3CCUI

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482c
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 8
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3ccuI00
1VQ5I 5DM6F 1YJWI 2QEXI 5GAHJ 1HC8A 2ZJRF 2JQ7A 1VQNI 5GADJ 1Y39A 4V19K 1VQLI 2FOWA 1YHQI 4IOAF 4IO9F 1VQPI 2K3FA 3CC2I 3CCEI 1YJNI 3CCRI 3CCJI 3J7ZI 1ACIA 3CCVI 2QA4I 2E34A 4IOCF 2ZJQF 1YITI 3I56I 3CJTB 3CCMI 1FOXA 2H8WA 3CCSI 1VQ9I 1YJ9I 5JVGF 3G4SI 5GAEJ 3CMEI 1S72I 1VQMI 3CD6I 3G6EI 3G71I 3CCLI 1MMSA 1VQ6I 1FOWA 1VQOI 3CC4I 2E36A 2OTJI 1QA6A 1FOYA 1VQ7I 3J7YJ 3CMAI 5GAGJ 1YI2I 3CF5F 2ZJPF 2E35A 2OTLI 1VQ4I 3CCQI 3DLLF 3CC7I 5DM7F 3I55I 1YIJI 2NXNB 3CCUI 1VQKI 3PIOF 4UY8I 1VQ8I 3PIPF
chains in the Genus database with same CATH superfamily
1ZN2A 2WAQA 3BDDA 5FROA 3M3YJ 1JHFA 1MMGA 4LGWA 2ZXIA 4Y4RA 1HW2A 1R1TA 2FX0A 1AWCA 2F4OB 2ZMEC 1HC8A 5L3FA 2J5PA 3MVPA 5CLSA 4AIJA 2J5OA 2EZKA 2QBYB 5CVUA 2JA2A 2H1LA 4FETA 1T33A 3EQLF 2L7KA 3DLAA 4B48A 4RAZA 4M3GA 5CKTA 4IRIA 1C0WA 2OA4A 2Y75A 2TRTA 2IA0A 2IGNA 3FM3A 1FTZA 4RAFA 2RQQA 3FX3A 1YJNI 3GUDA 1MZBA 1HBXG 1G3TA 2M1BA 3FKIJ 3BTJA 4XKWA 1ZH5A 1E3OC 4L5IA 3TMOA 4IQJA 4IVNA 5FRNA 3F21A 5J1YA 4G6DA 2DOFA 3MQ0A 3CCVI 1ZG1A 4ENNA 4I0AA 2R7RA 1H88C 5K5QA 4AIHA 2XRNA 3VPRA 3K7AJ 2E2HJ 1JXSA 4Q47A 1JGGA 1TWCJ 2L5QA 2UV1A 4OMYA 2DOEA 2M9HA 3U1KA 5L3GA 3FDYA 5EF6A 2R7WA 4DZPA 2DK5A 1K7AA 2CWEA 4LLGF 2OPTA 2A6TA 2K9LA 4BE0A 3CUQA 2PI0A 2RNGA 4II2A 3DXJF 1P2FA 1YJ9I 2XAQA 3LQQA 5GAEJ 2M34A 3QYFA 2GQQA 2NRAC 3CCLI 3HTSB 1YW9A 1IC8A 3AG4H 3HOVJ 3F3XA 5JR3A 1KQ8A 3L2VA 5EGOB 1F9NA 3HGGA 3K10A 2QKMB 4Y3OA 1V5EA 3SJMA 2HPMA 2RN7A 3CMAI 1LDJA 2Y69H 3ERMA 4G9YA 1E2XA 3H3ZA 3ZMUA 3VB2A 1XB4A 3W3CA 4DBQA 3LSKA 5J4VA 4BXUA 5M3FJ 2DMQA 3OS1A 2D1HA 3KEQA 1LQ1A 3HRMA 4LLNA 3FZVA 1YS6A 2WY7Q 3S15J 2WV0A 1LFUP 2VQGA 2XF6A 3LFUA 3TO7A 4MO7A 3TOAA 3CF2A 5FKMA 1MGTA 2WAFA 4QPOA 1K78A 3H3UA 2VLAA 3C3WA 3VSLA 2IGMA 3MKLA 3QOPA 5E8IA 1QO0D 4BAYA 2YR2A 1W7PB 4II3A 1MNEA 4BJTA 4ZZLA 3HKZN 2XROA 1H9TA 3I55I 5CPRB 1F43A 2LFBA 2GM4A 4FHTA 3GVAA 3RDIA 1VQKI 2MG4A 4BBSJ 2CFOA 2DI3A 3RKXA 4EJOA 1GXPA 1TWFJ 1IJWC 2PJRA 4A3GJ 4G7OF 1XGMA 1DU6A 4IL6C 1IXCA 1SVOA 4Q48A 4IHXA 3H9JA 2ZJRF 2PBIA 2JRMA 2K5CA 2XF7A 2E71A 5DTDA 1FSHA 1FTTA 3CQZJ 3IHUA 1SD4A 3KLNA 4V19K 1IUFA 1BR4A 5L3EA 1Q1HA 2XUBA 4LITA 3JSPA 1KU7A 1X2NA 2WA0A 3I71A 1MMDA 2ECCA 4M9XA 2W4SA 1GVJA 1TZLA 5EEHA 5TGTA 3BTIA 3KP2A 3CCJI 4EATA 3QQAA 2HOTA 1TBXA 2HTSA 3GTGJ 2DDAA 3B02A 2LF7A 4DNCA 2LBFB 4QSHA 4IOCF 1IV8A 3OOUA 1ZR2A 4ABZA 5HDNA 4Q4ZF 4B43A 1X3ZB 5BOXA 2C6YA 2JTVA 3HSRA 2JK3A 5J47A 1RC9A 3ZQIA 5FFZA 3TGNA 4KIGA 4CCKA 3OV8A 3JRAA 4XLPF 3K4NA 5KCMA 1T38A 3GTQJ 5CVVA 4AIKA 2D45A 3G6EI 1CF7B 1J09A 3CESA 4YIIA 3OIOA 1PP8F 2ME0A 4I09A 2EA2A 1D5VA 4EJVA 1D0ZA 5ICFA 2F5EA 1E0EA 2MABA 2KRFA 5H20A 4IF4A 3KP3A 1VI0A 4LMYA 5F0HA 1CQTA 4YFXF 2K4BA 4XM3A 3WODF 2GAUA 3LFKA 1UCRA 5BPDA 4HV5A 4JBAA 4AD9A 2XPWA 2KHMA 1T39A 2BZTA 3SXYA 2R5ZB 4IXAA 4E70A 3OYNA 2MYSA 3SQNA 3PUFA 3ULQB 3HC7A 1ON1A 3R60A 3W2WA 2DA5A 2HDWA 4ZYHA 2VKEA 3KEYA 1ZG5A 3J80K 2F4MB 2KZVA 1ORKA 3PNYA 3LA2A 4HOBA 2DJNA 3X2QH 4BNCA 4ZYDA 3E6DA 3K6GA 2KPMA 4XNFA 5BS6A 1MDMB 1UHSA 3ABUA 2HYJA 9ANTA 4NDLA 2KDZA 1FSEA 2FA5A 1U3EM 2K7LA 5FLXZ 2ZB9A 5EDNA 3HZJA 4N4OB 2IRFG 2FOWA 5B3SH 3H0DA 2K9QA 3VWBA 1KONA 5TISC 1VQPI 3TO6A 3RPQA 1OPCA 3MKWB 4UNOA 3GW2A 4KT6A 2HNHA 1XSXA 1GXQA 5C4XJ 4AWXB 1FZPB 3D5SC 3FHNA 2V1DA 1FWZA 2XB5A 2Q0OA 2ZCWA 5TJJA 3K70C 4ZZDA 3JW4A 4ZJZA 4PFPA 2WY8Q 4FX0A 1WZ2A 4A0YA 2Z9OA 4E4HA 3P5JA 4FX4A 3I3LA 2K4JA 4EEFG 5JHUA 2VKVA 1P4XA 2BE5F 2OZ6A 1JKRC 3HL2A 2MH9A 3ZQCA 1IO2A 2R7ZJ 1A35A 1AA7A 3H9QA 3EDPA 1IGNA 2X4HA 3PNVA 3RYRA 4QLCU 3G3ZA 3G71I 3M4OJ 3D0SA 1VQOI 1R49A 2I10A 2CMPA 3TP0A 3RIRA 4CH7A 3PL8A 3KYLA 4GRIA 4WCGA 4CYCB 3E5QA 1KQ9A 5FKOA 3AG2H 3AAFA 3F9KA 2YUSA 2X9DA 1LFPA 3KZIC 3ZN1A 1ZELA 4I2OA 1MMAA 3VOEA 4S04A 4HLYA 3N4MA 1HKQA 2ZNZA 4XBFA 2VODA 1BW5A 2HPIA 2LF8A 3S17J 4CCLA 4EJUA 2E1CA 3DBHB 2K02A 4GGGA 3PSIA 3RQIA 4N9IA 2E1MB 3ZMVA 2K3PA 1RUOA 3DPTA 5E3NA 1MBGA 4J01A 2R7OA 2LKSA 2B63J 4I7HA 3S14J 2MA3A 5DCMA 4B4CA 2CYYA 5F27A 5BMZA 2MD0A 4HQMA 4HSRA 1TWAJ 3SDGA 3ZCOA 5E1XA 1W0UA 1QNTA 3FBNB 3GCMA 3T5XA 2O61A 3SFIA 3PIPF 5CVJA 3HEFA 4OWRB 4TV7A 3MZHA 1S8NA 5HNFA 4IEJA 1S3JA 1MNMC 1FEXA 3KLOA 4JQFA 2IS4A 3O2PE 3MKZA 1U5TB 5E3OA 1QZEA 1V3FA 4YIFA 4U0YA 2KP6A 4B1RA 5GADJ 2L02A 1SFEA 1SD6A 2O6GE 1T98A 2BW3A 3S16J 4HDUA 2CW0F 1NK3P 3HHHA 1TWGJ 6PAXA 1F1ZA 1A5JA 1UHMA 1KQ0A 2MSYA 2ZXJA 2L9VA 3ZQFA 3T0YA 3CO7C 1H8AC 2HDDA 5F0CA 3TDUC 1BA5A 4R8HA 2Q8KA 5EEAA 4BHPA 2E19A 2VJJA 3DPLC 2B7EA 2ACJA 2E34A 3H5NA 4CCMA 3F72A 5E3LA 4HNUA 4J00A 3QPHA 3H92A 3E6BA 2Y31A 1Z6TA 3T1BA 4DYQA 4ZYGA 2CS3A 4XRMA 3C2HA 2HKOA 2M7BA 3NQOA 1HF0A 4ESFA 2HU9A 1P92A 3GLLA 4XKVA 4G6QA 3QU6A 2O8KA 2DK8A 2VXZA 5HLTA 3RSNA 2E7XA 2CUJA 2DO7A 1U5TC 1QVTA 3IAM2 5D5UB 2EWNA 2BY2A 3HRSA 3F0CA 3W6KB 3K4KA 2A61A 1QHGA 5L3DA 4ZDPA 3RKYA 2E36A 2P7VB 2ELKA 1ZR4A 4I02A 3ASNH 2OU2A 1K83J 3OSFA 3OIQA 4PZJA 2IS2A 2LH9A 1NHAA 4MTDA 5F6FA 4G6TB 4DYCA 2A5YB 1TLHB 1JI8A 1Z3YA 2D1VA 1W5CC 2STWA 3K1PA 4L9VA 2H6BA 2UUZA 3TP3A 2E5ZA 1TNTA 1ZARA 3NRVA 3ECHA 3MEXA 3PJRA 2FBHA 2DQRA 4V2FA 1D5YA 4AVZA 4J19A 4L9NA 1RESA 2V1XA 2ZKZA 1TT5B 1YIOA 3K2ZA 4IRHA 3GFIA 2HQNA 2PX9A 2VT2A 1OKRA 2VJIA 2ZJ2A 1FBUA 1GVDA 3M1CA 3P9CA 4XLFA 2R7UA 5H2FC 4BEHA 4HX7A 1ETQA 1ZG3A 2E1NA 4EM2A 1V4RA 2HOEA 3HPHA 3DTIA 5DCFA 5LEKA 3I4NJ 1WH7A 4BE2A 3MAJA 3GZ5A 4LOCA 2HOSA 3FXOA 5HNHA 1XD7A 4NHJA 2L7MP 3MCZA 3UR3C 3V7RA 3BROA 1D1BA 2EFNA 2JRTA 2F4IA 1SEUA 1W5SA 1UG0A 3ZOBA 2R7VA 1GLNA 2CG4A 2WB1A 1GHCA 4HF2A 1XDUA 4U7DA 1TC3C 1YRNB 2CUZA 1B72A 3M8FA 2EV6A 1MBJA 4XN0A 2K3FA 3M9AA 4AVPA 2PG4A 4BL0B 4DBRA 1FX7A 3JTHA 1ZGJA 2JJ7A 2Z99A 4OIQF 3DBLB 4A3MJ 2A05A 2LRDA 2CH0A 1B9MA 4L5EA 1WJAA 4LFUA 2E2JJ 4CGZA 3I4MJ 4ZYEA 3WTVC 5D5XB 3RKWA 3Q9SA 5M3MJ 3LSTA 2VOPA 4WXHA 2IGKA 2DMPA 3E5XA 3LA7A 1XSDA 2KIMA 1FOXA 2E60A 3S1NJ 2QQAA 3BR0A 4A5MA 3OOPA 1N78A 2F5VA 3F23A 4WX9A 4M3FA 1JHHA 2NS0A 4RB2C 3DTKA 3FMRA 2EFPA 4RB1A 4KFCA 4BY1J 4KMUX 1RR7A 2Y9ZA 4F3QA 2EH3A 4G8XA 4JX4A 1O3QA 1B6AA 1FOYA 1Z05A 3QPSA 1OMIA 5F04A 4HW0A 4HPQA 2X1CA 1X3WB 4HV6A 4GO1A 4XN3A 3JR9A 1FYKA 3GTLJ 1OQYA 4HYEA 4BACA 2XRLA 3PQJA 2KZGA 3R0JA 2X6YA 3ABMH 1XMAA 3DEWA 2IVMA 3CLQA 2DT6A 3FF5A 2MLKA 2B0LA 5HODA 1OCZH 4A0XA 3V8JA 1TL8A 1LB2A 2R93J 5H6QA 3OMYA 2NS8A 4BGDA 1OCTC 2ME6A 4C9YA 4B09A 3WG9A 3HOXJ 4IHSA 3GTMJ 3NWSA 2ETHA 3BR5A 2LY1A 4PK4A 1HW1A 2BEOA 5BNGA 1XN7A 3B6CA 2JPBA 1Z3XA 4LG0A 2KMUA 1YJWI 5LGUA 1Z21A 5AONA 1BL0A 1YW8A 3DQVC 5IP9J 2VBZA 1YYVA 1R1VA 1CGPA 4XR6A 4U0VA 2EB7A 3L2UA 1E3HA 5KAIC 4IHYA 3ZQQA 5IP7J 3OYEA 2JVHA 3CDLA 1D3YA 1JKQC 4C3IJ 5B1AH 1R22A 5EYRA 1LE8B 2DBBA 4I99C 3FMSA 1LUJB 1K4SA 3RTRA 3DKXA 1A04A 2V1NA 3ML6A 2WAQN 1G3YA 2LNBA 4UUSA 1BN5A 1K79A 5JLWA 1R71A 2KIFA 5J40A 3BZKA 2ZXHA 3E0JB 3KE2A 3F22A 3WTTC 3LWFA 1YX5A 4A3FJ 3CCYA 5K1YA 1KYZA 1FMVA 2HGCA 4B3XA 5DDGA 3MN2A 2M8GX 2A5WA 2LSOA 5K5RA 4HLXA 1B1BA 4OMZA 3ESWB 1EJ9A 3BJOA 4CICA 3P7NA 2YSRA 2CU7A 2EA4A 3IC7A 3LSGA 5M5WJ 2XAGA 3FXMA 2K40A 1FMWA 1YFHA 4AYBA 2EFOA 4D5FA 2CQXA 2EZHA 1VQ7I 4GDFA 3DU5A 1ZQ3P 4UUTA 1WPKA 2WV1A 1JT6A 3GF2A 3CTAA 5GAGJ 4NQWA 5HS9A 4IRGA 1Y8QB 4LG3A 5B66C 5HLGA 3K4JA 2ELJA 2LR8A 4EM1A 2R4GA 5EEGA 2FBKA 1WGXA 2WADA 2ZJPF 1HLVA 5CYVA 2LY9A 4B47A 5FD5A 4BXFA 2HZTA 1R5HA 2G7HA 3S8PA 4K2EA 5IP6A 5J8CA 1TT0A 3CO6C 1A36A 3HBLA 4BY7J 3CC7I 1S6LA 3SFZA 3V8LA 2CV2A 2PMZA 3GFLA 3KFWX 1P9QC 1WSUA 2O7OA 2JA7J 3MD2A 1WJEA 1WI3A 2X1DA 2B9SA 1YIJI 3PUBA 4BHBA 3GO5A 3R0AA 5M5XJ 2LD5A 1NK2P 3J81K 4M9ZA 1OYWA 3I53A 4OIOF 4UY8I 1G2HA 2M8EA 3TL4X 3DKWA 3COAC 1I50J 2DFHA 5EG0A 1IDZA 2L9SA 5DYMA 2A3SA 2HYFA 5C4JJ 2LP0A 3HYIA 1ETWA 3JRDA 1LKXA 3HTUA 1Z0XA 2E2IJ 2DU9A 4ENMA 1SFOJ 2M4GA 3L2QA 1Y1WJ 3VDXA 2F48A 4LIUA 2QF7A 1G4DA 2UZKA 3HDDA 2DFFA 1X19A 2VB6A 3GZNB 4EGZA 4V2GA 3V4GA 1WVRA 1ZK8A 2M87A 3BG6A 5L3BA 5JLXA 2FOKA 2VN2A 2HQAA 2XGEA 1SAXA 1BI0A 4YG2F 3G1LA 3WU2C 1YLFA 5LBQA 3SHFA 3FIWA 1XCBA 2VE9A 1R5ID 4YELA 3W6JB 2QKLB 1UG2A 2W57A 2L4MA 1B8IA 1X4OA 1EF4A 2QA4I 1ZAOA 3HKZA 3HUGA 4NC7A 4EGYA 4A69C 2YU3A 1IXRC 2BVMA 5B5EC 3F8FA 1QPMA 5J8FA 4ZC3A 1X2MA 2JZYA 3QPLA 4M6YA 4NC6A 1ZLKA 1OCRH 3S2HJ 2F5CA 2RAEA 3LNQA 2WAEA 1WJ5A 5FGMA 2HI3A 3TEDA 2BBYA 5BPIA 3CCSI 3GZ6A 4YFNF 1R5GA 2MW8A 4MLOA 3IKVA 2YU9J 3OYGA 1Y8RB 2XSDC 2DA6A 5IT9K 4DW6A 4EV0A 1S72I 2M4KA 5D5VB 2NNNA 2Q2EB 1YW7A 2FU4A 5HVQC 1MBHA 2HFHA 2EIKH 3HOUJ 4KJZA 3E5UA 1RIOH 3HOYJ 2OTJI 5LGTA 1IF1A 2RDPA 2VJ5A 2ZMEA 2ZO4A 3H35A 4C3JJ 3BQZA 2VQHA 4NBQA 1EA3A 1ULYA 4UVAA 2CQNA 3QP6A 1QU3A 1H0MA 3KP6A 3LSPA 2QSHX 3OYMA 1OCCH 1WJCA 1JTXA 2KRHA 2RGVA 4I6ZA 3QOEA 4ENKA 2FQ3A 2OC6A 4NC8A 1AKHA 1O3RA 3ZP5A 3OS0A 2M2EA 1W0TA 3V7SA 1USTA 1BC8C 4G12A 1R58A 3KP5A 1LFBA 3L2RA 2XAFA 1Z9CA 1W36D 4CZZA 2DMUA 3PIOF 2D5VA 3S2WA 1IN8A 2XGXA 1YO5C 2NYXA 4RM3A 2H8RA 2PEXA 1WFXA 2H6CA 3RPUA 2EFQA 2ESHA 1S7OA 4A6EA 2DA3A 2GOMA 3G2BA 4RBOA 2IW5A 3H36A 2KKOA 4RS8A 5FD6A 1ZREA 4XL9A 3CJQB 3OYDA 5LGNA 4XIDA 3JAMK 3L1PA 1VQLI 1V55H 4U0WA 3WTYC 4KISA 1BC7C 1U0JA 4B3AA 3MMYB 2QBYA 3CJNA 4EM0B 2DOAA 4IQ4A 1U8RA 4YIRX 1FBSA 5CQEA 1ETXA 1E3PA 3BR2A 3IH3A 3WHCA 4Q5SF 2NOGA 2QSFX 4RGRA 3G1MA 5FRMA 3O6BB 3L2WA 2VPLA 3IWFA 4UVCA 4NNJA 1KU2A 4E6KG 5LRSA 2FE3A 5F1RA 1PP7U 1G6NA 2PN6A 2CV1A 3IH4A 2AS5F 3VODA 4FQGA 2BV6A 1D8JA 3CMMA 3IAS2 2P6TA 3GYHX 3FXRA 1BOBA 5IY5H 3CJTB 1X4PA 3AL0B 3CCMI 2IGOA 4KITB 2OZUA 2XAJA 2STTA 4EJTA 5BQTA 2Z16A 1O3SA 2GBYA 3LA3A 4Y7NJ 3BC8A 5KAFC 1VQMI 4XLHA 4ON0A 2QENA 2P6SA 2NOJB 4BH9A 2EBIA 5A2QK 4JP0A 3GFJA 4FE7A 3L09A 2GIVA 1XMKA 3SYTA 2V7FA 1MBEA 3FMQA 1EH6A 4N9HA 1KA8A 1O7LA 1SFKA 4XK4A 4P9UA 1FC3A 1ONVA 4WXCA 5EGOA 2BVLA 1TW2A 2L7FP 2M0CA 2KJBA 2CFXA 3BG3A 4XRFA 3OY9A 3PFYA 4AU7A 2BOLA 1GV5A 4CSWA 2DMTA 2HEOA 1VQ4I 1DUXC 2VPRA 2OD5A 3CCQI 2UXNA 3DLLF 2WTEA 2X85A 2NAZA 4M72A 1FOKA 1ETOA 1I3AA 1Q1VA 3JREA 4FCYA 2YS9A 3JTGA 3WTZA 4L5JA 3NAUA 4D0PA 2HDCA 1LDDA 3E97A 3DCFA 5HDKA 5ICGA 5D8KB 1BIBA 3FXKA 2OAZA 4HBLA 5C3EJ 3ERED 2VKHA 5IOZA 1W7PA 4KIBA 4YEJA 2JUCA 2LLKA 3GTPJ 5IPAA 2RNJA 2VKDA 4LK1F 3Q0VA 5AIQA 3DPUA 3M07A 2LY2A 1MSFC 3LSIA 5GAHJ 1RNLA 3ECOA 2G7UA 2EPFA 4LJZF 4BYYA 4FE4A 3E3VA 1QHHD 3U2RA 5D5WB 2ZXWH 5JVTA 5CVIA 2R3SA 3PFIA 3LSMA 5DD8A 2KJCA 2MLGA 2FMYA 3CCEI 2IP2A 3SZTA 4M6VA 1N77A 3I54A 4R1HA 5LHIA 2X51A 1YQAA 1DDNA 4KICA 1RPWA 4NUBA 4WK8F 3KZYA 3C7JA 2BGCA 2MFZA 1DGRM 4UXNA 5B1BH 1KZHA 1MJAA 3CLOA 1IRXA 4M6XA 4MHGA 4ESJA 4CCOA 2Q2EA 1FNNA 1WQ2A 5IYDJ 1LVKA 1PJRA 4DQ2A 3H1CA 4N4NB 2HQ5A 2LBFA 3WGIA 3BOQA 2FXAA 3KX2A 2XDVA 4XSZF 3ZMZA 1BR1A 2XSJC 1APLC 4ZTJA 4PSWA 2H8WA 1DPUA 1OYYA 4PSXA 4UB6C 1DP3A 2L54A 3ASOH 4QWQA 1ZKGA 4BQAA 2DN0A 1G3WA 4OOIA 3JRGA 3WG7H 2DFEA 2FF4A 1WWXA 2E1MC 4H4KC 2LVSA 4P96A 4HX4A 2FD5A 3QYEA 4RLQA 2Z3YA 3OSGA 1SMTA 3DU6A 2COBA 4LD5A 4RMNA 5CVRA 3VYRB 2ADUA 3BJAA 3KP7A 1MSEC 1CF7A 2QQ9A 4S05A 4UB8C 3R6SA 1Y0UA 3OR2C 3K69A 2M45A 2P5VA 2RV8A 5FJ8J 5FO5A 4BUPA 3I59B 1MD0A 4Y15A 1PUEE 3BP8A 5HS8A 4M73A 2E35A 4BHCA 1X1CA 3QODA 3FISA 1S5LC 5FKKA 3MKYB 4UVBA 3VEPA 4L0YB 1IN6A 1ETVA 3K1MA 1F36A 2XKPA 2VE8A 2ID3A 5ILVA 2M0MA 3OYFA 2A69F 4UV8A 5DM7F 1D1CA 2ZFUA 3SZPA 2CRGA 1Z1DA 2BY0A 4W97A 4A3EJ 3BPXA 2F5FA 2M3AA 2K9NA 1UMQA 3E1SA 5FLMJ 3CCUI 2R5ZA 3LSHA 4BJ6C 2LC2A 1VZ0A 2AO9A 4U88A 1V5GA 4PCQA 3V8KA 3OYIA 3I58A 1RUNA 4HA8A 5CQGA 4O3MA 4XORA 3I5UA 1JKOC 4HRIA 2LOOA 2X0LA 2LKXA 5LEJA 5LD2C 1XPXA 2XKOA 2CQKA 1NTCA 2KQRA 3MFKA 2DFIA 2DA2A 2M30A 2Y0MA 1MDMA 4M3BA 3VSKA 4A2UA 3WE3A 3IWZA 2VT3A 1H89C 1J0RA 1PYVA 2LK2A 1J2XA 3D1NI 3L2CA 3L9FA 3HOZJ 4FT8A 1S7AA 3HJEA 4LIVA 2XASA 4G94A 1WKMA 4OAZA 2HWVA 4BQNA 3OYLA 2ZBKA 1IXSB 3JRFA 2L4AA 3GFMA 3OYBA 2XAUA 2LYCA 1GV2A 2DQLA 2LREA 4IX7A 2DXIA 1WJFA 3EETA 4HG2A 4LB5A 3JRIA 1G59A 5ERIA 1MJ9A 1QBJA 3M8EA 3A4CA 1SVLA 1A6QA 1OCOH 1PVEA 3IUOA 1REPC 2HR3A 3AG3H 2IS1A 2HVQA 2XIGA 3G73A 3SZGA 2QUFA 2FUG2 4U7BA 4XONA 2WB1N 1SANA 2COMA 2CW7A 5J6XA 4E7JA 2WBMA 5HOOA 2FJ1A 1R00A 3BG5A 1R1UA 5D8LB 4DJAA 3BCAA 3ZMTA 1TNSA 1Y56A 3ABTA 4XLEA 3ZQ7A 3ZPLA 2IAIA 3H9GA 2NVYJ 1HCRA 5K7ZA 1T95A 5DS9A 3DTEA 3WTXC 3MZYA 3QWLA 2ECBA 3CMYA 1HXDA 2NVXJ 1QZZA 3J7YJ 1AU7A 3RI4A 1FYLA 3EYIA 2QM3A 1Z6RA 1ODDA 4CA0A 3GXOA 4XKBA 4QTRA 3VYSB 4CYCA 5HS7A 5JI6A 1TWHJ 2PJPA 3K9TA 2W1OA 3CF5F 1JKPC 4L9TA 1FP2A 2A68F 2V6EA 1OCPA 3KPHA 1Z77A 1SD7A 5ED4A 4HNVA 2MBFA 2FSWA 4GYGA 1WI9A 2L0KA 2ZFWA 4EMSA 5K5OA 3Q0WA 4DGWB 1IAWA 4A93J 1I1SA 4HAMA 2Y0SN 4XLCA 4JYKA 3PO3J 2IBDA 1BJZA 2PJRB 5FLXK 3GLXA 5D6EA 5HDGA 4KN7X 2EFWA 1WH5A 2OV7A 4A3DJ 1Y6IA 5E17F 2X1EA 1O7FA 2QEXI 5E8GA 3ZMDA 4XQFA 3BY6A 4A5NA 2IS6A 4A0ZA 4BDYA 5KHDA 1BI1A 1OFCX 2JQ7A 1BW6A 3E6CC 2ID6A 4E7SA 4BXXJ 2N8GA 4CUGA 2FNAA 3T8TA 1U5TA 4D9JA 2KFDA 1YHQI 5E1ZB 3F6OA 3P9IA 5D6FA 2XC7A 2EQRA 4E7HA 1QZYA 3ZN0A 4MQVA 1OR7C 2OJED 2HYGD 3PO2J 1XX5A 2P81A 2K85A 4MIMA 5M5YJ 5J1UA 1XS9A 2VC1A 2DA7A 1ACIA 3GWZA 1P7IA 2P4WA 2PQ8A 4OIPF 3B6AA 3HRTA 2VIXA 1WJDA 2CGPA 2I5UA 1W5TA 2W48A 2O3FA 2R92J 2DA1A 3TOBA 1IUYA 3ISPA 1LEAA 1I6XA 3BTLA 4XKCA 1W4MA 4MFDA 3WTUC 2V6CA 3I56I 1I27A 3IV5A 3BTCA 2BYVE 5GPAA 1YX3A 5IYCJ 2Y48A 2R5YB 2EINH 2K27A 1BOAA 3WE2A 1JUSA 3LOCA 3JCUC 1D0XA 4BQOA 1EV7A 2AHQA 2V9PA 3QU3A 1MMSA 2DPDA 4OIRF 2DCEA 2VONA 3WGGA 1I1GA 2HXOA 4XRSG 2IA2A 2F2EA 3W2VA 2ZNYA 2JA8J 2JN6A 2EK5A 2R7QA 4M9SA 4XMYA 1U8BA 1L0OC 3M1EA 5DD4A 1YS7A 4FTHA 3G1OA 3CZ6A 4RLFA 2W85A 1ON2A 4P9FA 3GEZA 2W00A 1U6GA 1X3UA 3QAHA 1W1WE 1MW7A 2VL8A 4A3CJ 2K9MA 4ZH4F 1STZA 3CP8A 1I6HJ 3OYHA 2HQRA 3IL2A 4F92B 3ROUA 4X6AJ 3BR1A 1O4XA 1BM9A 3OYKA 1U2WA 4L18B 1B9NA 2HVSA 1IRFA 3A02A 4KT5C 1HSTA 4Z2YA 1UHWA 1I39A 3RZDJ 1W7PD 4AYBN 2DT5A 2CJJA 3HM5A 2RKHA 1BI3A 3U21A 2DLLA 3F8MA 1DPRA 2H94A 1Z91A 2QQ8A 1LNWA 2Y2ZA 1K6YA 4E7LA 1J59A 3BLYA 4LLLA 3HOWJ 3H5AA 1IW7F 1UFMA 4UHTA 5GP9A 5E18F 2MD5A 3FKJA 2DTRA 2VOOA 2R7SA 4JX5A 1VQNI 2QQBA 3K4MA 1XC5A 3HG9A 1XTAA 2MC4A 3DWLE 5ICEA 5D4RA 1G3SA 3QYBA 2PMZN 1D8KA 3O3KA 4Y13A 4IO9F 2GXAA 2NVTJ 3EUHC 1FPQA 3DF8A 2VJ4A 4A3JJ 3IKTA 3SEQA 1YRNA 3S3OA 5D4SA 1IG7A 4GCVA 4WWCA 2RC4A 1FYMA 1KU9A 4OINF 5HLIA 2JMWA 2FNPA 2Z33A 3H3VK 2QSGX 5L3CA 1FT9A 2X48A 2ZSHB 1MJBA 3NWTA 2IT0A 1X1DA 2G0EA 1J7KA 4IHTA 1R23A 2ICWG 2GZWA 1YOVB 2D2WA 1T0FC 2F5DA 2IXSA 3E7LA 4X0GA 4RGSA 1JUMA 2AXLA 1Z7UA 4C2UA 1R4NB 4A3IJ 5GTHC 2E1OA 2DODA 3A01B 1QQIA 2PLYA 1BBYA 1G8XA 1PDNC 1OR7A 4A3KJ 1P4AA 4Y52J 2JSPA 2Y30A 3U9GA 3KETA 3O8GA 1RKTA 2M7AA 2XVCA 4RM2A 1MNDA 1ZRDA 4CYDA 4CO8A 3DFGA 5ICCA 3EPZA 1WRJA 2RQPA 3FK7A 3LSRA 1UELB 3AFHA 1IRZA 1HDDC 2DDBA 3K4BA 1KU3A 3W2AA 4AM3A 1LPQA 5DCMB 1DP7P 1VFCA 3A03A 2R7XA 3AKZA 3FXUA 1R9TJ 3F8NA 2OF7A 3HRUA 3OWTA 3PNTA 4PJLA 3K70D 1POGA 4YFKF 1ERDA 2CUEA 3OS2A 5AIPA 2HTJA 4HF1A 2NXNB 1B59A 4CCJA 4ETSA 3R61A 1JJ8C 2VC0A 1SAUA 5FB2A 4IKFA 2V9KA 1M1EB 2CUFA 2V1UA 5KK1A 1ZYRF 3F8CA 2ESNA 2QLZA 3CDHA 2P0WA 3K4CA 2BW3B 1HW5A 3BQYA 1JUPA 3KYCB 2IEKA 2L01A 4RAYA 3IRRA 1K6OA 4U87A 1UZCA 2P7CB 1ZLJA 3IP4B 1LVAA 4F52A 4A6DA 4MQ9F 1J9IA 3S3MA 4EVIA 1R4MB 4ESBA 1TW3A 2IA1A 3DKYA 4JX6A 5E3MA 3IRQA 2PFBA 5GTIC 1EH8A 3CDIA 4JK1X 3RKQA 1USSA 1JE8A 3ZMSA 3WU0A 2NNYA 4PJMA 1FIPA 4I98B 2V26A 1MBKA 2FRHA 1LE8A 1XCVA 4RB3C 4ZYAA 4C2MJ 5LHHA 4E7IA 4KIFA 2R5YA 2BY1A 2VQLA 1QPIA 3GTOJ 3QP5A 1WJBA 2LTPA 5JFRA 2KLOA 1OISA 3C2BA 3K1NA 3VFZA 2O5RA 4H0EA 5IYBJ 2X6XA 3PQKA 2W84A 2WWYA 1FBQA 4A3BJ 4ENJA 1MKMA 3TW7A 4BE1A 2EV0A 2AXTC 3ZQLA 1IN7A 4HF0A 4EJWA 1VQ9I 5H6RA 1T2KA 1DGWY 1PUFB 2BXZA 4PJNA 3DP7A 3EUHA 3BZ6A 3FM5A 2X6WA 3CMEI 2QWWA 4YRVA 4C3HJ 1HSJA 2RREA 3RCOA 4A12A 3Q3SA 3ZR8X 3F6VA 2NVUB 1VQ6I 2NVQJ 1ZHFA 2BY3A 3C18A 2W7NA 3CC4I 4RGXA 3S2DJ 2LKPA 5K7FA 4O6JA 2R0QC 1RR8C 5KVRA 4C30A 1BIAA 2HOAA 2L9NA 4E7ZA 1SFUA 3HIFA 4B44A 2XGCA 3LMMA 2Z2SB 3TQNA 3RZOJ 1YI2I 2CV0A 3HB9A 4QPQA 3TW6A 2QZ8A 1GUUA 2GLOA 2LDUA 2JUGA 2YX4A 1T0FA 3E6MA 3MWMA 4RGUA 3KYDB 5LLQA 4PJJA 4AC0A 1DU0A 1H9GA 1SD5A 3DBRB 2O9LA 3T8RA 4M3EA 1NG6A 2GA2A 2V79A 3A1YA 3S3NA 1EH7A 1U9OA 4BEHB 5LHGA 3BCBA 3OR1C 5E20A 1YG2A 2VXDA 3HSFA 1TQPA 1F4KA 4S0HB 3BWGA 1P7JA 1ETKA 4LK0F 4HNTA 5DM6F 3LQRA 3HXLA 2IJLA 2O03A 5E79C 1J75A 4M3DA 3L7WA 1L3LA 3D5RC 5JHFA 1X1BA 2GIZA 1B72B 4BQQA 1B4AA 1I3QJ 3HGYA 3ZRGA 2DAOA 2CQQA 3H5RA 4XICA 3BR3A 4I0BA 1ITYA 4CDGA 3C1DA 4AIDA 1V5FA 4F55A 1T08B 3BJ6A 1O57A 2ELHA 1X1PA 4DZJA 2CO5A 3BG9A 5ILUA 3KEOA 1HDPA 4G7ZF 3AL0C 3DV8A 5C44J 1HKSA 2R7TA 1MH3A 1QGPA 4M71A 3ELKA 1T56A 4R79A 2FEZA 1XGNA 3V7CA 3CCRI 2EZLA 4MFEA 2GXBA 4BBRJ 4NB5A 2EZIA 5ILSA 4ZDLA 3QRFF 1FIAA 2K9SA 1AHDP 5CJ9A 1HA8A 4BDZA 2CQ7A 2A07F 5J3LA 5KNLA 3A01A 1R6RA 2O8XA 3WHBA 1ZGAA 1XMXA 5GPCA 1W36C 1U78A 3A2KA 4ITVA 2KIUA 2OCEA 4IJAA 4RA2A 3QPTA 1A6IA 3DEEA 3UNGC 2FBIA 3HPGA 1ETYA 2EIMH 3BR6A 1FLIA 2DYSH 3S32A 5F1JA 3HOTA 4KNYA 2VASA 2Z1DA 1BR2A 3NARA 1V54H 2XPUA 2Q1ZB 4BU2A 5JVGF 2XV4S 4ZTFA 1SVMA 3BG7A 3OYCA 4QIWN 4G7HF 3FWEA 4L9JA 3WGHA 1ZRCA 4BS9A 4JOMA 2AQFA 1VF9A 2E7WA 4D5CA 2KT0A 3SEZA 1FOWA 5EZHA 2XF5A 5F08A 4CZCA 1IV6A 2X6OA 3VYTB 4KMFA 2ISYA 1RKWA 4XSXF 2OQGA 2W82A 2FQ4A 4GYIA 3H0GJ 2F6CA 4FASD 1TP4A 2DYRH 3UKGA 2E5NA 3PSFA 1MMNA 1BI2A 2I8DA 2XGDA 3I0TA 2L9RA 2V4JC 4PFOA 3KCCA 1J5YA 2Y9YA 2GOXB 3S1RJ 2P5KA 5FKNA 1I5ZA 3EUAA 1XGOA 2NS7A 4CHUA 4CXFA 3KIOA 1OJLA 2JPCA 1OLTA 2OBPA 2OUMA 1KYWA 2MC3A 3ZXSA 1WHUA 4AUXA 3S93A 3K4LA 2QGUA 5DEQA 4RAGA 4WXDA 3ONQA 1A31A 4LG0B 1JGSA 4Y33A 5FFXA 1VQ8I 5F0FA 1BJAA 1UB9A 3FBIB 2VI6A 3FXQA 2R7FA 3GMEA 1QRYA 2LMDA 3N97A 2CSOA 2ZC2A 1VQ5I 1IZ1A 3A0HC 4KYWA 3JRHA 1O3TA 4FISA 2OCCH 3EUKL 4MTEA 1P6RA 3J81Z 4MEXF 1FP1D 4MGRA 2RVCA 1YE9A 2W24A 3GBGA 4IOAF 3ZGKA 2KISA 5DUIA 3CC2I 1RETA 3Q9VA 4UUSB 4RDUA 4XRSA 3EYYA 2MGQA 3M7GA 4E7KA 1TTYA 4GFBA 1ZRFA 3OIPA 3LL7A 1LJ9A 2JVGA 1RRJA 3J7ZI 3FK6A 4KDPA 3N05A 3JRBA 4ZDOA 1ENHA 1TQIA 1T6SA 3K2AA 4KUMA 1U9NA 1PUFA 1NH3A 4B8XA 2ZJQF 5TRDA 1UJ8A 1GDTA 2TCTA 1S9HA 1MIJA 3HHGA 4O5VA 2BXYA 3OL4A 1YITI 1N25A 3RQ4A 2EJRA 2BHYA 3MZ8A 2CW8A 2ZSIB 2YX7A 1IN5A 3P9KA 4XLNF 4IHVA 3AG1H 5EJCA 1GT0C 2BHZA 4HQEA 2H27A 3IH2A 3L00A 5EZGA 3CD6I 1SMYF 4DYRA 4PGGA 4LB6B 1XSVA 4Z6YA 2EIJH 3ZQHA 4L0ZB 1S7EA 3KZZA 3RJPA 1VTNC 1XGSA 4XLAA 2L2OA 1RI7A 4NQWB 3GTKJ 1QA6A 3NEUA 4W1UA 1HKTA 4MNUA 3WTSC 3CUQB 3OL3A 3Q5FA 2HKXA 4PUSA 5F64A 5IT9Z 2GXGA 5HLHA 1XG1A 5E1WA 4M74A 2VUMJ 1D1AA 2QVOA 3S1QJ 5K7HA 3C2GA 2P8TA 1ZGWA 2JA6J 2PMHA 4DIQA 2R7DA 2KIQA 2VQCA 3TDZC 2P5LC 3CP2A 2DJIA 2A6HF 5J1RA 3D5LA 1IRGA 2DPUA 3I64A 4BJ5C 5FKLA 2PMUA 5EG0B 5IOYA 2GWRA 4PGHA 3JSOA 4GXOA 2XPVA 4UUVA 2O0YA 2A6EF 1YTYA 4D1QA 1JJ6C 2GA1A 2OQRA 4HEA2 2UXXA 1R36A 3B73A 4OU0A 2Z5UA 4BKXA 1X58A 4UV9A 3TBIA 3SDBA 1K78B 1JT0A 5FLVA 1R7JA 1F5TA 1N75A 4MEYF 3LSJA 2JT1A 3FXLA 2XHKA 3ZQGA 2HXIA 3VYUB 1Y39A 1SC7A 3J7AY 2DA4A 2VBWA 1MBFA 2DMNA 3KP4A 3LAJA 3FHZA 2HVRA 4A3LJ 4XOTA 3CUQC 3V42A 3RYPA 3I9V2 1VNDA 2XAHA 2DTZA 4XOPA 3CUOA 5LRRA 5LFAA 1DQUA 1X1AA 2KRCA 4P5OA 3RPUD 2W25A 3I4PA 2DW4A 1B8IB 3GX4X 4D7NA 3HUGB 4OAYA 3PM1A 4WF2A 1SFXA 3O8HA 3JAMZ 1NG7A 4KN4X 2LG4A 2AQEA 4RB0A 3ABLH 3WTWC 2Y0SA 4HZFA 5DV5A 1OYIA 1TQMA 3M8JA 2EILH 1KGSA 3JRCA 2YPRA 3J80Z 2IPQX 2KL4A 2VBYA 2K86A 2HZDA 3TKYA 3HSEA 2VBXA 4Y17A 1UAAA 3K0LA 4HX8A 4I76A 1MH4A 3HOSA 2KDOA 3F8BA 4P55A 1ZTRA 4ANJA 3G4SI 3LAPA 5J4YA 4F93B 3FXJA 2EV5A 2WC2A 2QCOA 1T8IA 1QVUA 2H09A 2H1KA 2UWMA 2ZMEB 3CJRB 4HSTA 3WU1B 4KA4A 3BPVA 4F91B 2QYOA 3ABKH 4F7ZA 2XB0X 2M5WA 2MH2A 1AOYA 2HS5A 1Y1VJ 1FJLA 2V9VA 1HOMA 4IHWA 1IDYA 2L3DA 1LDKB 2JWTA 4HDVA 4N0BA 1FY7A 1K61A 1P4WA 4C2TA 1S29A 3A0BC 3TO9A 1D0YA 3Q0UA 4ASNA 4IPAA 1Y0NA 1JTYA 1AKHB 5A2QZ 3J7AO 4DOZA 3REOA 4D7MA 1EKEA 1HQCA 1IN4A 4I01A 3OYJA 2OTLI 5DUKA 3I59A 4IZZA 2FMLA 4PJ0C 4X1EA 3OYAA 2JA5J 2TDXA 3U1DA 2DT7B 3W6VA 3GTJJ 4PDKA 2JSCA 3BZCA 1XDSA 3DEUA 2G9WA 3S1MJ 3R4KA 1K4TA 4P1WA 2L7ZA 2ISZA 1LEBA 3BT9A 4CCNA 1Z67A 1Z7LA 5IT3A 1E17A 4EQQA 1WCMJ 1RZ4A
chains in the Genus database with same CATH topology
1VQ5I 5DM6F 1YJWI 2QEXI 5GAHJ 1HC8A 2ZJRF 2JQ7A 1VQNI 5GADJ 1Y39A 4V19K 1VQLI 2FOWA 1YHQI 4IOAF 4IO9F 1VQPI 2K3FA 3CC2I 3CCEI 1YJNI 3CCRI 3CCJI 3J7ZI 1ACIA 3CCVI 2QA4I 2E34A 4IOCF 2ZJQF 1YITI 3I56I 3CJTB 3CCMI 1FOXA 2H8WA 3CCSI 1VQ9I 1YJ9I 5JVGF 3G4SI 5GAEJ 3CMEI 1S72I 1VQMI 3CD6I 3G6EI 3G71I 3CCLI 1MMSA 1VQ6I 1FOWA 1VQOI 3CC4I 2E36A 2OTJI 1QA6A 1FOYA 1VQ7I 3J7YJ 3CMAI 5GAGJ 1YI2I 3CF5F 2ZJPF 2E35A 2OTLI 1VQ4I 3CCQI 3DLLF 3CC7I 5DM7F 3I55I 1YIJI 2NXNB 3CCUI 1VQKI 3PIOF 4UY8I 1VQ8I 3PIPF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ5 I;  5DM6 F;  1YJW I;  2QEX I;  5GAH J;  1HC8 A;  2ZJR F;  2JQ7 A;  1VQN I;  5GAD J;  1Y39 A;  4V19 K;  1VQL I;  2FOW A;  1YHQ I;  4IOA F;  4IO9 F;  1VQP I;  2K3F A;  3CC2 I;  3CCE I;  1YJN I;  3CCR I;  3CCJ I;  3J7Z I;  1ACI A;  3CCV I;  2QA4 I;  2E34 A;  4IOC F;  2ZJQ F;  1YIT I;  3I56 I;  3CJT B;  3CCM I;  1FOX A;  2H8W A;  3CCS I;  1VQ9 I;  1YJ9 I;  5JVG F;  3G4S I;  5GAE J;  3CME I;  1S72 I;  1VQM I;  3CD6 I;  3G6E I;  3G71 I;  3CCL I;  1MMS A;  1VQ6 I;  1FOW A;  1VQO I;  3CC4 I;  2E36 A;  2OTJ I;  1QA6 A;  1FOY A;  1VQ7 I;  3J7Y J;  3CMA I;  5GAG J;  1YI2 I;  3CF5 F;  2ZJP F;  2E35 A;  2OTL I;  1VQ4 I;  3CCQ I;  3DLL F;  3CC7 I;  5DM7 F;  3I55 I;  1YIJ I;  2NXN B;  3CCU I;  1VQK I;  3PIO F;  4UY8 I;  1VQ8 I;  3PIP F; 
#chains in the Genus database with same CATH topology
 1ZN2 A;  2WAQ A;  3BDD A;  5FRO A;  3M3Y J;  1JHF A;  1MMG A;  4LGW A;  2ZXI A;  4Y4R A;  1HW2 A;  1R1T A;  2FX0 A;  1AWC A;  2F4O B;  2ZME C;  1HC8 A;  5L3F A;  2J5P A;  3MVP A;  5CLS A;  4AIJ A;  2J5O A;  2EZK A;  2QBY B;  5CVU A;  2JA2 A;  2H1L A;  4FET A;  1T33 A;  3EQL F;  2L7K A;  3DLA A;  4B48 A;  4RAZ A;  4M3G A;  5CKT A;  4IRI A;  1C0W A;  2OA4 A;  2Y75 A;  2TRT A;  2IA0 A;  2IGN A;  3FM3 A;  1FTZ A;  4RAF A;  2RQQ A;  3FX3 A;  1YJN I;  3GUD A;  1MZB A;  1HBX G;  1G3T A;  2M1B A;  3FKI J;  3BTJ A;  4XKW A;  1ZH5 A;  1E3O C;  4L5I A;  3TMO A;  4IQJ A;  4IVN A;  5FRN A;  3F21 A;  5J1Y A;  4G6D A;  2DOF A;  3MQ0 A;  3CCV I;  1ZG1 A;  4ENN A;  4I0A A;  2R7R A;  1H88 C;  5K5Q A;  4AIH A;  2XRN A;  3VPR A;  3K7A J;  2E2H J;  1JXS A;  4Q47 A;  1JGG A;  1TWC J;  2L5Q A;  2UV1 A;  4OMY A;  2DOE A;  2M9H A;  3U1K A;  5L3G A;  3FDY A;  5EF6 A;  2R7W A;  4DZP A;  2DK5 A;  1K7A A;  2CWE A;  4LLG F;  2OPT A;  2A6T A;  2K9L A;  4BE0 A;  3CUQ A;  2PI0 A;  2RNG A;  4II2 A;  3DXJ F;  1P2F A;  1YJ9 I;  2XAQ A;  3LQQ A;  5GAE J;  2M34 A;  3QYF A;  2GQQ A;  2NRA C;  3CCL I;  3HTS B;  1YW9 A;  1IC8 A;  3AG4 H;  3HOV J;  3F3X A;  5JR3 A;  1KQ8 A;  3L2V A;  5EGO B;  1F9N A;  3HGG A;  3K10 A;  2QKM B;  4Y3O A;  1V5E A;  3SJM A;  2HPM A;  2RN7 A;  3CMA I;  1LDJ A;  2Y69 H;  3ERM A;  4G9Y A;  1E2X A;  3H3Z A;  3ZMU A;  3VB2 A;  1XB4 A;  3W3C A;  4DBQ A;  3LSK A;  5J4V A;  4BXU A;  5M3F J;  2DMQ A;  3OS1 A;  2D1H A;  3KEQ A;  1LQ1 A;  3HRM A;  4LLN A;  3FZV A;  1YS6 A;  2WY7 Q;  3S15 J;  2WV0 A;  1LFU P;  2VQG A;  2XF6 A;  3LFU A;  3TO7 A;  4MO7 A;  3TOA A;  3CF2 A;  5FKM A;  1MGT A;  2WAF A;  4QPO A;  1K78 A;  3H3U A;  2VLA A;  3C3W A;  3VSL A;  2IGM A;  3MKL A;  3QOP A;  5E8I A;  1QO0 D;  4BAY A;  2YR2 A;  1W7P B;  4II3 A;  1MNE A;  4BJT A;  4ZZL A;  3HKZ N;  2XRO A;  1H9T A;  3I55 I;  5CPR B;  1F43 A;  2LFB A;  2GM4 A;  4FHT A;  3GVA A;  3RDI A;  1VQK I;  2MG4 A;  4BBS J;  2CFO A;  2DI3 A;  3RKX A;  4EJO A;  1GXP A;  1TWF J;  1IJW C;  2PJR A;  4A3G J;  4G7O F;  1XGM A;  1DU6 A;  4IL6 C;  1IXC A;  1SVO A;  4Q48 A;  4IHX A;  3H9J A;  2ZJR F;  2PBI A;  2JRM A;  2K5C A;  2XF7 A;  2E71 A;  5DTD A;  1FSH A;  1FTT A;  3CQZ J;  3IHU A;  1SD4 A;  3KLN A;  4V19 K;  1IUF A;  1BR4 A;  5L3E A;  1Q1H A;  2XUB A;  4LIT A;  3JSP A;  1KU7 A;  1X2N A;  2WA0 A;  3I71 A;  1MMD A;  2ECC A;  4M9X A;  2W4S A;  1GVJ A;  1TZL A;  5EEH A;  5TGT A;  3BTI A;  3KP2 A;  3CCJ I;  4EAT A;  3QQA A;  2HOT A;  1TBX A;  2HTS A;  3GTG J;  2DDA A;  3B02 A;  2LF7 A;  4DNC A;  2LBF B;  4QSH A;  4IOC F;  1IV8 A;  3OOU A;  1ZR2 A;  4ABZ A;  5HDN A;  4Q4Z F;  4B43 A;  1X3Z B;  5BOX A;  2C6Y A;  2JTV A;  3HSR A;  2JK3 A;  5J47 A;  1RC9 A;  3ZQI A;  5FFZ A;  3TGN A;  4KIG A;  4CCK A;  3OV8 A;  3JRA A;  4XLP F;  3K4N A;  5KCM A;  1T38 A;  3GTQ J;  5CVV A;  4AIK A;  2D45 A;  3G6E I;  1CF7 B;  1J09 A;  3CES A;  4YII A;  3OIO A;  1PP8 F;  2ME0 A;  4I09 A;  2EA2 A;  1D5V A;  4EJV A;  1D0Z A;  5ICF A;  2F5E A;  1E0E A;  2MAB A;  2KRF A;  5H20 A;  4IF4 A;  3KP3 A;  1VI0 A;  4LMY A;  5F0H A;  1CQT A;  4YFX F;  2K4B A;  4XM3 A;  3WOD F;  2GAU A;  3LFK A;  1UCR A;  5BPD A;  4HV5 A;  4JBA A;  4AD9 A;  2XPW A;  2KHM A;  1T39 A;  2BZT A;  3SXY A;  2R5Z B;  4IXA A;  4E70 A;  3OYN A;  2MYS A;  3SQN A;  3PUF A;  3ULQ B;  3HC7 A;  1ON1 A;  3R60 A;  3W2W A;  2DA5 A;  2HDW A;  4ZYH A;  2VKE A;  3KEY A;  1ZG5 A;  3J80 K;  2F4M B;  2KZV A;  1ORK A;  3PNY A;  3LA2 A;  4HOB A;  2DJN A;  3X2Q H;  4BNC A;  4ZYD A;  3E6D A;  3K6G A;  2KPM A;  4XNF A;  5BS6 A;  1MDM B;  1UHS A;  3ABU A;  2HYJ A;  9ANT A;  4NDL A;  2KDZ A;  1FSE A;  2FA5 A;  1U3E M;  2K7L A;  5FLX Z;  2ZB9 A;  5EDN A;  3HZJ A;  4N4O B;  2IRF G;  2FOW A;  5B3S H;  3H0D A;  2K9Q A;  3VWB A;  1KON A;  5TIS C;  1VQP I;  3TO6 A;  3RPQ A;  1OPC A;  3MKW B;  4UNO A;  3GW2 A;  4KT6 A;  2HNH A;  1XSX A;  1GXQ A;  5C4X J;  4AWX B;  1FZP B;  3D5S C;  3FHN A;  2V1D A;  1FWZ A;  2XB5 A;  2Q0O A;  2ZCW A;  5TJJ A;  3K70 C;  4ZZD A;  3JW4 A;  4ZJZ A;  4PFP A;  2WY8 Q;  4FX0 A;  1WZ2 A;  4A0Y A;  2Z9O A;  4E4H A;  3P5J A;  4FX4 A;  3I3L A;  2K4J A;  4EEF G;  5JHU A;  2VKV A;  1P4X A;  2BE5 F;  2OZ6 A;  1JKR C;  3HL2 A;  2MH9 A;  3ZQC A;  1IO2 A;  2R7Z J;  1A35 A;  1AA7 A;  3H9Q A;  3EDP A;  1IGN A;  2X4H A;  3PNV A;  3RYR A;  4QLC U;  3G3Z A;  3G71 I;  3M4O J;  3D0S A;  1VQO I;  1R49 A;  2I10 A;  2CMP A;  3TP0 A;  3RIR A;  4CH7 A;  3PL8 A;  3KYL A;  4GRI A;  4WCG A;  4CYC B;  3E5Q A;  1KQ9 A;  5FKO A;  3AG2 H;  3AAF A;  3F9K A;  2YUS A;  2X9D A;  1LFP A;  3KZI C;  3ZN1 A;  1ZEL A;  4I2O A;  1MMA A;  3VOE A;  4S04 A;  4HLY A;  3N4M A;  1HKQ A;  2ZNZ A;  4XBF A;  2VOD A;  1BW5 A;  2HPI A;  2LF8 A;  3S17 J;  4CCL A;  4EJU A;  2E1C A;  3DBH B;  2K02 A;  4GGG A;  3PSI A;  3RQI A;  4N9I A;  2E1M B;  3ZMV A;  2K3P A;  1RUO A;  3DPT A;  5E3N A;  1MBG A;  4J01 A;  2R7O A;  2LKS A;  2B63 J;  4I7H A;  3S14 J;  2MA3 A;  5DCM A;  4B4C A;  2CYY A;  5F27 A;  5BMZ A;  2MD0 A;  4HQM A;  4HSR A;  1TWA J;  3SDG A;  3ZCO A;  5E1X A;  1W0U A;  1QNT A;  3FBN B;  3GCM A;  3T5X A;  2O61 A;  3SFI A;  3PIP F;  5CVJ A;  3HEF A;  4OWR B;  4TV7 A;  3MZH A;  1S8N A;  5HNF A;  4IEJ A;  1S3J A;  1MNM C;  1FEX A;  3KLO A;  4JQF A;  2IS4 A;  3O2P E;  3MKZ A;  1U5T B;  5E3O A;  1QZE A;  1V3F A;  4YIF A;  4U0Y A;  2KP6 A;  4B1R A;  5GAD J;  2L02 A;  1SFE A;  1SD6 A;  2O6G E;  1T98 A;  2BW3 A;  3S16 J;  4HDU A;  2CW0 F;  1NK3 P;  3HHH A;  1TWG J;  6PAX A;  1F1Z A;  1A5J A;  1UHM A;  1KQ0 A;  2MSY A;  2ZXJ A;  2L9V A;  3ZQF A;  3T0Y A;  3CO7 C;  1H8A C;  2HDD A;  5F0C A;  3TDU C;  1BA5 A;  4R8H A;  2Q8K A;  5EEA A;  4BHP A;  2E19 A;  2VJJ A;  3DPL C;  2B7E A;  2ACJ A;  2E34 A;  3H5N A;  4CCM A;  3F72 A;  5E3L A;  4HNU A;  4J00 A;  3QPH A;  3H92 A;  3E6B A;  2Y31 A;  1Z6T A;  3T1B A;  4DYQ A;  4ZYG A;  2CS3 A;  4XRM A;  3C2H A;  2HKO A;  2M7B A;  3NQO A;  1HF0 A;  4ESF A;  2HU9 A;  1P92 A;  3GLL A;  4XKV A;  4G6Q A;  3QU6 A;  2O8K A;  2DK8 A;  2VXZ A;  5HLT A;  3RSN A;  2E7X A;  2CUJ A;  2DO7 A;  1U5T C;  1QVT A;  3IAM 2;  5D5U B;  2EWN A;  2BY2 A;  3HRS A;  3F0C A;  3W6K B;  3K4K A;  2A61 A;  1QHG A;  5L3D A;  4ZDP A;  3RKY A;  2E36 A;  2P7V B;  2ELK A;  1ZR4 A;  4I02 A;  3ASN H;  2OU2 A;  1K83 J;  3OSF A;  3OIQ A;  4PZJ A;  2IS2 A;  2LH9 A;  1NHA A;  4MTD A;  5F6F A;  4G6T B;  4DYC A;  2A5Y B;  1TLH B;  1JI8 A;  1Z3Y A;  2D1V A;  1W5C C;  2STW A;  3K1P A;  4L9V A;  2H6B A;  2UUZ A;  3TP3 A;  2E5Z A;  1TNT A;  1ZAR A;  3NRV A;  3ECH A;  3MEX A;  3PJR A;  2FBH A;  2DQR A;  4V2F A;  1D5Y A;  4AVZ A;  4J19 A;  4L9N A;  1RES A;  2V1X A;  2ZKZ A;  1TT5 B;  1YIO A;  3K2Z A;  4IRH A;  3GFI A;  2HQN A;  2PX9 A;  2VT2 A;  1OKR A;  2VJI A;  2ZJ2 A;  1FBU A;  1GVD A;  3M1C A;  3P9C A;  4XLF A;  2R7U A;  5H2F C;  4BEH A;  4HX7 A;  1ETQ A;  1ZG3 A;  2E1N A;  4EM2 A;  1V4R A;  2HOE A;  3HPH A;  3DTI A;  5DCF A;  5LEK A;  3I4N J;  1WH7 A;  4BE2 A;  3MAJ A;  3GZ5 A;  4LOC A;  2HOS A;  3FXO A;  5HNH A;  1XD7 A;  4NHJ A;  2L7M P;  3MCZ A;  3UR3 C;  3V7R A;  3BRO A;  1D1B A;  2EFN A;  2JRT A;  2F4I A;  1SEU A;  1W5S A;  1UG0 A;  3ZOB A;  2R7V A;  1GLN A;  2CG4 A;  2WB1 A;  1GHC A;  4HF2 A;  1XDU A;  4U7D A;  1TC3 C;  1YRN B;  2CUZ A;  1B72 A;  3M8F A;  2EV6 A;  1MBJ A;  4XN0 A;  2K3F A;  3M9A A;  4AVP A;  2PG4 A;  4BL0 B;  4DBR A;  1FX7 A;  3JTH A;  1ZGJ A;  2JJ7 A;  2Z99 A;  4OIQ F;  3DBL B;  4A3M J;  2A05 A;  2LRD A;  2CH0 A;  1B9M A;  4L5E A;  1WJA A;  4LFU A;  2E2J J;  4CGZ A;  3I4M J;  4ZYE A;  3WTV C;  5D5X B;  3RKW A;  3Q9S A;  5M3M J;  3LST A;  2VOP A;  4WXH A;  2IGK A;  2DMP A;  3E5X A;  3LA7 A;  1XSD A;  2KIM A;  1FOX A;  2E60 A;  3S1N J;  2QQA A;  3BR0 A;  4A5M A;  3OOP A;  1N78 A;  2F5V A;  3F23 A;  4WX9 A;  4M3F A;  1JHH A;  2NS0 A;  4RB2 C;  3DTK A;  3FMR A;  2EFP A;  4RB1 A;  4KFC A;  4BY1 J;  4KMU X;  1RR7 A;  2Y9Z A;  4F3Q A;  2EH3 A;  4G8X A;  4JX4 A;  1O3Q A;  1B6A A;  1FOY A;  1Z05 A;  3QPS A;  1OMI A;  5F04 A;  4HW0 A;  4HPQ A;  2X1C A;  1X3W B;  4HV6 A;  4GO1 A;  4XN3 A;  3JR9 A;  1FYK A;  3GTL J;  1OQY A;  4HYE A;  4BAC A;  2XRL A;  3PQJ A;  2KZG A;  3R0J A;  2X6Y A;  3ABM H;  1XMA A;  3DEW A;  2IVM A;  3CLQ A;  2DT6 A;  3FF5 A;  2MLK A;  2B0L A;  5HOD A;  1OCZ H;  4A0X A;  3V8J A;  1TL8 A;  1LB2 A;  2R93 J;  5H6Q A;  3OMY A;  2NS8 A;  4BGD A;  1OCT C;  2ME6 A;  4C9Y A;  4B09 A;  3WG9 A;  3HOX J;  4IHS A;  3GTM J;  3NWS A;  2ETH A;  3BR5 A;  2LY1 A;  4PK4 A;  1HW1 A;  2BEO A;  5BNG A;  1XN7 A;  3B6C A;  2JPB A;  1Z3X A;  4LG0 A;  2KMU A;  1YJW I;  5LGU A;  1Z21 A;  5AON A;  1BL0 A;  1YW8 A;  3DQV C;  5IP9 J;  2VBZ A;  1YYV A;  1R1V A;  1CGP A;  4XR6 A;  4U0V A;  2EB7 A;  3L2U A;  1E3H A;  5KAI C;  4IHY A;  3ZQQ A;  5IP7 J;  3OYE A;  2JVH A;  3CDL A;  1D3Y A;  1JKQ C;  4C3I J;  5B1A H;  1R22 A;  5EYR A;  1LE8 B;  2DBB A;  4I99 C;  3FMS A;  1LUJ B;  1K4S A;  3RTR A;  3DKX A;  1A04 A;  2V1N A;  3ML6 A;  2WAQ N;  1G3Y A;  2LNB A;  4UUS A;  1BN5 A;  1K79 A;  5JLW A;  1R71 A;  2KIF A;  5J40 A;  3BZK A;  2ZXH A;  3E0J B;  3KE2 A;  3F22 A;  3WTT C;  3LWF A;  1YX5 A;  4A3F J;  3CCY A;  5K1Y A;  1KYZ A;  1FMV A;  2HGC A;  4B3X A;  5DDG A;  3MN2 A;  2M8G X;  2A5W A;  2LSO A;  5K5R A;  4HLX A;  1B1B A;  4OMZ A;  3ESW B;  1EJ9 A;  3BJO A;  4CIC A;  3P7N A;  2YSR A;  2CU7 A;  2EA4 A;  3IC7 A;  3LSG A;  5M5W J;  2XAG A;  3FXM A;  2K40 A;  1FMW A;  1YFH A;  4AYB A;  2EFO A;  4D5F A;  2CQX A;  2EZH A;  1VQ7 I;  4GDF A;  3DU5 A;  1ZQ3 P;  4UUT A;  1WPK A;  2WV1 A;  1JT6 A;  3GF2 A;  3CTA A;  5GAG J;  4NQW A;  5HS9 A;  4IRG A;  1Y8Q B;  4LG3 A;  5B66 C;  5HLG A;  3K4J A;  2ELJ A;  2LR8 A;  4EM1 A;  2R4G A;  5EEG A;  2FBK A;  1WGX A;  2WAD A;  2ZJP F;  1HLV A;  5CYV A;  2LY9 A;  4B47 A;  5FD5 A;  4BXF A;  2HZT A;  1R5H A;  2G7H A;  3S8P A;  4K2E A;  5IP6 A;  5J8C A;  1TT0 A;  3CO6 C;  1A36 A;  3HBL A;  4BY7 J;  3CC7 I;  1S6L A;  3SFZ A;  3V8L A;  2CV2 A;  2PMZ A;  3GFL A;  3KFW X;  1P9Q C;  1WSU A;  2O7O A;  2JA7 J;  3MD2 A;  1WJE A;  1WI3 A;  2X1D A;  2B9S A;  1YIJ I;  3PUB A;  4BHB A;  3GO5 A;  3R0A A;  5M5X J;  2LD5 A;  1NK2 P;  3J81 K;  4M9Z A;  1OYW A;  3I53 A;  4OIO F;  4UY8 I;  1G2H A;  2M8E A;  3TL4 X;  3DKW A;  3COA C;  1I50 J;  2DFH A;  5EG0 A;  1IDZ A;  2L9S A;  5DYM A;  2A3S A;  2HYF A;  5C4J J;  2LP0 A;  3HYI A;  1ETW A;  3JRD A;  1LKX A;  3HTU A;  1Z0X A;  2E2I J;  2DU9 A;  4ENM A;  1SFO J;  2M4G A;  3L2Q A;  1Y1W J;  3VDX A;  2F48 A;  4LIU A;  2QF7 A;  1G4D A;  2UZK A;  3HDD A;  2DFF A;  1X19 A;  2VB6 A;  3GZN B;  4EGZ A;  4V2G A;  3V4G A;  1WVR A;  1ZK8 A;  2M87 A;  3BG6 A;  5L3B A;  5JLX A;  2FOK A;  2VN2 A;  2HQA A;  2XGE A;  1SAX A;  1BI0 A;  4YG2 F;  3G1L A;  3WU2 C;  1YLF A;  5LBQ A;  3SHF A;  3FIW A;  1XCB A;  2VE9 A;  1R5I D;  4YEL A;  3W6J B;  2QKL B;  1UG2 A;  2W57 A;  2L4M A;  1B8I A;  1X4O A;  1EF4 A;  2QA4 I;  1ZAO A;  3HKZ A;  3HUG A;  4NC7 A;  4EGY A;  4A69 C;  2YU3 A;  1IXR C;  2BVM A;  5B5E C;  3F8F A;  1QPM A;  5J8F A;  4ZC3 A;  1X2M A;  2JZY A;  3QPL A;  4M6Y A;  4NC6 A;  1ZLK A;  1OCR H;  3S2H J;  2F5C A;  2RAE A;  3LNQ A;  2WAE A;  1WJ5 A;  5FGM A;  2HI3 A;  3TED A;  2BBY A;  5BPI A;  3CCS I;  3GZ6 A;  4YFN F;  1R5G A;  2MW8 A;  4MLO A;  3IKV A;  2YU9 J;  3OYG A;  1Y8R B;  2XSD C;  2DA6 A;  5IT9 K;  4DW6 A;  4EV0 A;  1S72 I;  2M4K A;  5D5V B;  2NNN A;  2Q2E B;  1YW7 A;  2FU4 A;  5HVQ C;  1MBH A;  2HFH A;  2EIK H;  3HOU J;  4KJZ A;  3E5U A;  1RIO H;  3HOY J;  2OTJ I;  5LGT A;  1IF1 A;  2RDP A;  2VJ5 A;  2ZME A;  2ZO4 A;  3H35 A;  4C3J J;  3BQZ A;  2VQH A;  4NBQ A;  1EA3 A;  1ULY A;  4UVA A;  2CQN A;  3QP6 A;  1QU3 A;  1H0M A;  3KP6 A;  3LSP A;  2QSH X;  3OYM A;  1OCC H;  1WJC A;  1JTX A;  2KRH A;  2RGV A;  4I6Z A;  3QOE A;  4ENK A;  2FQ3 A;  2OC6 A;  4NC8 A;  1AKH A;  1O3R A;  3ZP5 A;  3OS0 A;  2M2E A;  1W0T A;  3V7S A;  1UST A;  1BC8 C;  4G12 A;  1R58 A;  3KP5 A;  1LFB A;  3L2R A;  2XAF A;  1Z9C A;  1W36 D;  4CZZ A;  2DMU A;  3PIO F;  2D5V A;  3S2W A;  1IN8 A;  2XGX A;  1YO5 C;  2NYX A;  4RM3 A;  2H8R A;  2PEX A;  1WFX A;  2H6C A;  3RPU A;  2EFQ A;  2ESH A;  1S7O A;  4A6E A;  2DA3 A;  2GOM A;  3G2B A;  4RBO A;  2IW5 A;  3H36 A;  2KKO A;  4RS8 A;  5FD6 A;  1ZRE A;  4XL9 A;  3CJQ B;  3OYD A;  5LGN A;  4XID A;  3JAM K;  3L1P A;  1VQL I;  1V55 H;  4U0W A;  3WTY C;  4KIS A;  1BC7 C;  1U0J A;  4B3A A;  3MMY B;  2QBY A;  3CJN A;  4EM0 B;  2DOA A;  4IQ4 A;  1U8R A;  4YIR X;  1FBS A;  5CQE A;  1ETX A;  1E3P A;  3BR2 A;  3IH3 A;  3WHC A;  4Q5S F;  2NOG A;  2QSF X;  4RGR A;  3G1M A;  5FRM A;  3O6B B;  3L2W A;  2VPL A;  3IWF A;  4UVC A;  4NNJ A;  1KU2 A;  4E6K G;  5LRS A;  2FE3 A;  5F1R A;  1PP7 U;  1G6N A;  2PN6 A;  2CV1 A;  3IH4 A;  2AS5 F;  3VOD A;  4FQG A;  2BV6 A;  1D8J A;  3CMM A;  3IAS 2;  2P6T A;  3GYH X;  3FXR A;  1BOB A;  5IY5 H;  3CJT B;  1X4P A;  3AL0 B;  3CCM I;  2IGO A;  4KIT B;  2OZU A;  2XAJ A;  2STT A;  4EJT A;  5BQT A;  2Z16 A;  1O3S A;  2GBY A;  3LA3 A;  4Y7N J;  3BC8 A;  5KAF C;  1VQM I;  4XLH A;  4ON0 A;  2QEN A;  2P6S A;  2NOJ B;  4BH9 A;  2EBI A;  5A2Q K;  4JP0 A;  3GFJ A;  4FE7 A;  3L09 A;  2GIV A;  1XMK A;  3SYT A;  2V7F A;  1MBE A;  3FMQ A;  1EH6 A;  4N9H A;  1KA8 A;  1O7L A;  1SFK A;  4XK4 A;  4P9U A;  1FC3 A;  1ONV A;  4WXC A;  5EGO A;  2BVL A;  1TW2 A;  2L7F P;  2M0C A;  2KJB A;  2CFX A;  3BG3 A;  4XRF A;  3OY9 A;  3PFY A;  4AU7 A;  2BOL A;  1GV5 A;  4CSW A;  2DMT A;  2HEO A;  1VQ4 I;  1DUX C;  2VPR A;  2OD5 A;  3CCQ I;  2UXN A;  3DLL F;  2WTE A;  2X85 A;  2NAZ A;  4M72 A;  1FOK A;  1ETO A;  1I3A A;  1Q1V A;  3JRE A;  4FCY A;  2YS9 A;  3JTG A;  3WTZ A;  4L5J A;  3NAU A;  4D0P A;  2HDC A;  1LDD A;  3E97 A;  3DCF A;  5HDK A;  5ICG A;  5D8K B;  1BIB A;  3FXK A;  2OAZ A;  4HBL A;  5C3E J;  3ERE D;  2VKH A;  5IOZ A;  1W7P A;  4KIB A;  4YEJ A;  2JUC A;  2LLK A;  3GTP J;  5IPA A;  2RNJ A;  2VKD A;  4LK1 F;  3Q0V A;  5AIQ A;  3DPU A;  3M07 A;  2LY2 A;  1MSF C;  3LSI A;  5GAH J;  1RNL A;  3ECO A;  2G7U A;  2EPF A;  4LJZ F;  4BYY A;  4FE4 A;  3E3V A;  1QHH D;  3U2R A;  5D5W B;  2ZXW H;  5JVT A;  5CVI A;  2R3S A;  3PFI A;  3LSM A;  5DD8 A;  2KJC A;  2MLG A;  2FMY A;  3CCE I;  2IP2 A;  3SZT A;  4M6V A;  1N77 A;  3I54 A;  4R1H A;  5LHI A;  2X51 A;  1YQA A;  1DDN A;  4KIC A;  1RPW A;  4NUB A;  4WK8 F;  3KZY A;  3C7J A;  2BGC A;  2MFZ A;  1DGR M;  4UXN A;  5B1B H;  1KZH A;  1MJA A;  3CLO A;  1IRX A;  4M6X A;  4MHG A;  4ESJ A;  4CCO A;  2Q2E A;  1FNN A;  1WQ2 A;  5IYD J;  1LVK A;  1PJR A;  4DQ2 A;  3H1C A;  4N4N B;  2HQ5 A;  2LBF A;  3WGI A;  3BOQ A;  2FXA A;  3KX2 A;  2XDV A;  4XSZ F;  3ZMZ A;  1BR1 A;  2XSJ C;  1APL C;  4ZTJ A;  4PSW A;  2H8W A;  1DPU A;  1OYY A;  4PSX A;  4UB6 C;  1DP3 A;  2L54 A;  3ASO H;  4QWQ A;  1ZKG A;  4BQA A;  2DN0 A;  1G3W A;  4OOI A;  3JRG A;  3WG7 H;  2DFE A;  2FF4 A;  1WWX A;  2E1M C;  4H4K C;  2LVS A;  4P96 A;  4HX4 A;  2FD5 A;  3QYE A;  4RLQ A;  2Z3Y A;  3OSG A;  1SMT A;  3DU6 A;  2COB A;  4LD5 A;  4RMN A;  5CVR A;  3VYR B;  2ADU A;  3BJA A;  3KP7 A;  1MSE C;  1CF7 A;  2QQ9 A;  4S05 A;  4UB8 C;  3R6S A;  1Y0U A;  3OR2 C;  3K69 A;  2M45 A;  2P5V A;  2RV8 A;  5FJ8 J;  5FO5 A;  4BUP A;  3I59 B;  1MD0 A;  4Y15 A;  1PUE E;  3BP8 A;  5HS8 A;  4M73 A;  2E35 A;  4BHC A;  1X1C A;  3QOD A;  3FIS A;  1S5L C;  5FKK A;  3MKY B;  4UVB A;  3VEP A;  4L0Y B;  1IN6 A;  1ETV A;  3K1M A;  1F36 A;  2XKP A;  2VE8 A;  2ID3 A;  5ILV A;  2M0M A;  3OYF A;  2A69 F;  4UV8 A;  5DM7 F;  1D1C A;  2ZFU A;  3SZP A;  2CRG A;  1Z1D A;  2BY0 A;  4W97 A;  4A3E J;  3BPX A;  2F5F A;  2M3A A;  2K9N A;  1UMQ A;  3E1S A;  5FLM J;  3CCU I;  2R5Z A;  3LSH A;  4BJ6 C;  2LC2 A;  1VZ0 A;  2AO9 A;  4U88 A;  1V5G A;  4PCQ A;  3V8K A;  3OYI A;  3I58 A;  1RUN A;  4HA8 A;  5CQG A;  4O3M A;  4XOR A;  3I5U A;  1JKO C;  4HRI A;  2LOO A;  2X0L A;  2LKX A;  5LEJ A;  5LD2 C;  1XPX A;  2XKO A;  2CQK A;  1NTC A;  2KQR A;  3MFK A;  2DFI A;  2DA2 A;  2M30 A;  2Y0M A;  1MDM A;  4M3B A;  3VSK A;  4A2U A;  3WE3 A;  3IWZ A;  2VT3 A;  1H89 C;  1J0R A;  1PYV A;  2LK2 A;  1J2X A;  3D1N I;  3L2C A;  3L9F A;  3HOZ J;  4FT8 A;  1S7A A;  3HJE A;  4LIV A;  2XAS A;  4G94 A;  1WKM A;  4OAZ A;  2HWV A;  4BQN A;  3OYL A;  2ZBK A;  1IXS B;  3JRF A;  2L4A A;  3GFM A;  3OYB A;  2XAU A;  2LYC A;  1GV2 A;  2DQL A;  2LRE A;  4IX7 A;  2DXI A;  1WJF A;  3EET A;  4HG2 A;  4LB5 A;  3JRI A;  1G59 A;  5ERI A;  1MJ9 A;  1QBJ A;  3M8E A;  3A4C A;  1SVL A;  1A6Q A;  1OCO H;  1PVE A;  3IUO A;  1REP C;  2HR3 A;  3AG3 H;  2IS1 A;  2HVQ A;  2XIG A;  3G73 A;  3SZG A;  2QUF A;  2FUG 2;  4U7B A;  4XON A;  2WB1 N;  1SAN A;  2COM A;  2CW7 A;  5J6X A;  4E7J A;  2WBM A;  5HOO A;  2FJ1 A;  1R00 A;  3BG5 A;  1R1U A;  5D8L B;  4DJA A;  3BCA A;  3ZMT A;  1TNS A;  1Y56 A;  3ABT A;  4XLE A;  3ZQ7 A;  3ZPL A;  2IAI A;  3H9G A;  2NVY J;  1HCR A;  5K7Z A;  1T95 A;  5DS9 A;  3DTE A;  3WTX C;  3MZY A;  3QWL A;  2ECB A;  3CMY A;  1HXD A;  2NVX J;  1QZZ A;  3J7Y J;  1AU7 A;  3RI4 A;  1FYL A;  3EYI A;  2QM3 A;  1Z6R A;  1ODD A;  4CA0 A;  3GXO A;  4XKB A;  4QTR A;  3VYS B;  4CYC A;  5HS7 A;  5JI6 A;  1TWH J;  2PJP A;  3K9T A;  2W1O A;  3CF5 F;  1JKP C;  4L9T A;  1FP2 A;  2A68 F;  2V6E A;  1OCP A;  3KPH A;  1Z77 A;  1SD7 A;  5ED4 A;  4HNV A;  2MBF A;  2FSW A;  4GYG A;  1WI9 A;  2L0K A;  2ZFW A;  4EMS A;  5K5O A;  3Q0W A;  4DGW B;  1IAW A;  4A93 J;  1I1S A;  4HAM A;  2Y0S N;  4XLC A;  4JYK A;  3PO3 J;  2IBD A;  1BJZ A;  2PJR B;  5FLX K;  3GLX A;  5D6E A;  5HDG A;  4KN7 X;  2EFW A;  1WH5 A;  2OV7 A;  4A3D J;  1Y6I A;  5E17 F;  2X1E A;  1O7F A;  2QEX I;  5E8G A;  3ZMD A;  4XQF A;  3BY6 A;  4A5N A;  2IS6 A;  4A0Z A;  4BDY A;  5KHD A;  1BI1 A;  1OFC X;  2JQ7 A;  1BW6 A;  3E6C C;  2ID6 A;  4E7S A;  4BXX J;  2N8G A;  4CUG A;  2FNA A;  3T8T A;  1U5T A;  4D9J A;  2KFD A;  1YHQ I;  5E1Z B;  3F6O A;  3P9I A;  5D6F A;  2XC7 A;  2EQR A;  4E7H A;  1QZY A;  3ZN0 A;  4MQV A;  1OR7 C;  2OJE D;  2HYG D;  3PO2 J;  1XX5 A;  2P81 A;  2K85 A;  4MIM A;  5M5Y J;  5J1U A;  1XS9 A;  2VC1 A;  2DA7 A;  1ACI A;  3GWZ A;  1P7I A;  2P4W A;  2PQ8 A;  4OIP F;  3B6A A;  3HRT A;  2VIX A;  1WJD A;  2CGP A;  2I5U A;  1W5T A;  2W48 A;  2O3F A;  2R92 J;  2DA1 A;  3TOB A;  1IUY A;  3ISP A;  1LEA A;  1I6X A;  3BTL A;  4XKC A;  1W4M A;  4MFD A;  3WTU C;  2V6C A;  3I56 I;  1I27 A;  3IV5 A;  3BTC A;  2BYV E;  5GPA A;  1YX3 A;  5IYC J;  2Y48 A;  2R5Y B;  2EIN H;  2K27 A;  1BOA A;  3WE2 A;  1JUS A;  3LOC A;  3JCU C;  1D0X A;  4BQO A;  1EV7 A;  2AHQ A;  2V9P A;  3QU3 A;  1MMS A;  2DPD A;  4OIR F;  2DCE A;  2VON A;  3WGG A;  1I1G A;  2HXO A;  4XRS G;  2IA2 A;  2F2E A;  3W2V A;  2ZNY A;  2JA8 J;  2JN6 A;  2EK5 A;  2R7Q A;  4M9S A;  4XMY A;  1U8B A;  1L0O C;  3M1E A;  5DD4 A;  1YS7 A;  4FTH A;  3G1O A;  3CZ6 A;  4RLF A;  2W85 A;  1ON2 A;  4P9F A;  3GEZ A;  2W00 A;  1U6G A;  1X3U A;  3QAH A;  1W1W E;  1MW7 A;  2VL8 A;  4A3C J;  2K9M A;  4ZH4 F;  1STZ A;  3CP8 A;  1I6H J;  3OYH A;  2HQR A;  3IL2 A;  4F92 B;  3ROU A;  4X6A J;  3BR1 A;  1O4X A;  1BM9 A;  3OYK A;  1U2W A;  4L18 B;  1B9N A;  2HVS A;  1IRF A;  3A02 A;  4KT5 C;  1HST A;  4Z2Y A;  1UHW A;  1I39 A;  3RZD J;  1W7P D;  4AYB N;  2DT5 A;  2CJJ A;  3HM5 A;  2RKH A;  1BI3 A;  3U21 A;  2DLL A;  3F8M A;  1DPR A;  2H94 A;  1Z91 A;  2QQ8 A;  1LNW A;  2Y2Z A;  1K6Y A;  4E7L A;  1J59 A;  3BLY A;  4LLL A;  3HOW J;  3H5A A;  1IW7 F;  1UFM A;  4UHT A;  5GP9 A;  5E18 F;  2MD5 A;  3FKJ A;  2DTR A;  2VOO A;  2R7S A;  4JX5 A;  1VQN I;  2QQB A;  3K4M A;  1XC5 A;  3HG9 A;  1XTA A;  2MC4 A;  3DWL E;  5ICE A;  5D4R A;  1G3S A;  3QYB A;  2PMZ N;  1D8K A;  3O3K A;  4Y13 A;  4IO9 F;  2GXA A;  2NVT J;  3EUH C;  1FPQ A;  3DF8 A;  2VJ4 A;  4A3J J;  3IKT A;  3SEQ A;  1YRN A;  3S3O A;  5D4S A;  1IG7 A;  4GCV A;  4WWC A;  2RC4 A;  1FYM A;  1KU9 A;  4OIN F;  5HLI A;  2JMW A;  2FNP A;  2Z33 A;  3H3V K;  2QSG X;  5L3C A;  1FT9 A;  2X48 A;  2ZSH B;  1MJB A;  3NWT A;  2IT0 A;  1X1D A;  2G0E A;  1J7K A;  4IHT A;  1R23 A;  2ICW G;  2GZW A;  1YOV B;  2D2W A;  1T0F C;  2F5D A;  2IXS A;  3E7L A;  4X0G A;  4RGS A;  1JUM A;  2AXL A;  1Z7U A;  4C2U A;  1R4N B;  4A3I J;  5GTH C;  2E1O A;  2DOD A;  3A01 B;  1QQI A;  2PLY A;  1BBY A;  1G8X A;  1PDN C;  1OR7 A;  4A3K J;  1P4A A;  4Y52 J;  2JSP A;  2Y30 A;  3U9G A;  3KET A;  3O8G A;  1RKT A;  2M7A A;  2XVC A;  4RM2 A;  1MND A;  1ZRD A;  4CYD A;  4CO8 A;  3DFG A;  5ICC A;  3EPZ A;  1WRJ A;  2RQP A;  3FK7 A;  3LSR A;  1UEL B;  3AFH A;  1IRZ A;  1HDD C;  2DDB A;  3K4B A;  1KU3 A;  3W2A A;  4AM3 A;  1LPQ A;  5DCM B;  1DP7 P;  1VFC A;  3A03 A;  2R7X A;  3AKZ A;  3FXU A;  1R9T J;  3F8N A;  2OF7 A;  3HRU A;  3OWT A;  3PNT A;  4PJL A;  3K70 D;  1POG A;  4YFK F;  1ERD A;  2CUE A;  3OS2 A;  5AIP A;  2HTJ A;  4HF1 A;  2NXN B;  1B59 A;  4CCJ A;  4ETS A;  3R61 A;  1JJ8 C;  2VC0 A;  1SAU A;  5FB2 A;  4IKF A;  2V9K A;  1M1E B;  2CUF A;  2V1U A;  5KK1 A;  1ZYR F;  3F8C A;  2ESN A;  2QLZ A;  3CDH A;  2P0W A;  3K4C A;  2BW3 B;  1HW5 A;  3BQY A;  1JUP A;  3KYC B;  2IEK A;  2L01 A;  4RAY A;  3IRR A;  1K6O A;  4U87 A;  1UZC A;  2P7C B;  1ZLJ A;  3IP4 B;  1LVA A;  4F52 A;  4A6D A;  4MQ9 F;  1J9I A;  3S3M A;  4EVI A;  1R4M B;  4ESB A;  1TW3 A;  2IA1 A;  3DKY A;  4JX6 A;  5E3M A;  3IRQ A;  2PFB A;  5GTI C;  1EH8 A;  3CDI A;  4JK1 X;  3RKQ A;  1USS A;  1JE8 A;  3ZMS A;  3WU0 A;  2NNY A;  4PJM A;  1FIP A;  4I98 B;  2V26 A;  1MBK A;  2FRH A;  1LE8 A;  1XCV A;  4RB3 C;  4ZYA A;  4C2M J;  5LHH A;  4E7I A;  4KIF A;  2R5Y A;  2BY1 A;  2VQL A;  1QPI A;  3GTO J;  3QP5 A;  1WJB A;  2LTP A;  5JFR A;  2KLO A;  1OIS A;  3C2B A;  3K1N A;  3VFZ A;  2O5R A;  4H0E A;  5IYB J;  2X6X A;  3PQK A;  2W84 A;  2WWY A;  1FBQ A;  4A3B J;  4ENJ A;  1MKM A;  3TW7 A;  4BE1 A;  2EV0 A;  2AXT C;  3ZQL A;  1IN7 A;  4HF0 A;  4EJW A;  1VQ9 I;  5H6R A;  1T2K A;  1DGW Y;  1PUF B;  2BXZ A;  4PJN A;  3DP7 A;  3EUH A;  3BZ6 A;  3FM5 A;  2X6W A;  3CME I;  2QWW A;  4YRV A;  4C3H J;  1HSJ A;  2RRE A;  3RCO A;  4A12 A;  3Q3S A;  3ZR8 X;  3F6V A;  2NVU B;  1VQ6 I;  2NVQ J;  1ZHF A;  2BY3 A;  3C18 A;  2W7N A;  3CC4 I;  4RGX A;  3S2D J;  2LKP A;  5K7F A;  4O6J A;  2R0Q C;  1RR8 C;  5KVR A;  4C30 A;  1BIA A;  2HOA A;  2L9N A;  4E7Z A;  1SFU A;  3HIF A;  4B44 A;  2XGC A;  3LMM A;  2Z2S B;  3TQN A;  3RZO J;  1YI2 I;  2CV0 A;  3HB9 A;  4QPQ A;  3TW6 A;  2QZ8 A;  1GUU A;  2GLO A;  2LDU A;  2JUG A;  2YX4 A;  1T0F A;  3E6M A;  3MWM A;  4RGU A;  3KYD B;  5LLQ A;  4PJJ A;  4AC0 A;  1DU0 A;  1H9G A;  1SD5 A;  3DBR B;  2O9L A;  3T8R A;  4M3E A;  1NG6 A;  2GA2 A;  2V79 A;  3A1Y A;  3S3N A;  1EH7 A;  1U9O A;  4BEH B;  5LHG A;  3BCB A;  3OR1 C;  5E20 A;  1YG2 A;  2VXD A;  3HSF A;  1TQP A;  1F4K A;  4S0H B;  3BWG A;  1P7J A;  1ETK A;  4LK0 F;  4HNT A;  5DM6 F;  3LQR A;  3HXL A;  2IJL A;  2O03 A;  5E79 C;  1J75 A;  4M3D A;  3L7W A;  1L3L A;  3D5R C;  5JHF A;  1X1B A;  2GIZ A;  1B72 B;  4BQQ A;  1B4A A;  1I3Q J;  3HGY A;  3ZRG A;  2DAO A;  2CQQ A;  3H5R A;  4XIC A;  3BR3 A;  4I0B A;  1ITY A;  4CDG A;  3C1D A;  4AID A;  1V5F A;  4F55 A;  1T08 B;  3BJ6 A;  1O57 A;  2ELH A;  1X1P A;  4DZJ A;  2CO5 A;  3BG9 A;  5ILU A;  3KEO A;  1HDP A;  4G7Z F;  3AL0 C;  3DV8 A;  5C44 J;  1HKS A;  2R7T A;  1MH3 A;  1QGP A;  4M71 A;  3ELK A;  1T56 A;  4R79 A;  2FEZ A;  1XGN A;  3V7C A;  3CCR I;  2EZL A;  4MFE A;  2GXB A;  4BBR J;  4NB5 A;  2EZI A;  5ILS A;  4ZDL A;  3QRF F;  1FIA A;  2K9S A;  1AHD P;  5CJ9 A;  1HA8 A;  4BDZ A;  2CQ7 A;  2A07 F;  5J3L A;  5KNL A;  3A01 A;  1R6R A;  2O8X A;  3WHB A;  1ZGA A;  1XMX A;  5GPC A;  1W36 C;  1U78 A;  3A2K A;  4ITV A;  2KIU A;  2OCE A;  4IJA A;  4RA2 A;  3QPT A;  1A6I A;  3DEE A;  3UNG C;  2FBI A;  3HPG A;  1ETY A;  2EIM H;  3BR6 A;  1FLI A;  2DYS H;  3S32 A;  5F1J A;  3HOT A;  4KNY A;  2VAS A;  2Z1D A;  1BR2 A;  3NAR A;  1V54 H;  2XPU A;  2Q1Z B;  4BU2 A;  5JVG F;  2XV4 S;  4ZTF A;  1SVM A;  3BG7 A;  3OYC A;  4QIW N;  4G7H F;  3FWE A;  4L9J A;  3WGH A;  1ZRC A;  4BS9 A;  4JOM A;  2AQF A;  1VF9 A;  2E7W A;  4D5C A;  2KT0 A;  3SEZ A;  1FOW A;  5EZH A;  2XF5 A;  5F08 A;  4CZC A;  1IV6 A;  2X6O A;  3VYT B;  4KMF A;  2ISY A;  1RKW A;  4XSX F;  2OQG A;  2W82 A;  2FQ4 A;  4GYI A;  3H0G J;  2F6C A;  4FAS D;  1TP4 A;  2DYR H;  3UKG A;  2E5N A;  3PSF A;  1MMN A;  1BI2 A;  2I8D A;  2XGD A;  3I0T A;  2L9R A;  2V4J C;  4PFO A;  3KCC A;  1J5Y A;  2Y9Y A;  2GOX B;  3S1R J;  2P5K A;  5FKN A;  1I5Z A;  3EUA A;  1XGO A;  2NS7 A;  4CHU A;  4CXF A;  3KIO A;  1OJL A;  2JPC A;  1OLT A;  2OBP A;  2OUM A;  1KYW A;  2MC3 A;  3ZXS A;  1WHU A;  4AUX A;  3S93 A;  3K4L A;  2QGU A;  5DEQ A;  4RAG A;  4WXD A;  3ONQ A;  1A31 A;  4LG0 B;  1JGS A;  4Y33 A;  5FFX A;  1VQ8 I;  5F0F A;  1BJA A;  1UB9 A;  3FBI B;  2VI6 A;  3FXQ A;  2R7F A;  3GME A;  1QRY A;  2LMD A;  3N97 A;  2CSO A;  2ZC2 A;  1VQ5 I;  1IZ1 A;  3A0H C;  4KYW A;  3JRH A;  1O3T A;  4FIS A;  2OCC H;  3EUK L;  4MTE A;  1P6R A;  3J81 Z;  4MEX F;  1FP1 D;  4MGR A;  2RVC A;  1YE9 A;  2W24 A;  3GBG A;  4IOA F;  3ZGK A;  2KIS A;  5DUI A;  3CC2 I;  1RET A;  3Q9V A;  4UUS B;  4RDU A;  4XRS A;  3EYY A;  2MGQ A;  3M7G A;  4E7K A;  1TTY A;  4GFB A;  1ZRF A;  3OIP A;  3LL7 A;  1LJ9 A;  2JVG A;  1RRJ A;  3J7Z I;  3FK6 A;  4KDP A;  3N05 A;  3JRB A;  4ZDO A;  1ENH A;  1TQI A;  1T6S A;  3K2A A;  4KUM A;  1U9N A;  1PUF A;  1NH3 A;  4B8X A;  2ZJQ F;  5TRD A;  1UJ8 A;  1GDT A;  2TCT A;  1S9H A;  1MIJ A;  3HHG A;  4O5V A;  2BXY A;  3OL4 A;  1YIT I;  1N25 A;  3RQ4 A;  2EJR A;  2BHY A;  3MZ8 A;  2CW8 A;  2ZSI B;  2YX7 A;  1IN5 A;  3P9K A;  4XLN F;  4IHV A;  3AG1 H;  5EJC A;  1GT0 C;  2BHZ A;  4HQE A;  2H27 A;  3IH2 A;  3L00 A;  5EZG A;  3CD6 I;  1SMY F;  4DYR A;  4PGG A;  4LB6 B;  1XSV A;  4Z6Y A;  2EIJ H;  3ZQH A;  4L0Z B;  1S7E A;  3KZZ A;  3RJP A;  1VTN C;  1XGS A;  4XLA A;  2L2O A;  1RI7 A;  4NQW B;  3GTK J;  1QA6 A;  3NEU A;  4W1U A;  1HKT A;  4MNU A;  3WTS C;  3CUQ B;  3OL3 A;  3Q5F A;  2HKX A;  4PUS A;  5F64 A;  5IT9 Z;  2GXG A;  5HLH A;  1XG1 A;  5E1W A;  4M74 A;  2VUM J;  1D1A A;  2QVO A;  3S1Q J;  5K7H A;  3C2G A;  2P8T A;  1ZGW A;  2JA6 J;  2PMH A;  4DIQ A;  2R7D A;  2KIQ A;  2VQC A;  3TDZ C;  2P5L C;  3CP2 A;  2DJI A;  2A6H F;  5J1R A;  3D5L A;  1IRG A;  2DPU A;  3I64 A;  4BJ5 C;  5FKL A;  2PMU A;  5EG0 B;  5IOY A;  2GWR A;  4PGH A;  3JSO A;  4GXO A;  2XPV A;  4UUV A;  2O0Y A;  2A6E F;  1YTY A;  4D1Q A;  1JJ6 C;  2GA1 A;  2OQR A;  4HEA 2;  2UXX A;  1R36 A;  3B73 A;  4OU0 A;  2Z5U A;  4BKX A;  1X58 A;  4UV9 A;  3TBI A;  3SDB A;  1K78 B;  1JT0 A;  5FLV A;  1R7J A;  1F5T A;  1N75 A;  4MEY F;  3LSJ A;  2JT1 A;  3FXL A;  2XHK A;  3ZQG A;  2HXI A;  3VYU B;  1Y39 A;  1SC7 A;  3J7A Y;  2DA4 A;  2VBW A;  1MBF A;  2DMN A;  3KP4 A;  3LAJ A;  3FHZ A;  2HVR A;  4A3L J;  4XOT A;  3CUQ C;  3V42 A;  3RYP A;  3I9V 2;  1VND A;  2XAH A;  2DTZ A;  4XOP A;  3CUO A;  5LRR A;  5LFA A;  1DQU A;  1X1A A;  2KRC A;  4P5O A;  3RPU D;  2W25 A;  3I4P A;  2DW4 A;  1B8I B;  3GX4 X;  4D7N A;  3HUG B;  4OAY A;  3PM1 A;  4WF2 A;  1SFX A;  3O8H A;  3JAM Z;  1NG7 A;  4KN4 X;  2LG4 A;  2AQE A;  4RB0 A;  3ABL H;  3WTW C;  2Y0S A;  4HZF A;  5DV5 A;  1OYI A;  1TQM A;  3M8J A;  2EIL H;  1KGS A;  3JRC A;  2YPR A;  3J80 Z;  2IPQ X;  2KL4 A;  2VBY A;  2K86 A;  2HZD A;  3TKY A;  3HSE A;  2VBX A;  4Y17 A;  1UAA A;  3K0L A;  4HX8 A;  4I76 A;  1MH4 A;  3HOS A;  2KDO A;  3F8B A;  4P55 A;  1ZTR A;  4ANJ A;  3G4S I;  3LAP A;  5J4Y A;  4F93 B;  3FXJ A;  2EV5 A;  2WC2 A;  2QCO A;  1T8I A;  1QVU A;  2H09 A;  2H1K A;  2UWM A;  2ZME B;  3CJR B;  4HST A;  3WU1 B;  4KA4 A;  3BPV A;  4F91 B;  2QYO A;  3ABK H;  4F7Z A;  2XB0 X;  2M5W A;  2MH2 A;  1AOY A;  2HS5 A;  1Y1V J;  1FJL A;  2V9V A;  1HOM A;  4IHW A;  1IDY A;  2L3D A;  1LDK B;  2JWT A;  4HDV A;  4N0B A;  1FY7 A;  1K61 A;  1P4W A;  4C2T A;  1S29 A;  3A0B C;  3TO9 A;  1D0Y A;  3Q0U A;  4ASN A;  4IPA A;  1Y0N A;  1JTY A;  1AKH B;  5A2Q Z;  3J7A O;  4DOZ A;  3REO A;  4D7M A;  1EKE A;  1HQC A;  1IN4 A;  4I01 A;  3OYJ A;  2OTL I;  5DUK A;  3I59 A;  4IZZ A;  2FML A;  4PJ0 C;  4X1E A;  3OYA A;  2JA5 J;  2TDX A;  3U1D A;  2DT7 B;  3W6V A;  3GTJ J;  4PDK A;  2JSC A;  3BZC A;  1XDS A;  3DEU A;  2G9W A;  3S1M J;  3R4K A;  1K4T A;  4P1W A;  2L7Z A;  2ISZ A;  1LEB A;  3BT9 A;  4CCN A;  1Z67 A;  1Z7L A;  5IT3 A;  1E17 A;  4EQQ A;  1WCM J;  1RZ4 A; 
#chains in the Genus database with same CATH homology
 1VQ5 I;  5DM6 F;  1YJW I;  2QEX I;  5GAH J;  1HC8 A;  2ZJR F;  2JQ7 A;  1VQN I;  5GAD J;  1Y39 A;  4V19 K;  1VQL I;  2FOW A;  1YHQ I;  4IOA F;  4IO9 F;  1VQP I;  2K3F A;  3CC2 I;  3CCE I;  1YJN I;  3CCR I;  3CCJ I;  3J7Z I;  1ACI A;  3CCV I;  2QA4 I;  2E34 A;  4IOC F;  2ZJQ F;  1YIT I;  3I56 I;  3CJT B;  3CCM I;  1FOX A;  2H8W A;  3CCS I;  1VQ9 I;  1YJ9 I;  5JVG F;  3G4S I;  5GAE J;  3CME I;  1S72 I;  1VQM I;  3CD6 I;  3G6E I;  3G71 I;  3CCL I;  1MMS A;  1VQ6 I;  1FOW A;  1VQO I;  3CC4 I;  2E36 A;  2OTJ I;  1QA6 A;  1FOY A;  1VQ7 I;  3J7Y J;  3CMA I;  5GAG J;  1YI2 I;  3CF5 F;  2ZJP F;  2E35 A;  2OTL I;  1VQ4 I;  3CCQ I;  3DLL F;  3CC7 I;  5DM7 F;  3I55 I;  1YIJ I;  2NXN B;  3CCU I;  1VQK I;  3PIO F;  4UY8 I;  1VQ8 I;  3PIP F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...