4J9LA 4P72A 5KTQA 3M2VB 4J9PA 1L5UA 5L1JA 5GADI 2AT1B 2UUBJ 4Q0BA 4F8RA 2ERRA 7FDRA 4B3OA 3OR2A 5J1EA 3QAEA 1FJCA 4N56A 1D9FA 4K8RA 3NKYA 4DV6J 2AGPA 1N0VC 3K8WA 2MQQA 4QU6A 1CG2A 2GJIA 2CPZA 3ZTQA 2YBVA 2R8HA 2CQ2A 3QWPA 2FJDB 1UZHA 1JQGA 4LFAF 4X4NA 2DXFA 3TVKA 5J2PA 4M5NA 2KT2A 1RKJA 2OMOA 4PXCA 5F8GA 3LW5C 4NLQA 4DCPB 3VAKA 3NOGA 2EC0A 4X4SA 3I6PA 3GB0A 2O1PA 1X5OA 2V6AA 4OZLA 1L3UA 3FKBA 4OYWA 2NUUG 2D3ZA 1JJHA 3OL7A 4Y28C 2CPFA 4B9NA 1CSJA 4U7CA 2KB2A 3QNWB 2HHQA 2KVQE 3BKTA 1AB8A 1S0MA 5KFTA 3D54A 2AIRB 4DPUA 1BMQB 1MMLA 4UQGA 3NGSA 4KSEB 3DFEA 4ILLA 2ZH1A 2HURA 4LUBA 4K7QA 2C28A 2X1FA 5KT7A 5CZVA 4W98A 2UVUA 4JI2J 4FPIA 1X9MA 3M30B 2ATCB 2HBZB 3QSYB 4M63A 1WJ9A 2CPIA 3I4HX 3DDNA 3T6JA 3TJ8A 1G6BA 3DRSB 3HHLC 3MAHA 4KGMA 2DHAA 3RG6A 3L09A 3TZYA 3NMRA 2HEKA 2P9GA 4DU7A 1A9NB 4DR4J 4S0MA 5IV3A 1IN0A 1XNRF 4ZLLA 2VG7A 4B3TF 4P2XA 5I3UB 3AFGA 2BA9A 4JI1F 2FJWA 2UXCF 4IOAQ 3KG1A 3Q24A 1ZAVA 1HR0J 1SKSA 4OX6A 2FZCB 2G0CA 1VHIA 3KUGA 3ILOA 3FZ2A 2J9EA 1GFWB 4P7TA 1UFLA 4X4RA 2GCFA 4RO0A 4J9VA 1RAOA 3I4PA 5A2QU 1QVGR 4I6YA 3UI3A 3MEEA 4WPAA 1CJKB 1BQNA 1KVKA 3BBBA 2KTQA 1MWYA 4YP3A 3N6MA 2KZZA 5MLCV 3GFXA 1SC3B 2NSBA 3PKYA 1TL3A 2M88A 2CWXA 3LALA 2CQ0A 2K3IA 1VJQA 4DL7A 5LSRA 3FFIB 2QLBB 2GMHA 4IRKA 4F25A 2CQ3A 5D4LA 1HQUB 1LWEB 5EX0A 2H51B 2YX1A 3I9V9 2YWGA 4BC9A 3KKFA 3DRPA 2BKPA 4YEAA 5FJ4A 3K5NA 4E0DA 5D15A 1SJ3P 3JS9A 5HVGA 3MURP 4IG0A 4CM0A 3PNIA 1BD6A 2DEIA 3IN5A 3DLJA 2AJ4A 3Q8PB 3PJXA 1N33J 3QJLA 1UJ5A 4H4OB 2YWWA 1SL0A 4CLFA 1T9XA 3DOKA 1HNXJ 5K20B 1R0BG 5F3ZA 1VQ8S 1B3TA 1HNIB 3RU0A 1C4CA 3MDFA 1LFWA 2W9AA 1VLYA 1QSLA 5DDOC 4OYMA 5M2RA 4QIEA 3L3CA 2A0FB 4DMZA 4JBCA 4RWWA 5B0EA 2VG5B 2A3JA 5ETSA 1NUEA 2HFNA 2WVCA 4JI2F 4U7UK 1S1VB 4DF4A 2B6AB 2M2BA 1HNVB 3PRBA 3PYDA 3CCJS 2WVDA 2EK6A 5ETNA 1WOOA 1C1BB 1U49A 3M8QA 4J9QA 2DRBA 1OPZA 2CADA 1Q82T 3W2WA 3G71S 1WKKA 5A76A 3LPYA 3LP2B 4J9KA 1U2FA 1U6FA 2GQ2A 4DPYA 1HW8A 1GXTA 4LFCJ 1TTHB 4GVLA 1UVMA 5D4PA 4HKQA 2HFZA 2KG0A 3NEKA 1XMOJ 1T8EA 2VC0A 4N47A 2CZVC 1NK6A 3K17A 1WORA 4HEA9 1HARA 4JI4F 1CJTA 5DZ6A 4TXSA 2ZFHA 1OO0B 3VQSA 3UD3P 5KFRA 1C2PA 1T7PA 2B9EA 3J80U 3VAFA 1XEZA 2NYIA 5KG2A 4QYZK 2WVBA 5IT9U 3G8TA 3HD1A 1RAGB 1XBWA 1S6OA 3B8HA 4DQSA 3T1AA 2EW9A 2E44A 4V19J 1BLUA 2DCUB 1FK9A 1N56A 5CYJA 1YRUA 2N7YA 2DXEA 3D0GE 1CQMA 3FMWA 3MWBA 1UPMB 2HHSA 1QJHA 2F63A 1U6ZA 2Y1LB 3H90A 1DFDA 1TELA 4GKJJ 2DR5A 3ZZPA 3TVYA 4DBQA 4CH7A 4D3GA 1NPKA 1FD2A 3OXGA 1RT4B 2R7RA 2J0SD 2OEJA 3OJSA 1CEZA 3VV2B 5MAOA 1D8YA 2IAJB 4CO3A 4I67A 1N5YB 2EFNA 1Q7LB 1RT6A 3NWGA 2UP1A 3MM8A 3W8PA 1DZ5A 3DXSX 2JLGA 2BZ2A 4C11B 3NGUA 1P8GA 1XERA 1LWXA 2DHXA 2MY7A 1T03A 1BGXT 4BBYA 2CA9A 5CH7B 4QIFA 3SZ2A 4ZITA 3I5CA 2LU2A 2GGPA 2QFIA 4EZ9A 4ZCIA 4X2BA 3BR8A 3OVBA 1O6XA 2RUSA 5M2PA 4A8WA 4ITSA 1HNXF 3TO8A 2MKCA 1JJ4A 1HL6A 2JRSA 2GQCA 1PYTA 2V2VA 2NXJA 5AXNA 3K58A 1TKXB 4F26A 3BH7B 3EGVA 3I96A 2NXEA 4LF6J 4PYDA 1N6QB 3ZTSA 1MG7A 1REVB 2FHMA 2ASDA 2HBYB 4FPRA 1RHRB 2NXCA 3PO5A 1NSPA 2RQKA 4JB8B 2EI5A 2HNDA 4TYAA 2OELA 4HLBA 4DUZJ 3QWUA 3V4MA 2OH2A 1D1UA 4AE5A 4XDCA 1YRXA 4C98A 4GVBB 1U1NA 2R8GA 4DSIA 4GKKF 2GJFA 3EZUA 3IP0A 2VKRA 4WTYA 2YKAA 2JFDA 5GAEI 1KLMA 2MSTA 2C2NA 3A12A 1NCLA 4X62F 1U1QA 3M1VA 3SSRA 3TUPA 2VFRA 5E3CA 2EFOA 2O5DA 2ZBRA 2RILA 1EKRA 3JSMA 4QJVA 5D3GB 3IR7B 1T9UA 4OI4A 2W2QP 3C15A 5A8KB 1SH3A 1JIHA 2N7CA 1RT2A 1WC0A 4M95A 3KLIA 2DIUA 3TJAA 4OX8A 4DU8A 2XWXA 2FTRA 3KLHB 1WHXA 1G1XA 3OL8A 1KP6A 2I5JB 2IVMA 3W65A 2X3DA 2HBRB 5U47A 3R27A 5KT6A 5DQGA 3AHPA 2AJQA 3HKZD 3M2UB 4TLQA 5EDWA 1IR1A 2HG4A 2HRYA 2CZ9A 1GX6A 5F8NA 1WG4A 3CMQA 3TP2A 1TKDA 1JB0C 2JOQA 2OLWA 2VBXA 3IO1A 5DLGA 2V2ZA 3LAMA 1VRUB 2JC0A 2DNOA 4LRAA 5GVQA 4H4MA 4NCGB 3LP1B 4ICLA 2DY9A 4TY8B 3S7RA 2IMWP 1TVRB 4LRCA 4USIA 2EKNA 2D7SA 2ZUGA 3IBCB 1P1TA 2E5IA 3M6UA 5KT5A 5KFBA 1NNDA 1PAUB 2YXLA 3OL6A 1WDDA 4LBHA 4HVZA 1UWAA 3BO3A 1G7CB 4DSKA 2OFHX 1Q5YA 3US5A 3OSPA 2WONB 2R9LA 2ALZA 3A8JA 1EHWA 4PCQA 5GMKa 4NLWA 3C66A 4PPZA 3QJJA 2HQIA 5KT3A 4ECRA 4C48A 2CPJA 3KJNB 3W5XA 1I94J 3NGDA 1MW7A 4FBTA 1R6YA 3KUEA 4C4WA 4K50A 3VGUA 4PQAA 4L3KA 3RRHA 4DUZF 3IG1A 1JXLA 4QR2A 5KFUA 1U24A 5KFLA 3I0SB 3CJQA 1GTEA 4DQRA 3CTRA 1IR0A 1S1WA 1TU0B 5IT4A 5AE3A 4NRTA 3K2YA 1XTZA 1KBRA 5E2QA 2BMBA 1X31C 3MEDA 2LDIA 4A8KA 2D3UA 4I6AA 3VALA 2BJ3A 4HACB 5E3RA 2C2RA 1EETB 1WC6A 3DI6B 4OI3A 1C1CB 4CIOA 4USTA 4DQQA 2XYPB 2A10A 3LQVA 2UZAA 3PX4A 4WXWA 2UUTA 1FO1A 3W5YA 2C2EA 1NZ8A 1MMNA 2DNGA 1Q5VA 2Q66A 1YJUA 1NSQA 1JLAA 3H5SA 3Q8VA 4K4TA 2P6TA 3S8SA 1Q7YT 2Z56B 1RLDA 4B9TA 2G0JA 3WC2A 4J7CA 3MPWA 4M5DA 4RW8B 5KFOA 1KEKA 2LA4A 4MIBA 3T3FA 1RHUB 1FKPB 1HI1A 4Y00A 3F73A 1LW0A 3IAM9 1EQMA 3PVXA 3Q89A 3Q8YA 3R97A 3KOAA 2YPZA 3ITHA 1NKBA 4KO0B 4JV0A 4RW9A 1S77D 3A3NB 1MSWD 3AT1B 2AGOA 4LF8F 4FYDA 4FXDA 3CCWA 1P1LA 3ZZYA 3Q8SB 3A1YG 1RWMB 2VKZG 3R5BA 1WOPA 2EPIA 2V69A 3CJKA 2AEMA 4KR0B 4P10A 2V8GA 1X5PA 1VIOA 2C3PA 5D0RA 5ETVA 3CJSA 1JLEA 4K59A 3NNHA 3I5BA 4OHWA 1IBCB 5J2NA 5HQ8A 2RKIB 1RTDA 1HFEL 2V67A 1KQKA 1M5VC 1HPZB 3MI7X 1KFSA 3R5JB 1EP4A 3G9CA 5KFVA 2YQ3A 3THVA 2BVZA 3LAKA 3BYRA 2MKKA 3KTQA 2B56A 4CT8A 5CQGA 1R0CB 3U1LA 4DZDA 3FBBA 2R7UA 2VOOA 1W2IA 2FLNA 1SKUB 2W7AA 3EMTA 3M32A 1RHJB 4N41A 1U2RA 4DV5J 3G82A 4X64F 2KRBA 3TVZA 1FRXA 3IRXB 1HBNA 1HI8A 2X7IA 2HLUA 1HBMA 1S1UA 5AJ3F 2F4FA 3SQGB 1BXNA 4BLGA 5CAAA 1BQMB 1FCAA 3TA1A 2YNFB 2E5LJ 5A6WA 4OZ5A 4NRUA 2CQCA 3KHRA 1TV6A 3AXMA 3JAMY 1VQ7S 1Z1ZA 3KJVA 3D66A 1HYSA 3SFGA 3OFFA 3W64A 3I5AA 1F5AA 1YZ7A 1QTNB 4AD6A 4IR9A 4KB7A 2H5IB 4DX6A 1IR2A 4CH1A 3HT3A 1RAIB 1VLOA 1Y9OA 4ED0A 4ECYA 1CS4B 3JB9k 3BYPA 2DD8S 3JSYA 3ET6B 2YKMB 1UP1A 2PC6A 4Q2MA 3DOLB 3PYEA 2APOA 1FJGJ 3EPGA 4CO1A 3R2CJ 3PHEA 3NOCA 4MYTA 2B0GA 3FQKA 1U6BA 1LWCA 1MLAA 3NCQA 4DCOB 2W7PA 3MEGB 2HQFA 4IG3A 1FFGB 2AD9A 2JDJA 4LF5J 3GE9A 4NXMF 1UVJA 4KAIA 3FBEA 2Z2YB 1VFJA 2IVFB 1LXJA 2XYGB 2XS7A 1QAIA 4N8NA 5K8MA 4CLTA 2NZ4A 4QR0A 1R8BA 4CWBA 1Y3JA 4CO5A 1SPBP 4ZPBA 2O01C 3D3BJ 3CD6S 2V0NA 4FNHA 3ADAC 5IOLA 1ZM2A 1B7YB 1PAEX 2RQ4A 4YQWA 4O3NA 5BR8F 3GONA 2ZHAA 2WAQD 2J8AA 2V63A 5EWFA 4O3PA 3POTB 2WZ1A 3UWTA 4NCBA 3C3LA 4XPCA 3D6TB 4MFBA 5JXSA 4NLRA 3P5TL 4C3MA 4G1QB 3W63A 2VBWA 3UCUP 5C2CA 5KFCA 3AJDA 2VPXB 3L7PA 4RNNA 1DTTA 3H25A 1NKEA 3GV5B 2HGNA 4URSA 4O4GB 3BJYA 4P52A 1TFWA 4USVA 2Z2ZA 3PIOQ 3HHDA 2Y8YA 1WSVA 3KK2B 4DR3F 3CW2C 1YBAA 5CD4H 5A8WB 2ZE2B 5DETA 3AODA 1V9OA 1UTAA 2CUYA 5J2QA 2BR0A 3MMCA 4M5JA 4WKRA 5CD4A 2VJVA 1AFIA 4GO7X 4B02A 1QTMA 5EN1A 4RLEA 3WIVA 1M1KT 4Y65A 4IFYA 3M8PB 2P5VA 5CXTA 1RK8A 3PW7A 1VBKA 5HATA 3ZZ0A 2DGXA 1NK7A 2GVDB 3TARA 1NDPA 4UT4A 4PAAA 2K8GA 5HLFA 2FLPA 1NJZA 1RWOB 2G9OA 3UVJA 2KRRA 3CT9A 4K4UA 2O67A 1FD8A 1H2UX 1T9TA 3F0NA 4B3OB 1Q0NA 2QX0A 5LMNJ 3OR2B 1PCAA 3KWMA 2PT0A 2C1EB 1FWLA 2ZZMA 2ROEA 5KFDA 4LVNP 2IIHA 3OUYB 1S0NA 2ZNZA 4OX9F 3ZTOA 4NEZA 1B70B 3J7A1 2XGQA 2UU9F 3FQLA 2D3OR 4BS2A 3DGVA 3GR1A 3KHGA 1FJGF 2IA6A 1N5QA 1YVFA 2FLOA 1UVIA 1ULRA 4LREA 3GG0A 3MD1A 3MM6B 4LF5F 2NXUA 2WHOA 2RRAA 1D9DA 2WBRA 2G2OA 2BQRA 4TU9A 1HHSA 3WDOA 5DGBA 3BSAA 2R7VA 2B9YA 1LK7A 4V19X 5AE1A 4LF2A 3ZTPA 2VC1A 1S79A 4UUWA 5CYQA 4F0HA 1J5OA 3HHEA 2CNNB 1HW9A 1N48A 2OKQA 3PKMA 2W9BA 2MQ8A 3DRYA 3MGJA 2G2ZA 2VQEF 2HPUA 1Y4ZB 3WQPA 2XHCA 2XMVA 3VZHA 3D6MB 2R7WA 3ONQA 1NK0A 2VD3A 1IM6A 1I5OB 2GNKA 5G0RB 2JH3A 4TVAB 4YR0A 3QAUA 4K2XA 4BWMA 3GTYX 4WE1A 2DNMA 1IM4A 1TP7A 4PG7A 3ISZA 5L46A 4OZNA 2Z2LA 5K5MA 2WSFC 2DNNA 5A8RA 3HP6A 3K57A 2LQ8A 2ACMA 3BBFA 2C3UA 1R0AB 3X1LB 2BRKA 4ECTA 3KLFA 1QSYA 5B0FA 3D1HA 2ZBQA 1RTJA 1RT3A 4USUA 4IQMA 5HANA 5C25A 3QGPA 3CJ3A 5FDLB 4IOCQ 1Y00A 1RT7B 4Q8EA 3VHQA 1X0FA 4WIIA 5B0DA 2HGLA 2I1RA 4NLDA 2AJFE 3RW6A 2BM1A 4NLXA 5L9NA 4Y3CA 4F67A 2DPIA 4MYUA 4OI2A 2AJ2A 2R7QA 2GHPA 1VQMS 2ZJQQ 1IKWA 4NMXA 2RRNA 3JSRA 2CPEA 3MEEB 2BDPA 2FJEB 1BQNB 2CJXB 3JYTB 4KQZA 3MCOA 4XDDA 2ZJRQ 1XNQJ 1JLCA 2BABA 2PI4A 5LMNF 1KWMA 2J8SA 1VIXA 1ELOA 4LSNA 2BQUA 1X4HA 2OGUA 2DRDA 5KFXA 4ZJLA 2HZVA 4RNHA 1RHQB 1Q95G 3MM9A 1NJWA 4K0KJ 2H48B 4AL5A 2ZBCA 1FF2A 3H4DA 4ZP9A 2AWZA 2MQNA 2KH9A 1RA7A 3M2RB 1E6YA 4IO9Q 5IWAF 2QYGA 4NYZA 3W5ZA 4JI6J 2VB6A 1DQ8A 1NSAA 2BE9B 2DNYA 1T05B 2B9WA 3I87A 3DRXA 2LXIA 3ILJA 2LEPA 4IG0B 2V4JB 2I6WA 4NA2A 1V6HA 4ED1A 2YX4A 1YJ9S 2IFXA 3PYGA 1YKWA 4LBIA 3QYYA 2ZKUA 3CD7A 1H74A 2DHSA 1R6VA 3IXQA 5CCLA 4W92B 2J7KA 2DO0A 1X60A 1RB0A 4CM2A 1UEKA 1RYRA 1ZM4A 2KHCA 2R2UA 3HSZA 4X66F 3PW4A 2ZWPA 3QPIA 3GG1A 3W9JA 4F3MA 1IKVA 3HVWA 1G3OA 4IH5A 4CT9A 5KAKA 3KLGA 1W7WA 2IPOB 2FHKA 1QE1B 1N36J 3C6TA 1JXEA 1WELA 4OHXA 3S1TA 1RBOB 1ACMB 3JSBA 3N4WA 4KHPF 4J9MA 4O44A 5D8HB 1LW2A 1C0UB 3OXFA 3C8YA 1CJVA 3NS6A 3M8QB 3NP5A 3VAIA 5T41A 1ZYQA 4AUKA 4F7VA 3SQOP 2FUG9 1Z4UA 2DITA 5KG7A 1VK8A 1KONA 3IC1A 3J7ZT 2R7SA 2ZM6F 4MJKA 3BGOP 4KKOA 3ZFVA 1MMDA 3CCZA 3N28A 4DV7F 2ZDOA 1VQ5S 1RJJA 4TNOA 1MN9A 3KMSA 1CJTB 2LQJA 1G4CA 2QLJB 1Q16B 4CO0A 4WZQA 4IUFA 2QRRA 4QCLA 1OYDA 3HVTA 1S9GA 2A2DA 4ANDA 1WF0A 4OZ3A 6AT1B 1LWFA 3QRPA 4ECVA 3HJVA 2XSJA 4KYZA 3ZC4A 4P2FA 2F8EX 1FK9B 4A8QA 4ZKAA 3OL9A 1BE4A 1NRKA 5F8HA 3PACA 3NG8A 2MGZB 3MR5A 1NLKL 4G6VB 2HWTA 2QLXA 1DARA 3JAMU 2QLFB 1F9EB 1WD6A 2UUAJ 2WB1D 3FNNA 3VQTA 4CZCA 2XBPA 3NRBA 3H2LA 4DF8A 2X1GA 5I4MA 2Y3YA 2ZC3A 4DQPA 4DV3J 5KG5A 1ITPA 1VQYA 4L73A 4FP9A 4WU3A 1RT6B 2UUWA 1TZ0A 1U02A 4P71A 4PWWA 3SMZA 2ZITA 1XR5A 1KOOA 1OQ3A 3BM7A 3LO3A 2GGPB 4ZPWR 1ZPVA 4C8LA 5KFGA 4CLWA 3GZ7A 5L1IA 2V8HA 2NPFA 2W2NP 4JI7F 2MLYA 1MN7A 4ZLJA 1WKJA 3MPYA 3CJ0A 4I2QB 4H4KA 3N5BA 3QZ8A 2WSCC 1UMJA 2YNHA 1VQ9S 1YI2S 4ZS6A 2CRLA 3N6NA 3DMJA 3PW5A 1RDRA 4JI8F 5F9LA 1M1GA 4Z37A 3OTOF 1TMMA 5HMWA 3ZZTA 4J90A 2KM8B 2KI2A 5KFHA 1SV5B 1QDUB 1VBZA 2XMKA 1PJ5A 2H1YA 4B3RF 1UCNA 5F41A 4A8XA 1RGVA 3D2WA 1WG1A 1FWKA 3E8OA 4LRBA 2MB0B 5BYRA 1KLMB 2HZAA 3GSIA 3M1VB 1SUQB 2MQLA 4Y2CA 5EGYA 1KS2A 3N01A 2QA4G 4RUAA 3K0JA 3T1YF 5CYMB 2AKWB 4CLSA 2KU7A 3G96A 3JSMB 5HJXA 2YNGA 3C15B 3A8EA 1T9VA 1B99A 3HXMA 1RT2B 3FJ2A 3M9MB 3GJTB 4UY85 3B82A 4ZVFA 5HMZA 3DNCA 3ZTRA 4DX8H 1RLCL 3QT7A 2UXBF 1HKAA 3LH2S 4PXBA 1WOSA 1RZMA 3VZIA 2FGCA 1VBXA 3WX8A 5KFSA 2IJFA 3DHWC 3C19A 1XR6A 2VV5A 4ENOA 4B17A 3UN3A 5J2MB 5HJYA 3AB2B 3MMBB 4F02A 2UXDJ 3BBCA 1S76D 1RCOB 1PYSB 1HQ2A 4X65F 1K44A 1FRIA 2F8MA 4ER8A 2R7OA 3DRRA 1ZZFA 3CXCR 2J9CA 3CCES 1RQ0A 4XAKA 1UEVA 2E7WA 1Y0HA 1CJUB 3H4BA 2CPDA 3N5FA 1JLGA 1RT5A 1TL1B 3PTWA 1CBKA 4LJMA 3DYAB 3UN2A 2PA8D 2BKOA 4H4MB 5KFFA 1QUPA 1YGYA 2HRUA 3UR3C 5F0UA 5K14A 2EWHA 2GAHC 5EX3A 2HHUA 4ZVEA 2M9KA 1RBLA 4JI5F 2Y1IA 5T7LA 1T02A 3Q86A 2GIFA 4O3OA 2IYIA 1S6QB 4I0WA 3NGTA 3M8WA 4UUXA 3IGVA 4RBTA 1GNKA 3VCDA 5HP1A 3MR7A 1YJ7A 1FI4A 4DFKA 2D74B 3QFHA 3Q2SC 1X7VA 4URGA 4J5OA 3MR6A 5H9EK 1FDAA 2E1AA 1U4BA 2DJWA 2YPYA 1HNZF 4HHUA 4UOHA 2MLZA 2IM3A 3IG1B 2I0XA 1RACB 3CCSS 1T11A 1NH7A 4EUVA 2E5GA 5A0YA 3X3UA 1J5EF 3DLGA 4LMZA 1NK4A 1BUXA 1SBRA 3C14A 4KT0C 4EBCA 1R8CA 1DLOB 2CAJA 2DY1A 1FKAF 3CC4S 3HHKA 3FBCA 2JVOA 2XNRA 1NDCA 2CFXA 3PM9A 2E7VA 1X4GA 5M2UA 2FJVA 1KN6A 4ETZA 1FRMA 2AYGA 1DBDA 3VF0B 4LF7F 2OAUA 3ZNJ1 1IKXB 2GMJA 3D0HE 2RH3A 1K8AT 2OPPA 4I7FA 1M5SA 3VGVA 3MPUB 2QE5A 4CTAA 1WF2A 5ITHA 2OPQB 3C6UA 4M8LA 1T3OA 1X4DA 2RRBA 1JNZB 1YJNS 1JLAB 3UD5A 1FHTA 1UPPA 1WI8A 4AQYJ 2XMWA 4DSLA 2ZH9A 1FFSB 3PCOB 2GVZA 1SH0A 2OMLA 3IWXA 1HHTP 1VQLS 3QIPA 1F9FA 1KFDA 2JEIA 3IM8A 3KK1A 3CE8A 3UW1A 3EGZA 2CWKA 5C24B 4R5PB 4DR7F 4JV5F 2VQFJ 1REGX 1S9EA 1YQHA 1NPPA 2BOPA 4QW8A 4IKAA 1RHMB 4CLUA 4DUYF 7AT1B 2EVZA 1NPRA 5H9FK 1FX4A 1FNXH 5HBMA 1JLBB 3GV7B 1SB6A 2OIHA 2GW8A 2J0XA 5LJ5Y 5HROB 4Z7YA 4WK1A 5JUMA 1E6VA 4X4QA 1FKOA 3CJKB 3RUBL 4L74A 3MD3A 1O51A 1WWHA 3MUTP 2WTFA 1OSDA 1UWBA 3B54A 4QIWD 2ABYA 1JLEB 4PABA 5T14A 1HBOA 1UETA 3TUIC 4HT5A 3M2VA 1RTDB 2MMYA 2WVFA 3MAAA 2OTLS 1FXRA 1ZETA 1TL5A 2JVRA 1EP4B 4FS2A 4F4AA 4TQRA 3HD2A 3HO1A 3W9IA 4A48A 4CP5A 1U1OA 4H4KC 3ZO7A 2MSSA 4LQ9A 3Q8RB 5EUHA 1U09A 5JVHQ 4LF9F 3JQJA 3B6BA 1OY6A 4YY3F 2JLFA 2HS4A 1KKHA 3HCXA 2H4WB 5GMDA 2R7TA 3GIJA 1FJEB 8AT1B 1KQFB 4OI1A 4EK2A 1XMQJ 3FK4A 2CNOB 4F0KA 3W8GA 3MR3A 3TEGA 3V81B 4HI1A 1NKCA 4ED8A 3FC9A 2VA3A 1S1UB 3M9NB 1H7WA 2F9DA 5JVGQ 3T9ZA 1IBLJ 1TV6B 1TAQA 2KXHA 3HI9A 1RCXB 5B08A 4XTTA 2CVEA 1HYSB 3IR5B 3O5TB 3VWSA 2MHEA 4C97A 3CDAA 1TFYA 1ZZNA 1FE0A 5DM6Q 3HLUA 3HFKA 1KD1T 4WBFA 2ZDPA 4QOTA 2V8VA 1EKSA 4XK8C 4YR3A 1JNRB 2VPZB 2FVPA 2A6MA 3MCSA 1DURA 4JV2A 3MECB 4X4VA 3J7YI 4X4OA 1HIYA 4PZVA 4RPFA 3DRSA 4C8MA 3NS7B 2IC3B 1VI7A 3CCTA 3NNCA 4DV1F 9ATCB 4IFVB 3H5YA 2GO8A 3CDBA 3I56S 2E1PA 3OJUA 2NS1B 5I3UA 1NB7A 4UW2A 5I42B 3GILA 5SZTA 3CJ5A 4DFJA 1SVDA 4Y6IA 1WTFA 4MK7A 4PQUB 4IYQA 3HZGA 5F3TA 1BWVA 4ZN3A 2MPUA 3ZNUA 2DVIA 2E1RA 1S1XB 3UDLA 2ZOMA 3BN7A 1ZS6A 1GEHA 1D09B 1BHNA 1XWLA 4CLYA 1CJKA 2H5JB 4DV0F 4MFBB 4USHA 3EZ5A 1WEXA 3OXLA 3E01A 5DJBA 4JI0J 4ILMA 2YWHA 1QAXA 3FGVA 2LECA 1HWUA 2LMIA 3CC2S 4ECWA 3KHLA 4OHYA 3C46A 4DSJA 2GV1A 1V3RA 2LU1A 3FFIA 3LGHA 1S6PB 4DG1A 4P74A 1QLNA 1HQUA 1S9FA 1I51B 5KFWA 2KG1A 3PRVA 2RDIA 3H8YA 2KDOA 5F8LA 4NMLA 3IRWP 1YLXA 2LCWA 2G2YA 2P6SA 2VH7A 1XC9A 3VVUA 2F40A 3WIUA 2AYBA 2PIIA 1FRHA 1FA0A 4QBUA 3QJPA 2ZBIA 4ECXA 4N8OA 2JEJA 4F2RA 3BDEA 2C2ZB 2EBGA 1GAOA 1Y7PA 3PEJA 4DR1F 4DX5A 1GTHA 1HNIA 4LT6A 4I68A 1YRTA 2C2OB 2Z0GA 2Q43A 4MKYA 1IUJA 2F4VF 2KYZA 1D9AA 3MHYA 3KXDA 2ZVSA 2W25A 1TL7B 3H42A 3KDNA 3FZBA 3FEYB 3P96A 3G87A 4DV2J 2J7UA 3IMQJ 2KN4A 3KNGA 3P6YC 1ZAWA 2YTCA 2M4MA 2VG5A 1WEYA 3A13A 3UDVA 1S97A 1S1VA 5CABA 2HMIA 1XIQA 2B6AA 4PKDB 3SDEB 2HZCA 3R6GB 3EZOA 2Y1JA 2FJAB 2KJWA 3DLEB 5KOXA 1D3WA 3D3CJ 1R8HA 1VJWA 1UA0A 1SKWA 3LP2A 1RTHA 2WVEA 2B4PA 4CDIA 4B9UA 3FUYA 3S6EA 5L1KA 2YY3A 1HMVB 1MROA 4X84A 1IJFB 4U7UD 1R43A 1RBAA 2DISA 3J81Y 1B64A 2V34A 4C8OA 3CDUA 1FRJA 3ZXWA 2U2FA 2K06A 2ILYA 2ILZA 2F1FA 2FVRA 2UVWA 3LGNA 2J9DE 1P9YA 1U25A 4WP3A 3AA8A 1AUSL 3G8SA 1CLFA 2OPRB 4UZCA 2ZH2A 5BJRA 5A8RB 3PY8A 4LSLB 3JTOA 5HMXA 3DOMA 3U7JA 3UCZP 4L76A 4XO0A 3UDEA 1VQOS 4LQ3A 1K1SA 1SCJB 2KXNB 3RBEA 4WIQA 4HT7A 2F5GA 1RT4A 1RTJB 2HVDA 1ZA2B 1DQAA 3MM7A 5KG1A 3EDQB 1O0PA 2HNZB 3BQ0A 2IAJA 2F9JA 5C25B 1U8WA 3P4UB 1U0HB 4LFBJ 4I6WA 4B9VA 4RUHA 1ZOTA 2R3VA 2J76E 2E5JA 5HVHA 1GMWA 4KV8A 1XJWB 4C11A 2BV3A 1HNWF 4KGXB 3QGIA 2AJ1A 3CC7S 4DXLA 4JI3J 5D4OA 3T5LA 3AA9A 4WFYA 2HYIB 2UUBF 3K5LA 3GFHA 4RW6B 1HWKA 2YH1A 2BXJA 1IKWB 3BS9A 5GAHU 1WC3A 3I32A 2L9DA 1H7XA 4WK3A 4F4XA 2C2DA 2CJAA 2KO1A 2HRTA 3Q8UA 1FEHA 4DV6F 4WYWA 4HH0A 2JEFA 2FC9A 2HIYA 2CNLB 1SKRA 1TKXA 4CLZA 1JLCB 1VISA 2MZSA 1R27B 4PWDB 4LSNB 4Q44A 1REVA 4PPDA 4G3IA 3KDOA 1KVJA 3M05A 3UNYA 5DGAA 2YWKA 5LSOA 4PUOB 3OLBA 4NI2A 4KJIA 4ZOSA 1GXUA 5EWGA 1LKZA 2QIFA 2CYYA 4NLGA 5KFZA 4DV4J 1GH8A 1K1QA 1RTIB 4GVBA 2HVEA 3PJ9A 4U8YA 4OJHA 3KK3A 3M4XA 2IRXA 4UZBA 2CQPA 3JQMA 3F44A 4CH0S 3ZZUA 2EFGA 1K9MT 2DK2A 3DXBA 2A2CA 3LP0B 4NLSA 1N52B 3T9NA 4Y2AA 2RIJA 3R6LB 2C3MA 2UV8G 5D3GA 4WP8A 2QJ3A 2V4RA 2VG6B 4QIVA 4YDDB 3QIDA 1IVZA 3ISNC 4F4ZA 5DDRC 1UA1A 1AA1B 2KKHA 1IKVB 1L3KA 4KH1B 2RF2B 4B9LA 1TKTB 5B0AA 2CPHA 2ATLA 1Q81T 2HFUA 2GHWA 4QR1A 4DR4F 1TKZA 2DGVA 2UV8A 3C6TB 2G4BA 3DM2A 3CDWA 3NMAA 2HHTA 3C16B 4B3SJ 3M2UA 4EO8A 3GYGA 3OVAA 1HR0F 4ZPTR 4DL5A 5KFNA 4ID5B 5BXIA 2NUHA 2MJNA 2E9ZA 1IBKJ 5HSPA 3N9UC 5GAHI 1OSCA 1T0TV 1VRUA 2OHDA 1XK8A 3K5PA 3MTKA 3P5BP 1SH2A 2WCXA 2DHGA 5IZHA 1SIWB 4F3QA 1A0OB 2IJRA 2QYCA 2YQ0A 3NGRA 4JV1A 5KFMA 2LA6A 1DTQA 1SL2A 2K3KA 4CYUA 1S5ZA 3HVTB 2XWYA 3V4IA 1S9GB 1IBMJ 2RT3A 4KGVB 1LWFB 2WONA 1N5TA 1FDDA 2XSJB 1KC8T 2HAFA 3GCWP 1DY3A 3DLLQ 1FESA 5IC6B 4D3HA 2D41A 4ZK7M 4KHRA 3P3DA 4WJBA 1S7IA 3RRKA 2Q3PA 1U1RA 1R3NA 4CRJA 3A3OB 2XS2A 3AD9C 1N33F 3HULA 2W4PA 1SJ4P 4RL1A 3D1OA 2CJKA 2ADCA 4OQJA 3EVMA 1SJFA 3IWNC 1LOUA 2V50A 1X4CA 2IA0A 3SI8A 2VU5A 1L3SA 2XCPA 5LSLA 3UO0A 1HWJA 1NXIA 2Q79A 3W2VB 4I1TA 4IH6A 5E7OB 1U0SA 2YNIB 1D0EA 4ES2A 3JQKA 1WC5A 1G2EA 3G2XA 4IR1A 4DSEA 4ECZA 4DR5J 2YNHB 3GIMA 4N7TA 5BYQA 4NLYA 2BEFA 4RW7B 1KQGB 3AOCA 4K5SA 4KFBA 1R89A 2QMXA 3TAMB 4RW4B 3KHHA 4J9UE 4ERDA 1WSRA 3UQSA 4BC7A 4YHHJ 3NBPB 1VMBA 5SUHA 2BANA 2IRYA 3V6JA 3QT5A 1YITS 3OLAA 4LFCF 3RBDA 1N34J 3R8YA 3PYFA 1XMOF 4RNFA 2IY5B 1NB2A 4ZPAA 3W60A 2FQQB 1IBKF 3KFWX 3M6XA 1H38A 3BO2A 4YB7A 1I6JA 4TQSA 3P49B 2FYXA 3D1QA 3V6DA 3ILIA 1RABB 5KG3A 2Z30B 1O5JA 1UW9A 2YKOA 4HI2A 2YNGB 4R8UB 2MLXA 2QT7A 1YZ6A 4YB5A 4TYBA 1JLFB 1Q8IA 4JYAJ 5E0OA 4KHMA 3EDRB 2BE2B 2DH7A 4ZVRB 1VQKS 4MK9A 2VFTA 2VFUA 4OV1A 3QLHB 3CWJA 2C2KB 4GKJF 5AXLA 1Q79A 1KLNA 3EVWA 3W61A 3FCHA 2WRMA 3AXKA 1VCTA 1S99A 3MUVP 3CNQP 1RUSA 4NCAA 4PRFA 3K59A 3CULA 4B3MJ 4PG8A 4ZVPB 3PX6A 2HQ3A 1S1TB 1HPZA 2FVQA 3NL0A 1EARA 2R8IA 5GAGU 2V94A 2ZOGA 5ETQA 1HQEA 5DM7Q 3OD2A 1WF1A 2QSFA 3IS9B 5AE2A 2JFKA 1RSCA 5HN0A 3K5MA 2ZNYA 2XMJA 2V9WA 4J37A 4NXNJ 1JLGB 4RUBA 2W4CA 4YOEA 4N77A 2V4QA 4I2PA 5LMUJ 3Q23A 2FGOA 4X4PA 1OYEA 1XR7A 1V3ZA 5IQQA 4P73A 3BSCA 2XS5A 2H54B 2D9PA 1VBYA 5K14B 2XEXA 1X9WA 4FYXB 4HR2A 1ROFA 1WACA 2GFFA 2EG1A 5IT9Y 3UE2A 3IRXA 4LF6F 3TQEA 4ECSA 1CULA 4NASA 5T7LB 2Z8QA 5DG9A 3OTEA 5BYSA 3SQGA 1CC7A 3CVKA 1AXQA 2ZD1B 2YNFA 2VPWB 2E29A 2B5JB 3H98A 2HHHJ 5HVFA 1CC8A 4R25A 5HP1B 2AMCB 4MIAA 4GC6A 1WEZA 4WFAQ 4ZP8A 5F0WA 3J81U 1H6KX 2ZKTA 1WI6A 2HK3A 3OQ2A 2HW3A 2FVSA 2OUGA 1IXKA 2DHHA 1CS4A 2JL9A 4A8OA 3BPDA 2FHJD 1M0SA 3W66A 2AQ4A 1UKUA 3ET6A 2YKMA 2IM1A 4ED5A 3DOLA 2EBEA 5J1NA 3C14B 4IDKB 1TUVA 3HFVA 5GADU 4LFAJ 2XMUA 4ILRA 2GC8A 3MEGA 3D0IE 2VIHA 2VF3A 4KPYA 2FC8A 1W26A 3T19A 3NY0A 2AW0A 2V5HG 1W25A 1IKYA 4O3SA 4WFZA 3CJ8A 2N4DA 3TZZA 1YWXA 4I7FB 1S4FA 3MMJA 3PRDA 4K4XA 1V3SA 4CTAB 5AXKA 4OI6A 3R5AA 1PJ7A 2JZ5A 2GMLA 4YB6A 5GAGI 2HQGA 4E2FB 4C8NA 2OFGX 4P2MA 2EKYA 4QW9A 5ETLA 2KVIA 2VUGA 3EICA 2XM3A 3HHNB 3BQ1A 2D1CA 5J1PA 2HWHA 1VK3A 2UVRA 1IJEB 1P27B 4A8SA 3HMJG 3PEHA 1IQZA 3QO9A 1DJ0A 2DNPA 2W1BA 2LKZA 2W4DA 2BW7A 1S59A 2LQ5A 3OR1B 2G0IA 2G1DA 2CQBA 3BO4A 1JLQA 4LRDA 3M6WA 4O4GA 5IFMA 3R3TA 2XB2D 2J0QD 2KHDA 2PEBA 3PR4A 1MU2A 4IQXA 2DTJA 2RAQA 3NLCA 4OJ3A 4B08A 4CNYA 1YJRA 1XNRJ 4B3TJ 3SFUA 3HHLB 4ZHRA 5A8WA 4JI1J 4PG6A 1H3DA 2UXCJ 4WU2A 2L41A 1U48A 3W9HA 2BJ1A 1QAJA 4LVOP 1FKOB 3M8PA 3TUJC 1I94F 2QTWA 2W01A 8RUCA 2CJBA 5I3PA 2RSQA 2JSXA 2F7VA 3TANA 5CA5A 3T6BA 3MCNA 2GVDA 2XZTB 2Z2MA 3EYZA 3PZPA 5KOWA 2DNHA 2IMOA 3HZEA 4ED6A 3BGUA 2HKEA 3QGHA 3P8BB 3MAAB 4OYPA 2HK2A 2IHR1 1I1GA 3OTCA 1NK5A 3G8QA 3OUYA 2EG2A 5DLFA 4YFUA 1RE1B 4Q5VA 1JKHB 5FLXY 3BDPA 4C3LA 4AL6A 2QL7B 2MXYA 1SC4B 1WTBA 4FYVB 3GV8B 2PFDA 3CDEA 6FDRA 2RQCA 4KBIA 2Y9HA 3NGKA 1VQ6S 1DAXA 2D9OA 2B9XA 4AL7A 4UOGA 2CQGA 2L08A 3MM6A 3G4SS 2RMLA 1B4SA 2LQ9A 3SCJE 1RISA 2B43A 2YWEA 4DX7A 5HI7A 4DL6A 4LF4J 2GA7A 1U45A 2CQ4A 4K4ZA 3EGWB 5KFAA 3TZWA 2MKYA 3SXLA 4DLGA 2HQCA 3AB4B 1FXLA 1SQEA 4X4TA 3CIMA 3TAQA 3LWMA 1UZDA 3TI0A 4Y2MA 1VGYA 1YHQS 1PC4A 2D69A 2A1BA 5G0RA 1H73A 2E9TA 2J7WA 5AXMA 2J5AA 1SC6A 4RNMA 1Y5IB 5DDQC 3IM9A 3QZ7A 4AXJA 1UJ6A 3KYLA 4AFFA 2B7CB 3H7HB 3M9OB 2Y1RI 1FWPA 2COLA 3AJ1A 2VHGA 2XO6A 2W8LA 4M5MA 3R7BB 3TYTA 2PGCA 1R0AA 2ZVIA 3DLKA 5RUBA 2DGOA 2K2PA 3BN4A 4G65A 2QG9B 4QWDA 1HBUB 2NPIA 3GIRA 4EMDA 4HL9A 3UFCX 3NCPA 5FDLA 3HSDA 5IS2A 2DRAA 1C0TA 1RU1A 2WOMA 3RTVA 4DCJB 5L9XA 1GK8A 1P9QC 1RT7A 2C3YA 3K5OA 3TX8A 3RRGA 2A6OA 1F5CA 1X5TA 2JJ4D 4MIWA 2Q1LA 3HVAA 4OZJA 4JI4J 1X8DA 3EGNA 3TJ9A 3ZZOA 4Z2XA 2PDAA 1JMTA 1S0VA 5KFYA 4DWIA 3JYTA 1F2GA 1TK5A 1FRLA 4EI2A 3R5DA 3I0RB 2XC9A 4RU2A 2MZJA 3E01B 3OSNA 1F1BB 3RJMB 1S4EA 5C2GA 1Q78A 4ANEA 2OEKA 5IM0B 1WNEA 4DV5F 1FDBA 5CHCB 4OIXA 3UPFA 4XPEA 1UAWA 3GU0A 4DG1B 2NREA 3MF5A 3M2RA 1ZM3A 4LBPA 4FVMA 2XCAA 5HL7Q 4FF4A 2E5LF 3RR7A 3MMAA 1T05A 1EQ0A 3A8IA 2CJQA 1S57A 2IBOA 2V4JA 3DLHA 5DS7A 3OTDA 2RHQB 4ELVA 4LF4F 1F6TA 2GHVC 2W24A 1ZAXA 1U1LA 4Q0BB 2XI3A 4LR9A 5J1EB 1EX8A 4CQ1A 2FHJA 2GIRA 2LEAA 1AZSA 4M1KA 2ZH6A 4F2SA 2HIQA 4AT1B 4K5RA 1X4AA 3LA0A 4NEYA 3MFIA 5FIIA 3EXCX 3THTA 3PDNA 2WW4A 3MAQA 2J6UA 1VC5A 4DPWA 2E1MC 5J2PB 3GR0A 5K8OA 3KG0A 3TA2A 4PXDA 4NLPA 2WSEC 1QE1A 1U7LA 2LFVA 3UR0A 1NEEA 2HMIB 3TX0A 4O0NA 3MPVA 1LNQA 1X4BA 1C0UA 2DGTA 2J6TA 3RR8A 2IDLA 1VQNS 3BSOA 2MZRA 4GKKJ 3G6XA 4FYYB 3QFWA 2KYXA 3EXYA 1NU4A 2JWNA 1RTHB 4QWCA 4X62J 2KFYA 4C8ZA 2CQDA 1GT8A 4RKUC 3T5KA 1R7IA 4DFMA 3SEOA 1MROB 3D6FB 3ZZZA 4UQTA 4K2JA 1GMUA 2MQOA 4OYIA 4IRCA 1HD1A 1ZM9A 3ENQA 5GAEU 3KG4A 2PMHA 4ZVHA 5IXUA 4DL3A 2ZBPA 2X1AA 3NAHA 2EK1A 2AYMA 1LK5A 1KTQA 2VPYB 4OYBA 3BGRA 2CJ9A 1NSKL 3DN9A 2HS0A 4E8UA 3RGIA 1OWXA 3AD8C 1VS3A 2VBYA 2MGZA 2VG7B 3DOMB 4LF1A 2MTLA 5ETPA 4MKBA 3TAPA 3VR1A 1YBTA 4IO1A 5KFEA
chains in the Genus database with same CATH topology
3OFHA 4QIGA 1WHVA 1JLEA 4K59A 2LXUA 2ZC4A 5D4NA 2YWHA 2MYFA 3NNHA 4ZDNA 3SCKE 1QAXA 4TLRA 2H9ZA 3FGVA 3I5BA 4ZLPA 2FPHX 2LECA 4OHWA 5J2NA 5HQ8A 1HWUA 1KTVA 2LMIA 2OPSB 5FD1A 3SCLE 3CC2S 4ECWA 1LQ9A 2RKIB 3MM7B 3Q22A 1RTDA 4IOBA 3KHLA 4OHYA 4C8YA 1HFEL 5B7WA 1VHFA 3C46A 4DSJA 1KQKA 2GV1A 1V3RA 2LU1A 3FFIA 4LIRA 3TNVA 2ZH7A 3OFEA 3D28A 1S6PB 1M5VC 5CZXA 1HPZB 3MI7X 1KFSA 2PSZA 1JWWA 4U9RA 1TL4A 4ZPCA 4DG1A 1EP4A 2R2RA 1QLNA 1B0TA 1HQUA 4QPTA 1GX5A 2CG4A 1S9FA 3LUYA 4KV8B 4C0BA 5KFWA 2KG1A 3G9CA 5KFVA 2RDIA 2YQ3A 3H8YA 4RNOA 3THVA 5B0CA 2BVZA 3UD4P 4DJBA 3LAKA 5DG7A 4DS5A 2BUNA 2KDOA 2MKKA 3KTQA 2B56A 3TUZC 5F8LA 4CT8A 2OO4A 2ZD1A 4NMLA 5CQGA 4RUCA 3U1LA 2C22A 3U1MA 2R7UA 2VOOA 3IRWP 2LCWA 1VQSA 2B5JA 1W2IA 1TL3B 2P6SA 2FLNA 2VH7A 1XC9A 4OJ1A 2W7AA 2DH9A 2F40A 4KIAA 3RB6A 5F8MA 2BJDA 2LVWA 2AYBA 3M32A 3PV8A 3CIZA 2PIIA 4N41A 1MNEA 4WCEQ 5LL6d 4NZ6A 1GQEA 1FRHA 4DV4F 1U2RA 1C4AA 1FA0A 3I0SA 3MOJB 5CCMA 4I2QA 2PO4A 4QBUA 3QJPA 4X64F 2I8EA 2ZBIA 4ECXA 4N8OA 4CI0B 2JEJA 2KRBA 4F2RA 3TVZA 3BDEA 3HKWA 1FRXA 1Q86T 3IRXB 2EBGA 1HBNA 1GAOA 1HI8A 1Y7PA 4A8YA 4OZ1A 3PEJA 1SI9A 4DR1F 3AQPA 2HLUA 1GTHA 5A2QY 1HNIA 2V8DA 4LT6A 4Q45A 2AP6A 1HBMA 5EWEA 1S1UA 5AJ3F 1YTYA 3SQGB 4I68A 1YRTA 2CPXA 3DRPB 3R5CA 4OZ0A 2Z0GA 4CO2A 4NLTA 1Q8LA 1BQMB 1FCAA 3TA1A 2Q43A 1N5SA 2YNFB 4MKYA 1IUJA 5A6WA 2F4VF 2IRUA 2HHPA 2N4CA 4C0OC 1EETA 2KYZA 1D9AA 3DI6A 3MHYA 4U6PA 3L95X 1C1CA 4OZ5A 4NRUA 2CQCA 4TU7A 2ZVSA 1TV6A 3KHRA 2W25A 3JAMY 1HWLA 3IR6B 1OQ6A 3FZBA 3FEYB 4IDKA 3PW2A 2AX0A 4B9MA 1VQ7S 1Z1ZA 3P96A 1KOHA 2QFJA 2J7UA 3KJVA 3LGMA 1HYSA 3SFGA 2KN4A 3KNGA 3P6YC 3OFFA 1ZAWA 2RU9A 2YTCA 1SV5A 2M4MA 1F5AA 2VG5A 1WEYA 3I5AA 2JC1A 3BR9A 4IR9A 4KB7A 1QAYA 2PA3A 1X9SA 3RB3A 1S97A 2UUCF 1S1VA 1RT1B 2HMIA 2B6AA 1YJTA 4PKDB 2VFVA 3SDEB 2HZCA 4CH1A 2CQ1A 3B78A 3S01A 2XLIA 3KK3B 3HT3A 3E3XA 4Q8FA 3DOKB 4ZPVR 3N79A 3LOUA 1VRTB 2MKIA 3SYZA 1Y9OA 4QWBA 4ED0A 4ECYA 2UVVA 3JB9k 3FSYA 2C2DA 4BHQA 1SUQA 3TA0A 2Y1JA 2MZTA 2FJAB 3DMJB 2DD8S 2KJWA 3DLEB 2KFNA 1L3TA 2ZH3A 3JSYA 2QA2A 2MZQA 5KOXA 4K4YA 4C3KA 1D3WA 2YKMB 1UP1A 1WG5A 5CYMA 2B4OA 2PC6A 2Q6CA 3DOLB 2CIMA 2OSRA 4Q2MA 1R8HA 2LYVA 3VAGA 1VJWA 1UA0A 1SKWA 2APOA 3LP2A 3EPGA 4CO1A 4R0JA 1RTHA 3U27A 1LXNA 4O4RA 2B4PA 4B9UA 3GWCA 1R8AA 4B3SF 3PHEA 4L6V3 4RZRA 3S6EA 1BQXA 3C2PA 4MYTA 5B0DA 2B0GA 2EFQA 3FQKA 4NL5A 5L1KA 1U6BA 1LWCA 4FNIA 3NCQA 1SJQA 2W7PA 4RW8A 3MEGB 2CVIA 1N4LA 3KLEA 2YY3A 4IG3A 2AD9A 1HMVB 1T95A 2JDJA 2N3OA 2HVHA 1MROA 3GE9A 4X84A 2OP5A 4KE5A 1B7FA 1JK9B 1FKPA 2V2KA 4ED7A 4NXMF 1UVJA 1IJFB 4KAIA 1R43A 2DISA 3HDSA 3J81Y 1VFJA 3GYXB 1B64A 2IVFB 1LXJA 4OHZA 2ADBA 2PD1A 2XS7A 1QAIA 5KFPA 4N8NA 5B09A 5K8MA 4C8OA 4KO0A 4KGKA 2NZ4A 3CDUA 4QR0A 2HNYA 1R8BA 1FRJA 2U2FA 1APSA 2ILYA 1Y3JA 4YR2A 4CO5A 1YIJS 4WKYA 2ILZA 2B4VA 2F1FA 4ZPBA 2VASA 2FVRA 3BREA 3OR1A 2UVWA 1TKZB 2O01C 3CD6S 3FEXB 4RWXA 3I55S 3LGNA 3W2WB 2V0NA 2OD6A 2J9DE 3H5UA 3DM2B 4FNHA 5G4DA 1U25A 2C3OA 4EEYA 2BYCA 1ZM2A 3AA8A 4ZP6A 5J2MA 2RQ4A 4YQWA 3MMBA 4O3NA 5BR8F 3G8SA 2R4FA 1CLFA 2JX2A 2OPRB 3SV4A 2ZZNA 3M8RA 2ZHAA 2WAQD 2J8AA 5KG0A 2ZH2A 2GQQA 5BJRA 5EWFA 1ZH5A 5A8RB 2W7OA 3PY8A 2B4UA 4O3PA 3POTB 3N0VA 3QMQA 3UWTA 4C7QA 3RW7A 4EFAC 3C3LA 2M70A 4XPCA 3GYNA 3Q8QB 4NCBA 4LSLB 4MFBA 2E5HA 3JTOA 3G6ES 5HMXA 2FIUA 3DOMA 1IBMF 4FF3A 5JXSA 3BEGB 4NLRA 3HHLA 3P5TL 1QSSA 3MTJA 3U7JA 3UCZP 4XO0A 4C3MA 5LT5A 4G1QB 4AYBD 1VQOS 4LQ3A 4Y2KA 1K1SA 2MY8A 4IRDA 3J7YU 2VBWA 3UCUP 2CZ4A 4Q2LA 4NYPA 2KXNB 3RBEA 5KFCA 1TL1A 4HT7A 2VPXB 4OJGA 3CUNA 1RT4A 3L7PA 4RNNA 1DTTA 3H25A 1M5HA 1NO8A 2OPSA 1RTJB 3DYAA 4ELUA 3IBWA 3UDCA 2KXFA 1NKEA 2RKIA 1DQAA 3MM7A 5KG1A 3GSDA 1O0PA 5H9EJ 3BZQA 3TRGA 1AFJA 2HNZB 3BQ0A 2IAJA 2F9JA 4JOUA 4O23A 2HGNA 5C25B 5JJBA 4WFBQ 3GV5B 3OW2R 4URSA 1XNQF 1J2VA 4O4GB 4I6WA 4B9VA 4RUHA 4DL4A 3BJYA 2L3MA 2OJ3A 3LF0A 5LXRA 1ZOTA 3E51A 5D78A 4R0EA 2J76E 2E5JA 1TFWA 1HD0A 4KV8A 4C11A 1HNWF 2BV3A 2VODA 2HWIA 1SJ1A 1X4EA 1DTQB 3QGIA 2AJ1A 2U1AA 3CC7S 3PIOQ 1LFPA 1HWIA 3HHDA 4PG4A 3OFGA 3KK2B 3GMGA 3DRRB 4DR3F 3T5HA 3V4IB 3T5JA 5D4OA 5DQIA 3T5LA 1S6QA 3AA9A 1H98A 1YBAA 4WFYA 4O0IA 5CD4H 4BCAA 5A8WB 2HYIB 3K5LA 2ZE2B 2UUBF 3GFHA 4RW6B 5DETA 3H59A 3K7RA 1HWKA 4EU0A 1V9OA 3T1HF 2YH1A 1UW4A 5J2QA 4K0KF 2BR0A 2BXJA 3LWLA 3MMCA 1IKWB 2I38A 2ZH5A 1RAJA 5DRKA 4OLOA 1RT5B 4YUDA 4WKRA 2R2SA 3CCUS 2DR8A 1M5KC 2HHWA 4CO4A 4ALZA 3LANA 3BS9A 1AFIA 5GAHU 4GO7X 4B02A 3I32A 2L9DA 4I69A 1QTMA 5EN1A 1H7XA 4RLEA 1KNZA 1M1KT 4WK3A 2DT9A 3F41A 4F4XA 1NJXA 5K8NA 2CJAA 2KO1A 1U8SA 4IFYA 4Y65A 1FEHA 3M8PB 2PEHA 4WYWA 4DV6F 4JI6F 3KMQA 4HH0A 2P5VA 5CXTA 1YSJA 1RK8A 2FC9A 3GFYA 4G1PA 3J80Y 2JEFA 2AJ0A 3PW7A 3DHXA 2FD2A 2V9KA 3ZZ0A 1SKRA 1JKHA 1TKXA