3CCUI

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482c
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
70
structure length
70
Chain Sequence
b'GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 8
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3ccuI00
3G6EI 3I55I 2E35A 3CCVI 5GAEJ 1YITI 1VQ5I 1HC8A 4UY8I 3J7YJ 2FOWA 4IO9F 1YJWI 1FOXA 1FOYA 3G4SI 3DLLF 3CD6I 1YJ9I 1FOWA 1ACIA 2QEXI 1VQ4I 3CCQI 4V19K 1VQMI 1YI2I 3CCSI 1VQOI 3G71I 1S72I 1VQ6I 3CC2I 2E36A 2JQ7A 3CC4I 2OTLI 1VQKI 3PIPF 2K3FA 2E34A 1VQ9I 4IOCF 5DM6F 3I56I 1VQLI 2ZJQF 3CMEI 1VQPI 1QA6A 2H8WA 3CCRI 5DM7F 2QA4I 2NXNB 1YHQI 1VQNI 2OTJI 1MMSA 5GADJ 1Y39A 3J7ZI 5GAHJ 3CJTB 3CF5F 3PIOF 3CCLI 1VQ8I 3CCEI 2ZJPF 5JVGF 3CCJI 2ZJRF 1VQ7I 1YIJI 3CMAI 5GAGJ 3CCMI 1YJNI 3CC7I 4IOAF 3CCUI
chains in the Genus database with same CATH superfamily
2IA0A 4TV7A 5E1ZB 4ESBA 2QKMB 3ZGKA 1U2WA 3RJPA 1T6SA 2E5ZA 4E4HA 1WI9A 3SDBA 4A3LJ 4QTRA 2TRTA 1LFUP 3K4CA 1RR8C 3BR3A 2ADUA 3TMOA 3H0DA 3TO6A 1MBKA 1EV7A 3IC7A 3WTZA 2CW8A 2IA2A 2IW5A 2M7AA 3PSFA 3W2AA 2E7XA 3SEQA 2E19A 2LG4A 1I1GA 3BCAA 2Q0OA 2FJ1A 1WCMJ 2DYRH 4L0YB 1L3LA 3E97A 3PL8A 2O5RA 4EJOA 1DU6A 3CJNA 4EV0A 5HDKA 3F21A 1FIAA 1WHUA 1SAUA 1BI3A 2F4OB 3S1RJ 1JKQC 2R7UA 1O4XA 4HF2A 3BR1A 4J19A 1BIBA 2VOPA 2FNPA 3HOUJ 4PJJA 2HOEA 2KL4A 1A36A 1IV8A 5CVRA 2YX7A 1MNEA 2HZDA 4C3HJ 2QSFX 5FJ8J 2NNYA 2CJJA 3ZQQA 2Y30A 4L0ZB 4WK8F 3OS1A 3D0SA 4YIIA 2CV0A 1Z05A 4OU0A 2R92J 2HVRA 3DEEA 2R5YA 2PBIA 2M7BA 2WTEA 2Y0SA 1VQKI 2GIZA 2HFHA 2XASA 2FNAA 5GTHC 2R4GA 4I09A 4V2FA 4L18B 1QNTA 4R79A 2A05A 2F5FA 4CHUA 1P4WA 3BZCA 3O2PE 4BY1J 3GO5A 3D5LA 4OIRF 5TRDA 4A3MJ 4OMYA 4LLNA 2X0LA 4LLGF 1VQPI 4S05A 2FBKA 2IS2A 1ETWA 1HW2A 3OYCA 1QVUA 3MMYB 3DEUA 5DM7F 2L01A 1VQNI 4GO1A 4HLYA 3L9FA 2RKHA 4I76A 4PJLA 1H89C 1ZR4A 2QF7A 3PO3J 3QQAA 5J4YA 2ESNA 3PIOF 1NG6A 2F6CA 1REPC 2VKEA 4N9IA 5H2FC 1MW7A 3F8MA 4HG2A 1AHDP 4YFXF 4WXCA 1T0FC 4C2TA 3C7JA 2BBYA 2EZKA 3W6KB 2R7RA 2WV0A 5DUKA 5M5YJ 3AFHA 3VFZA 4N4OB 4BJ5C 4AWXB 4B3XA 4WF2A 3FDYA 5FD5A 2LTPA 3DCFA 1F36A 4MIMA 1QRYA 4S04A 2NVYJ 3CCMI 4DGWB 4CCJA 1V5EA 3HM5A 4FE7A 1Q1VA 3KP5A 1WJ5A 5B1AH 5HLIA 4LD5A 1DQUA 3G6EI 3K70C 4O3MA 2MFZA 1WWXA 3KYLA 2XAHA 2DK5A 2XKPA 2VLAA 4FT8A 4BE1A 2PI0A 2R7XA 3F8BA 4W97A 5J1UA 3JR9A 1JJ8C 1FX7A 2P4WA 4IHSA 3RCOA 1HC8A 4HLXA 3ZQGA 4FHTA 1QGPA 1S7OA 3OYDA 2ICWG 3FXLA 1R4MB 2X1CA 2LKPA 3C2GA 1HDDC 3CTAA 1XS9A 4EJVA 4BXXJ 1S5LC 3S2DJ 2L9NA 3F9KA 3H3VK 3M07A 4BQNA 3QAHA 3BCBA 1RPWA 3S3OA 1Z9CA 3HOWJ 2PX9A 2VC0A 2X6OA 5IT9K 1YX3A 3EUAA 1TT0A 3WG9A 3ZMTA 4KICA 2LBFB 4UUTA 2CQXA 1B9NA 4XONA 3K1MA 4XIDA 4E7LA 3F3XA 2HZTA 1ZELA 4CCOA 1HDPA 1FSHA 4II2A 2O8KA 4PJMA 3H3UA 2KIFA 1G59A 3A2KA 1UJ8A 1L0OC 3SFZA 5AONA 2QQ8A 2KRFA 5DM6F 2I8DA 3IAS2 2XAFA 2K40A 3A1YA 1TP4A 2KPMA 2WBMA 3KEYA 2BY1A 5D6FA 3UKGA 1LJ9A 1RUOA 4D7NA 2DMQA 3KP2A 4IJAA 2EH3A 5HODA 1ENHA 2R7ZJ 1P2FA 2GA2A 2N8GA 5EGOB 4CGZA 2OTJI 2XPUA 5K5QA 5LBQA 4GCVA 2Q1ZB 4I02A 2VJIA 5E3MA 4XORA 5J3LA 4HDUA 2B7EA 1OCPA 1TWGJ 1Y0NA 2FE3A 5BNGA 1BBYA 1S6LA 1ONVA 2HGCA 1MBJA 2HOAA 5FKOA 3WGHA 2DQLA 2K27A 3HOTA 3NQOA 3C2BA 4EMSA 3A01B 2BV6A 3HKZA 3CESA 4L5JA 2NYXA 3RYPA 4LB6B 3A0HC 4DIQA 2FX0A 2MH9A 1YW9A 4XQFA 1ZH5A 2XGEA 1HA8A 3BZKA 1DP7P 2KZGA 4OAYA 4CCNA 2ZNYA 1YRNA 3PUFA 4IHVA 1KU7A 1J09A 3MKZA 1W5TA 1UCRA 1F5TA 5F64A 4UXNA 4G6DA 3V7RA 3I64A 3CUQB 2V6CA 2HOTA 3JW4A 4ZYGA 2A3SA 2HQNA 1HSJA 1I39A 4UHTA 4A0ZA 3QPLA 3WGGA 1B8IA 5DCMB 4F92B 2FOWA 3CP2A 1MH4A 5JI6A 1CF7B 1O3RA 1AU7A 4GGGA 4JOMA 1LKXA 4DZJA 2R5ZA 3FKIJ 4HQEA 3HXLA 2GAUA 1RUNA 3G1MA 2IBDA 1V54H 1IGNA 1MNMC 2Y48A 4A3GJ 2X51A 1XGMA 2CFXA 3KCCA 4PDKA 4YG2F 2B0LA 3KP7A 1KYWA 3EQLF 4U0VA 1QPMA 3CCSI 4LK1F 1VQOI 5L3EA 1D8JA 1A04A 2MLGA 2IGOA 3DPUA 5HLGA 1X3ZB 1OJLA 3BZ6A 1ZK8A 2XAUA 3ERED 2XGCA 1D5VA 3MD2A 3CC4I 5AIQA 2X6YA 2VODA 1TLHB 5HVQC 3ZQHA 2HDWA 5LLQA 2RV8A 2KP6A 1G3WA 2K85A 4A3IJ 1X2MA 2DT7B 3RQ4A 3K1NA 4KN4X 1DDNA 3IKVA 4BGDA 1NK3P 4NC8A 4OIPF 3FXQA 4HNUA 2Z33A 3I58A 4II3A 3JRGA 2DN0A 5J8CA 3F0CA 1PP7U 1JXSA 2BOLA 2PG4A 3BPXA 3E6MA 3SXYA 5IYDJ 4DW6A 1UZCA 1MDMB 1W0TA 3W3CA 3LMMA 4L5IA 4M72A 3LSHA 2A68F 3I53A 3GUDA 4XN3A 4IQJA 1O57A 5LGTA 1N75A 4XR6A 3VB2A 2IT0A 3HEFA 4F91B 1D1AA 2HS5A 1E3HA 2BEOA 3DTEA 4FASD 3OL4A 2F5VA 3E5UA 2OD5A 1IUYA 3CZ6A 5D8KB 5FGMA 1T0FA 3MKWB 3ZCOA 2A69F 3E6DA 4PGHA 2QBYB 2R7OA 3JCUC 3WG7H 4A3DJ 4PCQA 3DKWA 2WV1A 1IV6A 3K4BA 5IP6A 5B66C 3CCUI 1MZBA 1XB4A 3KP6A 1VZ0A 4CYCB 4XRSG 3HUGB 3OYNA 1BW6A 2M4KA 5HDGA 1Z3YA 1SFXA 4RGRA 3B6CA 1LEAA 3O8GA 3TL4X 1T8IA 3E3VA 1LDJA 1G3YA 2ZKZA 2VQGA 3OYBA 3EYYA 3PO2J 1Y8RB 4KFCA 4ASNA 1ORKA 2MC3A 3FHZA 1HKTA 1FBSA 1YITI 1VQ5I 1AWCA 3FM3A 4RAFA 3AL0B 1FBUA 2LFBA 2MBFA 5FLXZ 2Y31A 3TKYA 2HKXA 3PQKA 3ECHA 3JTHA 2W24A 1HKQA 1X1AA 3L2CA 2Q2EA 3WGIA 2H27A 2K9QA 3HGGA 4M6VA 5E1WA 2GQQA 1Z1DA 4P5OA 1YTYA 2R7DA 2GXAA 2K9SA 2DA2A 3M4OJ 3GTPJ 2XB5A 1U9OA 3K9TA 1VQ4I 4I99C 1LE8B 4KMUX 2CGPA 2M3AA 3MCZA 1OPCA 3DLAA 1ON1A 4MQ9F 2HKOA 3IUOA 3LAJA 4L9JA 3M9AA 1HLVA 4XSXF 3BTIA 4BXUA 4BJTA 3K69A 2EZIA 2KZVA 4KNYA 1EH6A 4RGXA 5B5EC 2K4JA 1BJZA 1AKHA 3FKJA 5E17F 1O3SA 1LVAA 2EZHA 5IP7J 2FQ3A 1XPXA 1IUFA 3A03A 2JQ7A 3ZMZA 5F1JA 3W6VA 4FTHA 1R22A 2HYJA 2RNGA 3WU2C 1KZHA 1HW5A 3FX3A 2AQEA 2FUG2 1VFCA 3CLQA 2A5YB 1X1DA 5D4SA 3L00A 1K7AA 1C0WA 2DOEA 1IRZA 2RC4A 2VJJA 4OMZA 2Z2SB 1T33A 5K7HA 5HS9A 3NAUA 4HQMA 3KZIC 2ZB9A 4KUMA 4AVPA 1MMNA 4B8XA 1QA6A 2H8WA 2R5YB 1FOKA 3KP3A 4IHYA 3A02A 3ZMVA 2AXLA 1EH8A 3W2VA 1KQ0A 4YFKF 2W82A 5GADJ 2UZKA 2BGCA 3HSEA 2Y2ZA 3TDUC 4E7IA 3IP4B 2LK2A 3CDHA 4MFEA 4P9FA 1UHWA 2OBPA 2QGUA 2NRAC 3DF8A 1K4SA 1ZHFA 2M0MA 2CSOA 2NS0A 2ZJPF 1S7EA 1WJAA 3AG2H 1R36A 5J6XA 5GPCA 4KT6A 2STWA 4ZDPA 1YIOA 1ZGWA 2XHKA 3S15J 2B63J 3I4PA 3ULQB 3N97A 3WE3A 3NARA 3S32A 4OWRB 1FY7A 3PM1A 2GWRA 1BI1A 1J2XA 3AAFA 1B1BA 4ZZLA 5FO5A 1MGTA 4ESJA 3OYEA 4ZDOA 2GM4A 5K5RA 2JA8J 4EM2A 4A5NA 3D5RC 1XMKA 1UFMA 2HYGD 1V5FA 3PFIA 4O6JA 1PJRA 1AA7A 2QM3A 1IJWC 4DBRA 2CO5A 1ZRDA 4A3CJ 1U8BA 4UUVA 2HXIA 1M1EB 2M34A 3KETA 3M8JA 1KONA 2CH0A 2KDOA 2QZ8A 1BC7C 3KEQA 4X0GA 4CUGA 3FF5A 3QP6A 1ETQA 4BL0B 1U8RA 2QQBA 1I3QJ 3DKYA 2NVQJ 3DBLB 1B6AA 3U1KA 4ZYDA 2VQHA 3W6JB 4BHPA 3BOQA 3ZMSA 5J8FA 3HTSB 3ESWB 4F55A 3L2UA 1RKTA 2Y0SN 3FXRA 2A6TA 2VE8A 3HRMA 3G71I 3VOEA 3J80K 3PJRA 1EF4A 3JRDA 1JUMA 1WPKA 1QHHD 2WWYA 2L9RA 3HOVJ 1JKRC 3FISA 4HNTA 5HLHA 2O0YA 3TOBA 5LFAA 1JI8A 4BQOA 1I3AA 2O9LA 3ZPLA 1W7PA 4WX9A 4RM3A 1HQCA 1OCCH 3BJ6A 4C3IJ 1ZR2A 4IPAA 5L3DA 4UVCA 4XL9A 1O3QA 2K9LA 3I56I 1I6HJ 2AXTC 4UUSA 3SQNA 4XKCA 3CP8A 5F0CA 1J75A 1ZG5A 1S9HA 4JBAA 2D1HA 5EYRA 2ZFUA 1MIJA 4Y3OA 1IRGA 5ICCA 4CCLA 2EV0A 1IN6A 4WWCA 1SFEA 5F6FA 1O7LA 4PFPA 5KAFC 4FISA 5D4RA 3F8FA 1R1VA 3MKYB 3HPHA 1APLC 1QQIA 1KA8A 4OIOF 3KPHA 4D7MA 3E1SA 2ZJRF 2CRGA 4KT5C 4GDFA 1ODDA 2RVCA 3IH3A 1VQ7I 2XV4S 4Q47A 3FMSA 4YIFA 2EBIA 3DWLE 4RM2A 1N77A 4NQWA 1OFCX 1R1TA 3L2QA 2ZO4A 1WZ2A 4DYQA 3UNGC 1OCZH 1X19A 4A5MA 4BACA 1K6OA 2E35A 2PMZN 5E3LA 4JX6A 2L0KA 1FMVA 3BTCA 2BHYA 3C2HA 4M9XA 1U5TC 1F1ZA 2VONA 3J7YJ 3FIWA 5LGNA 3CO6C 2LY2A 1YJWI 1YRNB 3H3ZA 4MFDA 1VNDA 2DI3A 5FLVA 1USTA 1FWZA 1FPQA 2QENA 2IAIA 4ZYAA 1RC9A 5TGTA 3ABUA 1J5YA 2FD5A 1RI7A 2DQRA 4AU7A 4CICA 1V5GA 1B8IB 3D1NI 1QZYA 2W57A 3RPUA 2R7SA 1G2HA 4RLFA 2OQRA 4XOTA 1SC7A 1WH7A 3HOXJ 4KITB 4IF4A 3V7SA 2R5ZB 2XF7A 5D8LB 1ULYA 3I71A 2F48A 2LY9A 3BTLA 3S17J 1B4AA 3DEWA 4C9YA 1IXRC 2YSRA 3CDLA 1S8NA 2EJRA 2LKXA 2V1DA 2PEXA 3BTJA 4G8XA 1JJ6C 4MEXF 1Z67A 3LOCA 3L2RA 5B3SH 3WTUC 2HVSA 2CYYA 2FXAA 3HOYJ 4BE2A 3SFIA 2X85A 4E7JA 2GIVA 3M1CA 5AIPA 3M8EA 4DNCA 3ONQA 1K61A 2OU2A 3HSRA 2GXBA 3GEZA 2RQPA 5FD6A 1X58A 4JYKA 5IY5H 3RSNA 4QPQA 3RQIA 1JT6A 1JHHA 3CMEI 1Y1VJ 3G73A 1O3TA 1XG1A 4I6ZA 2IXSA 1RR7A 5DD8A 3BJOA 4HYEA 2DDBA 5FROA 5EF6A 3B6AA 2VJ5A 3H5AA 2WADA 3EPZA 2GBYA 1S7AA 2OZ6A 4RGSA 3BC8A 3HKZN 2OAZA 1HSTA 1LDDA 2H6CA 1UG0A 3P5JA 2HU9A 2YS9A 3I3LA 1Z21A 2FF4A 3TW7A 4XNFA 1KQ9A 1ZAOA 1V55H 1E17A 2LYCA 4IRHA 3T1BA 3K1PA 4OIQF 1TW2A 2OPTA 2P6SA 2GOMA 2L7FP 1D3YA 2D2WA 4XLAA 1UAAA 2F5DA 5JHFA 2O6GE 5IYCJ 3IRRA 4M9ZA 4NC7A 3S16J 4UB6C 3BG5A 3FXKA 4LIUA 3BR0A 2XAGA 3C18A 2W00A 3S3MA 3BG3A 4IQ4A 4M6YA 1MBEA 3OYIA 2LC2A 1T98A 2DU9A 1W5SA 2TCTA 1BR1A 5FLXK 1ZKGA 3I59A 2CV1A 5A2QZ 2KLOA 2OUMA 4LLLA 2DDAA 4XKWA 5J4VA 4WXDA 4HNVA 1FOYA 3SZGA 2R0QC 3F6OA 1FOXA 3OYGA 2F5CA 1HOMA 2VBWA 2R3SA 3EUHC 2Z1DA 2ELJA 2LSOA 4Z6YA 3J7AY 2D5VA 3H5RA 4IHXA 2DJIA 1WJDA 2HPIA 1YS7A 1DGWY 3REOA 5EG0A 3MQ0A 3N05A 4Q48A 1IRFA 3R0JA 2AO9A 4UB8C 2V1NA 5F0HA 2OCEA 2M30A 2Y69H 1X2NA 2DYSH 1FYKA 2VPRA 3AG1H 2GZWA 1JUSA 1R5HA 1YX5A 5L3CA 2E5NA 2G9WA 3FM5A 3OWTA 3SZTA 1N78A 2XDVA 1D8KA 1WFXA 2PMZA 1LPQA 1KGSA 5FFZA 4BQAA 2WAFA 1LVKA 3CDIA 4G7HF 1I50J 5CLSA 4D5FA 3HJEA 1E3OC 2O3FA 1VQ9I 1ZLJA 1DP3A 4E70A 4HDVA 2EIJH 3OS0A 1AKHB 3WE2A 4A6EA 4AIHA 2YU3A 4BE0A 2M9HA 3J80Z 2JA5J 4KIFA 3DPLC 4M71A 3WODF 1MKMA 1MMGA 2IGNA 1XCBA 1P92A 1MMSA 2JK3A 1J0RA 1ETXA 3V4GA 2QSHX 4RB0A 1UB9A 1SFOJ 1SFKA 3MEXA 4XLHA 5E18F 1PDNC 3PSIA 1YO5C 4J00A 1SVMA 3CJTB 1A6IA 3TEDA 3CCLI 2BE5F 3G1LA 3P9KA 3OOPA 3BP8A 1RETA 2XSJC 2W1OA 4UNOA 2Z5UA 4BYYA 2ZMEC 2LF8A 4U7DA 4D0PA 2VKDA 3IL2A 3OIPA 1OMIA 5ILSA 4LB5A 3E6CC 3AG4H 3MVPA 1R5ID 1SMTA 2P6TA 1ZRCA 4KA4A 4HAMA 1U78A 2ID6A 5GAGJ 2JZYA 4RLQA 3COAC 3IH4A 3IV5A 2XGXA 4M3GA 4CA0A 1MNDA 3T0YA 4HV6A 4LG0A 1U3EM 1Z91A 2I10A 1P7IA 2VB6A 4PSWA 4LITA 2ZSHB 2NVUB 2EZLA 3FZVA 3BDDA 3CCVI 5GAEJ 1H9GA 2A61A 3V8LA 3S3NA 5GP9A 1Y0UA 2VUMJ 2KJCA 4NUBA 5CVVA 3ROUA 2IGMA 1U5TA 3HPGA 2CUJA 5BOXA 2YUSA 4CCMA 4LG3A 2KT0A 1GXQA 1YS6A 1FEXA 1ACIA 3FXMA 4M3EA 4HF1A 1D1CA 3GZNB 1PUFA 5EEGA 1TWFJ 5E8IA 1BR2A 1QU3A 3CCQI 4MO7A 2XIGA 3LSKA 5KVRA 2ZFWA 1NTCA 3QYBA 5E3NA 4DZPA 3S93A 2M2EA 2R7QA 3M8FA 2DLLA 3X2QH 4AUXA 4PJ0C 3R6SA 2G7UA 1RIOH 3IRQA 2HQAA 4AM3A 3ERMA 3ELKA 3K4KA 4E7SA 2LLKA 4HOBA 1NHAA 1EH7A 3HZJA 1WVRA 2LF7A 5LHIA 1FZPB 2UXXA 3K7AJ 3LAPA 4ZTFA 5CYVA 3H9JA 3Q9VA 2X1DA 4AVZA 4IOCF 2DOFA 4J01A 4IHTA 4B48A 4HW0A 3J7AO 3QPHA 2HDCA 4I98B 1GHCA 1U0JA 3QYEA 2MD5A 4AYBA 2LNBA 3OYLA 3FXUA 4LJZF 2NXNB 2DA3A 2F4MB 2OCCH 4HZFA 1BR4A 2BVLA 4GFBA 1FNNA 3H1CA 3J7ZI 4A3KJ 4IRGA 2IA1A 4ZC3A 2JTVA 1HF0A 1BL0A 4HV5A 2KFDA 3U2RA 4Y33A 4BAYA 1N25A 4V2GA 4OINF 2M1BA 1FIPA 1IZ1A 3HHHA 3K10A 1X4OA 4XRMA 3SZPA 4BU2A 1XMAA 3GLLA 3OR2C 5LEJA 2JJ7A 4PZJA 3GTQJ 4RB1A 2DA1A 4QPOA 1G3SA 2OF7A 2QVOA 3I4MJ 4RAGA 5IT3A 1KYZA 1IN8A 1FTTA 4I0BA 4BS9A 5ILUA 1MSFC 1RZ4A 3TGNA 4R8HA 3HG9A 3QODA 4P1WA 3B02A 4XKVA 1TWHJ 1OCRH 3RKYA 2ZNZA 3K70D 1K83J 2ZXWH 3ASOH 3E7LA 3UR3C 2EILH 3WTWC 4EEFG 1FMWA 4NQWB 2X4HA 2EA4A 2BW3A 2XF6A 3DU5A 3FK7A 4X6AJ 5JLXA 2H1KA 5K1YA 3P9IA 3DPTA 2DMPA 2YX4A 3M3YJ 3SYTA 2CQQA 1LUJB 2FBHA 1ZREA 3EUHA 2XKOA 1UHSA 1TQPA 3E5XA 3JTGA 3HSFA 1J7KA 1VQMI 1D0XA 2ECBA 1R71A 3OYFA 2HQ5A 1VI0A 2BZTA 3LFUA 2FU4A 4MLOA 1SFUA 1SEUA 1HW1A 2J5OA 4YFNF 2DJNA 4AIDA 2P7VB 1JKOC 1OYWA 4G7OF 1O7FA 3LL7A 1T08B 4ZH4F 2JSCA 1FJLA 1YW8A 1X1PA 2FQ4A 3JSPA 3NWTA 1DPUA 3LSMA 5GPAA 3ZQ7A 3ABLH 2H6BA 5L3FA 2G7HA 2UXNA 2WY7Q 4CSWA 4IXAA 2XAQA 2E71A 2DTZA 2E1CA 1XSXA 2HPMA 2WAQA 1MJ9A 1P6RA 4GYIA 2XRNA 4M3FA 4HF0A 4XRSA 1SD4A 5BPDA 4A3FJ 5IYBJ 3VEPA 2M8EA 4RB3C 4KJZA 2QA4I 4P9UA 2DFEA 3OY9A 3TQNA 4A3JJ 3G3ZA 1BM9A 4A3BJ 5LGUA 1PVEA 2IJLA 1IDZA 4BKXA 2W48A 3PUBA 2XPVA 3GX4X 2FRHA 1X3UA 2V9VA 5DYMA 1KU2A 4CZZA 2L9SA 3GTKJ 2QUFA 2VIXA 2WAEA 2HYFA 1WQ2A 2CG4A 4M73A 4ZDLA 5LRSA 2EIMH 5M5WJ 2E1MC 2BY3A 1WGXA 2K5CA 3R60A 3DP7A 1I6XA 2F5EA 3IWZA 3NEUA 1K78A 3EUKL 3DKXA 1T2KA 2ZMEA 3DQVC 2Z99A 5CKTA 5M5XJ 1B59A 4C2MJ 4WXHA 2BY0A 1HBXG 1XCVA 3DBHB 3EDPA 2QCOA 2MLKA 1GV5A 1BC8C 1TQMA 2E7WA 2WY8Q 1ZG1A 1J59A 3FBNB 2VBZA 1F43A 5DV5A 3I55I 2W25A 2DO7A 3K4JA 3F6VA 3QU3A 3ZOBA 5E20A 1R1UA 4ZYEA 3I5UA 2XAJA 5DDGA 2EB7A 5A2QK 3TP3A 4G6TB 4QSHA 1WRJA 3ZR8X 3MAJA 1XMXA 3QWLA 1IAWA 5FLMJ 4HEA2 3FMQA 4G94A 2M45A 5ERIA 3M7GA 4AD9A 2K4BA 5EGOA 1I1SA 4ITVA 1OR7C 2P8TA 2FBIA 1FP1D 1X3WB 4ABZA 1BN5A 2P5VA 2V9KA 5C3EJ 2FMLA 3I59B 4Y15A 2R7WA 1H8AC 3TBIA 2MD0A 3C3WA 4FCYA 4U7BA 1MD0A 4AC0A 4A12A 3V42A 1LEBA 1AOYA 1MBFA 2DA5A 3BQYA 5IP9J 2EFPA 1P9QC 3S14J 2DPUA 4A2UA 3GVAA 1JTYA 3ABMH 3HYIA 3D5SC 4L9NA 4BNCA 1BIAA 3A01A 1Z6RA 3ZQLA 2ZBKA 3U21A 4LK0F 3KLOA 5H20A 5EG0B 4DJAA 1OCTC 4E7KA 4E7ZA 2L7ZA 3S1NJ 3CUOA 5L3GA 1IN5A 1ZRFA 4BDZA 4ENKA 1TC3C 3K0LA 3L2VA 2X6WA 5ICFA 1R7JA 4HX4A 1VQLI 3VODA 5F1RA 1ZGAA 2I5UA 2CS3A 2VI6A 3PQJA 4U88A 1LFPA 3ABKH 2CU7A 4MHGA 4BXFA 2D45A 1CGPA 1GDTA 2BVMA 2COBA 1MBGA 3HHGA 5FRMA 1XSDA 1Z7UA 1TW3A 2F2EA 2X9DA 3L09A 3U9GA 5KK1A 2ME0A 3LSJA 4QWQA 1IF1A 1DPRA 4MTDA 1WSUA 4HRIA 3CF5F 4GYGA 2JVHA 1IXCA 5TISC 1Q1HA 2Q8KA 5M3MJ 3VPRA 1H88C 3OSGA 3KZZA 1ETOA 2EA2A 5DCFA 3CCJI 1IN4A 4P55A 3MWMA 2VL8A 1R58A 2F4IA 3EYIA 3Q9SA 4I2OA 4DOZA 5KHDA 1SANA 3SEZA 3J81Z 2JVGA 1HXDA 2AS5F 2VT2A 2M8GX 4YRVA 4EGZA 2EV5A 4YEJA 2RN7A 4ZTJA 4CH7A 3BLYA 3GTJJ 2DODA 3BR5A 4CCKA 1JE8A 2KRCA 4PJNA 4BQQA 2COMA 3DXJF 2ZSIB 4F93B 3MZHA 5JFRA 2DA7A 3HTUA 4OOIA 2OA4A 2JRMA 3JSOA 2CV2A 3QOEA 2JA2A 4LG0B 3OYKA 1TZLA 3I54A 4C3JJ 1P7JA 5HLTA 3ZP5A 3SJMA 4MEYF 1B72A 3WU0A 2QEXI 2RREA 1WKMA 4U0WA 2VC1A 4A0YA 3S2WA 3RPUD 5FB2A 4XMYA 4KIBA 4B44A 2CUEA 4M6XA 3FK6A 3DV8A 3WHCA 3IWFA 3MN2A 3NRVA 5FKLA 4BJ6C 1U5TB 1W4MA 1QVTA 3CJQB 2XC7A 1S72I 2E1NA 3VYRB 1JTXA 2Z16A 3SDGA 2O7OA 4IX7A 2W7NA 3T8RA 1QPIA 1PUFB 1D0YA 2P0WA 1Y8QB 4F52A 3H35A 1ON2A 3LA2A 2CQKA 4ETSA 4IEJA 4RBOA 5BQTA 3WTSC 3PIPF 1OYYA 4IL6C 5LEKA 1XGOA 2DBBA 4XLCA 2YU9J 2Z3YA 3SHFA 3HUGA 2CQ7A 1GT0C 2IPQX 1ETYA 2E1OA 1JUPA 3P7NA 3Q0UA 5BPIA 4U87A 3TO9A 4I7HA 2H8RA 3Q0VA 3BWGA 4NC6A 1OKRA 1IXSB 2LVSA 1LQ1A 3JRFA 2JUGA 1E0EA 1Z77A 3MFKA 2R7VA 4XN0A 1WJFA 3HDDA 3CLOA 3E6BA 3G1OA 2RQQA 1NK2P 2X48A 4BBRJ 1K6YA 2W84A 3KLNA 3FXOA 3R61A 3H92A 3CO7C 3CCEI 4BDYA 1ZYRF 4PUSA 3A0BC 4YELA 5J40A 1LE8A 4EM0B 4L5EA 2ISZA 4JK1X 4XLFA 4ZYHA 3Q3SA 1RKWA 3WTYC 3JREA 3OYMA 2CQNA 1DGRM 1H9TA 1RESA 3DTKA 1D0ZA 2MSYA 3FBIB 4HX8A 4LGWA 1TTYA 1MJBA 4A0XA 1R49A 3GWZA 1I27A 1XX5A 2KIQA 1YJNI 3GMEA 4BBSJ 3PNVA 2V1XA 3IH2A 3V7CA 1XGNA 2Y0MA 4N0BA 1LDKB 4RS8A 2JRTA 2ISYA 2WB1A 5LHHA 1QZEA 2XB0X 1TNTA 2DMNA 2DOAA 4EVIA 2HR3A 4B3AA 3FWEA 4Y52J 4Q5SF 2NS8A 3M1EA 1IG7A 5LRRA 3GTLJ 4DYRA 5K7ZA 4RGUA 3JAMZ 4ZJZA 2FMYA 3S1QJ 3MZYA 2L7MP 1MSEC 3BROA 3G4SI 3CD6I 1SD7A 2QYOA 5C4XJ 3HIFA 3HRUA 3FXJA 5FKKA 2STTA 5D5XB 4CO8A 4AIKA 1FOWA 1V3FA 4Y17A 1BOAA 1FC3A 5JHUA 3L7WA 3QU6A 2EWNA 2W85A 2QKLB 3OYJA 2Z9OA 1QHGA 2PQ8A 3OYAA 1OR7A 5CVUA 1TWCJ 2DA6A 3BG6A 2FSWA 3ZQIA 4U0YA 2LR8A 2BW3B 5D5UB 1Z7LA 2L7KA 2JUCA 3WTTC 2PMUA 5ICGA 1MJAA 2E2JJ 1VQ6I 2P5KA 2E2IJ 3VYUB 3IKTA 3DU6A 1I5ZA 1UHMA 1FSEA 1KU3A 1X1CA 2JSPA 1YLFA 2KQRA 5CQGA 5BS6A 5HS8A 5JR3A 5DD4A 1ZTRA 5K5OA 2JT1A 3E0JB 4HSTA 5FKNA 1PUEE 4AYBN 3RKQA 5ICEA 5EZHA 4ZZDA 4ESFA 4MNUA 4DBQA 2CUFA 2KHMA 4PFOA 3VDXA 3H0GJ 3B73A 3CF2A 4ANJA 2Q2EB 5EDNA 3CCRI 2A07F 3RKXA 1BJAA 1OISA 3H36A 1LNWA 5HNHA 3RDIA 4HX7A 2VXDA 2HWVA 2J5PA 3O8HA 3OIQA 1F4KA 1SD5A 5GAHJ 3LNQA 4XLPF 4F7ZA 3FMRA 2G0EA 3R0AA 1UG2A 1JKPC 2LH9A 3CCYA 4RA2A 4D1QA 2DA4A 2QSGX 3GFLA 3L2WA 2BHZA 3HL2A 1IRXA 4ENNA 1VTNC 2B9SA 2IP2A 4MGRA 1KU9A 3K4LA 1RRJA 2GXGA 2EPFA 2X1EA 2ZXJA 4LMYA 5E3OA 4DQ2A 2UV1A 2HVQA 2M87A 1FLIA 2L5QA 4WCGA 3JRIA 4B09A 3TOAA 2ACJA 3GXOA 1OLTA 4XRFA 1X4PA 4KDPA 2K9MA 3JRCA 5JVTA 1OYIA 3GFJA 5F0FA 1Z0XA 1T95A 2BXYA 2IVMA 1STZA 1K78B 2VOOA 3VSKA 2ZMEB 3HGYA 2V9PA 4RDUA 3TW6A 5CPRB 4IRIA 4UV9A 3ML6A 3HB9A 3K2AA 1YJ9I 4BEHA 1KQ8A 2ZCWA 2QQAA 1ZGJA 2PMHA 2PLYA 1SVLA 1IW7F 5ILVA 1OCOH 1JGSA 2M5WA 1ZN2A 2OJED 1E2XA 4FETA 5DTDA 2LREA 2V6EA 1W36C 1ERDA 2EFNA 2MW8A 1SMYF 3S2HJ 2L3DA 3BJAA 2MABA 5CJ9A 3H9GA 4L9TA 4OAZA 3RZOJ 4EJUA 3BPVA 1ETKA 3S8PA 2XF5A 3P9CA 4CZCA 2JA6J 2WAQN 3ZQCA 1B9MA 3IHUA 3KYDB 2E36A 3TO7A 2DFIA 1ZLKA 3HC7A 1IC8A 2OTLI 2PJRA 2Y75A 3QP5A 4EGYA 1XC5A 3V8KA 1Y1WJ 4BHCA 4NNJA 2DMTA 4MQVA 4B1RA 2VE9A 3EETA 5BMZA 3LSIA 3VWBA 4AIJA 2XGDA 3LQRA 1YOVB 3KIOA 3WU1B 2CW7A 2HOSA 1S29A 3RI4A 5HS7A 3KP4A 2L2OA 2K86A 3E5QA 2VT3A 5K7FA 3F72A 1T56A 3CMMA 4P96A 2PN6A 5IOYA 2FOKA 5CVIA 2NOJB 1D1BA 5KNLA 1BI0A 1Y6IA 1MH3A 4FX4A 1R4NB 4XLEA 1K79A 2LY1A 2VBXA 1YE9A 1GV2A 4XK4A 2DMUA 1Y56A 1SVOA 3GTGJ 1FT9A 2K3PA 3CUQC 5LHGA 5JLWA 1XD7A 2LKSA 3MKLA 2EFOA 2JA7J 2XVCA 1VF9A 5D6EA 3OIOA 1WI3A 4HA8A 2IEKA 2HI3A 3KZYA 3T8TA 5E8GA 3OSFA 3BR6A 2PFBA 4PK4A 1FYMA 1XSVA 4XSZF 2ME6A 1ETVA 3CMAI 3J81K 1W7PB 4A93J 2IRFG 1FP2A 2L02A 2V4JC 2GLOA 3CC7I 2E60A 4IOAF 3U1DA 3LA7A 3TDZC 5J47A 5EZGA 4B47A 4LIVA 2OV7A 3N4MA 4UUSB 1IO2A 2KIUA 4UVBA 4Y4RA 3RYRA 3HOSA 4IHWA 5KAIC 4YIRX 4E6KG 2XROA 5HDNA 2NS7A 4I0AA 4FE4A 2NOGA 2X6XA 3OOUA 2JPBA 1FTZA 3OL3A 3ASNH 1RNLA 3WHBA 1GVJA 5M3FJ 4ENMA 2YPRA 3CJRB 3VSLA 2JN6A 2HEOA 2OC6A 4ENJA 4NBQA 3LSTA 2DW4A 2DT5A 4UVAA 5C4JJ 1DU0A 4A69C 2ZC2A 2TDXA 3LSRA 4NB5A 2M0CA 1P4AA 3A4CA 2M4GA 4M74A 4V19K 1YI2I 2VBYA 1TL8A 2DFHA 5CQEA 2XUBA 4XBFA 2D1VA 2IGKA 2PJPA 3FHNA 5LD2C 1LFBA 3KEOA 2BY2A 2CMPA 2V26A 2ETHA 2AQFA 3LFKA 3ZXSA 1B72B 1WH5A 2JMWA 4BHBA 2VQLA 3PNTA 2KJBA 5D5WB 3ZRGA 4CDGA 1H0MA 2IS6A 5KCMA 1D5YA 2RDPA 1JHFA 3GZ5A 2MG4A 3ZMUA 2EK5A 1XTAA 5D5VB 3AKZA 2E34A 1G8XA 4BH9A 4R1HA 2HDDA 4KMFA 4MTEA 1E3PA 1MBHA 2KRHA 2CFOA 3GTMJ 4CXFA 4LOCA 1TBXA 2EV6A 3RTRA 2P81A 3R4KA 2L9VA 2QWWA 3GYHX 4JQFA 4B43A 2MYSA 3ZQFA 4EJTA 5EEHA 2K9NA 2VJ4A 2WA0A 2ESHA 2OZUA 1TT5B 1GUUA 3LSGA 3W2WA 2VXZA 2BYVE 4XOPA 2GOXB 2UUZA 3LQQA 4PGGA 3DBRB 2RNJA 1XN7A 4GXOA 1G6NA 2HXOA 2V79A 4K2EA 5IPAA 3F22A 1CQTA 3GBGA 3AL0C 3I4NJ 1EKEA 4JX5A 2VASA 2P7CB 1TQIA 1R00A 3ISPA 1YIJI 3G2BA 4XKBA 3OV8A 2ECCA 5F27A 3PNYA 3HOZJ 2RGVA 1QO0D 4EM1A 2LDUA 3HRSA 2DCEA 4I01A 2VPLA 2EFQA 2KDZA 1BI2A 2ELHA 3OR1C 3LSPA 3I9V2 2E1MB 4UV8A 2RAEA 2MC4A 1W36D 1V4RA 4UY8I 4M3DA 2EQRA 3GFIA 4Z2YA 4IO9F 3JAMK 5F04A 2LD5A 1EJ9A 1UELB 2LMDA 4B4CA 1TWAJ 3DLLF 2LBFA 3VYSB 2CW0F 3QYFA 1USSA 3BY6A 3S1MJ 3JRAA 4QIWN 1JT0A 2HNHA 5F08A 2CWEA 1IN7A 2VQCA 5DEQA 1YG2A 2L4MA 4A3EJ 4X1EA 3BG9A 2HTSA 4PSXA 2Y9YA 5IT9Z 3DTIA 3OYHA 1PP8F 1JGGA 3JRBA 5FKMA 2DPDA 4CYDA 2C6YA 1X1BA 3BT9A 1W0UA 4C2UA 1WJEA 2BXZA 2DTRA 5J1RA 2QLZA 3BG7A 2DK8A 4FX0A 2LOOA 2UWMA 3V8JA 1R23A 2JWTA 1FYLA 1DUXC 1FBQA 3HBLA 1R5GA 1BA5A 2EINH 2V7FA 3ZN0A 3AG3H 3K2ZA 4F3QA 2XSDC 3GW2A 3BR2A 4A6DA 3H5NA 1ITYA 5DUIA 2MGQA 4S0HB 3PFYA 1GVDA 4G12A 2V1UA 3OS2A 3RZDJ 2OQGA 4NHJA 2ZJQF 1G3TA 2YR2A 1T39A 1YQAA 2AHQA 3Q0WA 2LP0A 5EJCA 1A5JA 3K4NA 3H9QA 4HSRA 1Y39A 3LWFA 2A6HF 2L54A 2NVTJ 1ZARA 1EA3A 1R6RA 2NAZA 1W7PD 2WC2A 4LFUA 1W5CC 5FRNA 4E7HA 1WJCA 1YYVA 1XDUA 3O3KA 1VQ8I 2GA1A 1HKSA 3GFMA 1GLNA 1S3JA 2CUZA 5HOOA 3HRTA 5CVJA 4KYWA 2IS1A 4G6QA 3CUQA 4JX4A 4RAYA 2EIKH 2WB1N 5H6RA 3LA3A 2Y9ZA 4IKFA 3QPSA 5DCMA 1POGA 4KN7X 4QLCU 5IOZA 2ZXIA 5DS9A 1CF7A 2A6EF 3C1DA 1A31A 4DYCA 2XPWA 3IAM2 3K4MA 1MMDA 1SD6A 2XRLA 2E2HJ 3VYTB 3L1PA 1U9NA 5B1BH 4EJWA 4ON0A 4IZZA 4BY7J 2KKOA 4D5CA 5H6QA 2HQRA 3O6BB 1UMQA 2VKHA 3OMYA 1K4TA 5L3BA 1Z3XA 1MMAA 4KISA 4HBLA 2QQ9A 1A6QA 2VKVA 5C44J 1BOBA 3MZ8A 3QPTA 4W1UA 4M3BA 3RIRA 2KMUA 2DT6A 4H0EA 3Q5FA 4HPQA 4N9HA 2ELKA 2MA3A 2L4AA 4EATA 1NH3A 4M9SA 5HNFA 1BW5A 4JP0A 4EQQA 3K6GA 2FA5A 2O61A 2FEZA 3KX2A 1F9NA 2P5LC 4RAZA 1NG7A 2ID3A 3ZMDA 3WTVC 4XICA 2EFWA 1LB2A 2R7FA 4N4NB 4BEHB 3GF2A 4GRIA 1WJBA 3F23A 2H1LA 2HTJA 2VN2A 2ZJ2A 4BUPA 3ABTA 4G7ZF 1ZQ3P 3CC2I 3KE2A 3RPQA 3ECOA 2KIMA 1A35A 9ANTA 5TJJA 2IS4A 1R9TJ 1MDMA 2DAOA 5ED4A 5E1XA 5J1YA 3CMYA 5GTIC 2R93J 2K3FA 5E79C 1XGSA 1TNSA 1T38A 3BQZA 2LRDA 1ZG3A 4Y7NJ 2K7LA 3I0TA 1IDYA 3GLXA 3JRHA 4L9VA 1Z6TA 1W1WE 2DXIA 4H4KC 2NNNA 2H09A 3KFWX 2PJRB 4XM3A 1G4DA 3NWSA 1YHQI 3F8CA 4KIGA 3ZN1A 3GTOJ 1GXPA 4Q4ZF 3GZ6A 3QOPA 4FQGA 2O8XA 4O5VA 2QBYA 1YW7A 4IVNA 2JPCA 1XDSA 1U6GA 1P4XA 5FFXA 3KYCB 4RMNA 3T5XA 3GCMA 1HCRA 2NVXJ 2K02A 3WTXC 3CQZJ 2O03A 2ZXHA 3TP0A 2KISA 4G9YA 2W4SA 4NDLA 2DFFA 4CYCA 5JVGF 4D9JA 2R7TA 3RKWA 2A5WA 4Y13A 3DFGA 2MH2A 4RB2C 3QRFF 1QZZA 4C30A 1OQYA 6PAXA 1PYVA 3F8NA 1YFHA 1SAXA 1J9IA 1QBJA 2H94A 5EEAA 4XLNF
chains in the Genus database with same CATH topology
3G6EI 3I55I 2E35A 3CCVI 5GAEJ 1YITI 1VQ5I 1HC8A 4UY8I 3J7YJ 2FOWA 4IO9F 1YJWI 1FOXA 1FOYA 3G4SI 3DLLF 3CD6I 1YJ9I 1FOWA 1ACIA 2QEXI 1VQ4I 3CCQI 4V19K 1VQMI 1YI2I 3CCSI 1VQOI 3G71I 1S72I 1VQ6I 3CC2I 2E36A 2JQ7A 3CC4I 2OTLI 1VQKI 3PIPF 2K3FA 2E34A 1VQ9I 4IOCF 5DM6F 3I56I 1VQLI 2ZJQF 3CMEI 1VQPI 1QA6A 2H8WA 3CCRI 5DM7F 2QA4I 2NXNB 1YHQI 1VQNI 2OTJI 1MMSA 5GADJ 1Y39A 3J7ZI 5GAHJ 3CJTB 3CF5F 3PIOF 3CCLI 1VQ8I 3CCEI 2ZJPF 5JVGF 3CCJI 2ZJRF 1VQ7I 1YIJI 3CMAI 5GAGJ 3CCMI 1YJNI 3CC7I 4IOAF 3CCUI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E I;  3I55 I;  2E35 A;  3CCV I;  5GAE J;  1YIT I;  1VQ5 I;  1HC8 A;  4UY8 I;  3J7Y J;  2FOW A;  4IO9 F;  1YJW I;  1FOX A;  1FOY A;  3G4S I;  3DLL F;  3CD6 I;  1YJ9 I;  1FOW A;  1ACI A;  2QEX I;  1VQ4 I;  3CCQ I;  4V19 K;  1VQM I;  1YI2 I;  3CCS I;  1VQO I;  3G71 I;  1S72 I;  1VQ6 I;  3CC2 I;  2E36 A;  2JQ7 A;  3CC4 I;  2OTL I;  1VQK I;  3PIP F;  2K3F A;  2E34 A;  1VQ9 I;  4IOC F;  5DM6 F;  3I56 I;  1VQL I;  2ZJQ F;  3CME I;  1VQP I;  1QA6 A;  2H8W A;  3CCR I;  5DM7 F;  2QA4 I;  2NXN B;  1YHQ I;  1VQN I;  2OTJ I;  1MMS A;  5GAD J;  1Y39 A;  3J7Z I;  5GAH J;  3CJT B;  3CF5 F;  3PIO F;  3CCL I;  1VQ8 I;  3CCE I;  2ZJP F;  5JVG F;  3CCJ I;  2ZJR F;  1VQ7 I;  1YIJ I;  3CMA I;  5GAG J;  3CCM I;  1YJN I;  3CC7 I;  4IOA F;  3CCU I; 
#chains in the Genus database with same CATH topology
 2IA0 A;  4TV7 A;  5E1Z B;  4ESB A;  2QKM B;  3ZGK A;  1U2W A;  3RJP A;  1T6S A;  2E5Z A;  4E4H A;  1WI9 A;  3SDB A;  4A3L J;  4QTR A;  2TRT A;  1LFU P;  3K4C A;  1RR8 C;  3BR3 A;  2ADU A;  3TMO A;  3H0D A;  3TO6 A;  1MBK A;  1EV7 A;  3IC7 A;  3WTZ A;  2CW8 A;  2IA2 A;  2IW5 A;  2M7A A;  3PSF A;  3W2A A;  2E7X A;  3SEQ A;  2E19 A;  2LG4 A;  1I1G A;  3BCA A;  2Q0O A;  2FJ1 A;  1WCM J;  2DYR H;  4L0Y B;  1L3L A;  3E97 A;  3PL8 A;  2O5R A;  4EJO A;  1DU6 A;  3CJN A;  4EV0 A;  5HDK A;  3F21 A;  1FIA A;  1WHU A;  1SAU A;  1BI3 A;  2F4O B;  3S1R J;  1JKQ C;  2R7U A;  1O4X A;  4HF2 A;  3BR1 A;  4J19 A;  1BIB A;  2VOP A;  2FNP A;  3HOU J;  4PJJ A;  2HOE A;  2KL4 A;  1A36 A;  1IV8 A;  5CVR A;  2YX7 A;  1MNE A;  2HZD A;  4C3H J;  2QSF X;  5FJ8 J;  2NNY A;  2CJJ A;  3ZQQ A;  2Y30 A;  4L0Z B;  4WK8 F;  3OS1 A;  3D0S A;  4YII A;  2CV0 A;  1Z05 A;  4OU0 A;  2R92 J;  2HVR A;  3DEE A;  2R5Y A;  2PBI A;  2M7B A;  2WTE A;  2Y0S A;  1VQK I;  2GIZ A;  2HFH A;  2XAS A;  2FNA A;  5GTH C;  2R4G A;  4I09 A;  4V2F A;  4L18 B;  1QNT A;  4R79 A;  2A05 A;  2F5F A;  4CHU A;  1P4W A;  3BZC A;  3O2P E;  4BY1 J;  3GO5 A;  3D5L A;  4OIR F;  5TRD A;  4A3M J;  4OMY A;  4LLN A;  2X0L A;  4LLG F;  1VQP I;  4S05 A;  2FBK A;  2IS2 A;  1ETW A;  1HW2 A;  3OYC A;  1QVU A;  3MMY B;  3DEU A;  5DM7 F;  2L01 A;  1VQN I;  4GO1 A;  4HLY A;  3L9F A;  2RKH A;  4I76 A;  4PJL A;  1H89 C;  1ZR4 A;  2QF7 A;  3PO3 J;  3QQA A;  5J4Y A;  2ESN A;  3PIO F;  1NG6 A;  2F6C A;  1REP C;  2VKE A;  4N9I A;  5H2F C;  1MW7 A;  3F8M A;  4HG2 A;  1AHD P;  4YFX F;  4WXC A;  1T0F C;  4C2T A;  3C7J A;  2BBY A;  2EZK A;  3W6K B;  2R7R A;  2WV0 A;  5DUK A;  5M5Y J;  3AFH A;  3VFZ A;  4N4O B;  4BJ5 C;  4AWX B;  4B3X A;  4WF2 A;  3FDY A;  5FD5 A;  2LTP A;  3DCF A;  1F36 A;  4MIM A;  1QRY A;  4S04 A;  2NVY J;  3CCM I;  4DGW B;  4CCJ A;  1V5E A;  3HM5 A;  4FE7 A;  1Q1V A;  3KP5 A;  1WJ5 A;  5B1A H;  5HLI A;  4LD5 A;  1DQU A;  3G6E I;  3K70 C;  4O3M A;  2MFZ A;  1WWX A;  3KYL A;  2XAH A;  2DK5 A;  2XKP A;  2VLA A;  4FT8 A;  4BE1 A;  2PI0 A;  2R7X A;  3F8B A;  4W97 A;  5J1U A;  3JR9 A;  1JJ8 C;  1FX7 A;  2P4W A;  4IHS A;  3RCO A;  1HC8 A;  4HLX A;  3ZQG A;  4FHT A;  1QGP A;  1S7O A;  3OYD A;  2ICW G;  3FXL A;  1R4M B;  2X1C A;  2LKP A;  3C2G A;  1HDD C;  3CTA A;  1XS9 A;  4EJV A;  4BXX J;  1S5L C;  3S2D J;  2L9N A;  3F9K A;  3H3V K;  3M07 A;  4BQN A;  3QAH A;  3BCB A;  1RPW A;  3S3O A;  1Z9C A;  3HOW J;  2PX9 A;  2VC0 A;  2X6O A;  5IT9 K;  1YX3 A;  3EUA A;  1TT0 A;  3WG9 A;  3ZMT A;  4KIC A;  2LBF B;  4UUT A;  2CQX A;  1B9N A;  4XON A;  3K1M A;  4XID A;  4E7L A;  3F3X A;  2HZT A;  1ZEL A;  4CCO A;  1HDP A;  1FSH A;  4II2 A;  2O8K A;  4PJM A;  3H3U A;  2KIF A;  1G59 A;  3A2K A;  1UJ8 A;  1L0O C;  3SFZ A;  5AON A;  2QQ8 A;  2KRF A;  5DM6 F;  2I8D A;  3IAS 2;  2XAF A;  2K40 A;  3A1Y A;  1TP4 A;  2KPM A;  2WBM A;  3KEY A;  2BY1 A;  5D6F A;  3UKG A;  1LJ9 A;  1RUO A;  4D7N A;  2DMQ A;  3KP2 A;  4IJA A;  2EH3 A;  5HOD A;  1ENH A;  2R7Z J;  1P2F A;  2GA2 A;  2N8G A;  5EGO B;  4CGZ A;  2OTJ I;  2XPU A;  5K5Q A;  5LBQ A;  4GCV A;  2Q1Z B;  4I02 A;  2VJI A;  5E3M A;  4XOR A;  5J3L A;  4HDU A;  2B7E A;  1OCP A;  1TWG J;  1Y0N A;  2FE3 A;  5BNG A;  1BBY A;  1S6L A;  1ONV A;  2HGC A;  1MBJ A;  2HOA A;  5FKO A;  3WGH A;  2DQL A;  2K27 A;  3HOT A;  3NQO A;  3C2B A;  4EMS A;  3A01 B;  2BV6 A;  3HKZ A;  3CES A;  4L5J A;  2NYX A;  3RYP A;  4LB6 B;  3A0H C;  4DIQ A;  2FX0 A;  2MH9 A;  1YW9 A;  4XQF A;  1ZH5 A;  2XGE A;  1HA8 A;  3BZK A;  1DP7 P;  2KZG A;  4OAY A;  4CCN A;  2ZNY A;  1YRN A;  3PUF A;  4IHV A;  1KU7 A;  1J09 A;  3MKZ A;  1W5T A;  1UCR A;  1F5T A;  5F64 A;  4UXN A;  4G6D A;  3V7R A;  3I64 A;  3CUQ B;  2V6C A;  2HOT A;  3JW4 A;  4ZYG A;  2A3S A;  2HQN A;  1HSJ A;  1I39 A;  4UHT A;  4A0Z A;  3QPL A;  3WGG A;  1B8I A;  5DCM B;  4F92 B;  2FOW A;  3CP2 A;  1MH4 A;  5JI6 A;  1CF7 B;  1O3R A;  1AU7 A;  4GGG A;  4JOM A;  1LKX A;  4DZJ A;  2R5Z A;  3FKI J;  4HQE A;  3HXL A;  2GAU A;  1RUN A;  3G1M A;  2IBD A;  1V54 H;  1IGN A;  1MNM C;  2Y48 A;  4A3G J;  2X51 A;  1XGM A;  2CFX A;  3KCC A;  4PDK A;  4YG2 F;  2B0L A;  3KP7 A;  1KYW A;  3EQL F;  4U0V A;  1QPM A;  3CCS I;  4LK1 F;  1VQO I;  5L3E A;  1D8J A;  1A04 A;  2MLG A;  2IGO A;  3DPU A;  5HLG A;  1X3Z B;  1OJL A;  3BZ6 A;  1ZK8 A;  2XAU A;  3ERE D;  2XGC A;  1D5V A;  3MD2 A;  3CC4 I;  5AIQ A;  2X6Y A;  2VOD A;  1TLH B;  5HVQ C;  3ZQH A;  2HDW A;  5LLQ A;  2RV8 A;  2KP6 A;  1G3W A;  2K85 A;  4A3I J;  1X2M A;  2DT7 B;  3RQ4 A;  3K1N A;  4KN4 X;  1DDN A;  3IKV A;  4BGD A;  1NK3 P;  4NC8 A;  4OIP F;  3FXQ A;  4HNU A;  2Z33 A;  3I58 A;  4II3 A;  3JRG A;  2DN0 A;  5J8C A;  3F0C A;  1PP7 U;  1JXS A;  2BOL A;  2PG4 A;  3BPX A;  3E6M A;  3SXY A;  5IYD J;  4DW6 A;  1UZC A;  1MDM B;  1W0T A;  3W3C A;  3LMM A;  4L5I A;  4M72 A;  3LSH A;  2A68 F;  3I53 A;  3GUD A;  4XN3 A;  4IQJ A;  1O57 A;  5LGT A;  1N75 A;  4XR6 A;  3VB2 A;  2IT0 A;  3HEF A;  4F91 B;  1D1A A;  2HS5 A;  1E3H A;  2BEO A;  3DTE A;  4FAS D;  3OL4 A;  2F5V A;  3E5U A;  2OD5 A;  1IUY A;  3CZ6 A;  5D8K B;  5FGM A;  1T0F A;  3MKW B;  3ZCO A;  2A69 F;  3E6D A;  4PGH A;  2QBY B;  2R7O A;  3JCU C;  3WG7 H;  4A3D J;  4PCQ A;  3DKW A;  2WV1 A;  1IV6 A;  3K4B A;  5IP6 A;  5B66 C;  3CCU I;  1MZB A;  1XB4 A;  3KP6 A;  1VZ0 A;  4CYC B;  4XRS G;  3HUG B;  3OYN A;  1BW6 A;  2M4K A;  5HDG A;  1Z3Y A;  1SFX A;  4RGR A;  3B6C A;  1LEA A;  3O8G A;  3TL4 X;  1T8I A;  3E3V A;  1LDJ A;  1G3Y A;  2ZKZ A;  2VQG A;  3OYB A;  3EYY A;  3PO2 J;  1Y8R B;  4KFC A;  4ASN A;  1ORK A;  2MC3 A;  3FHZ A;  1HKT A;  1FBS A;  1YIT I;  1VQ5 I;  1AWC A;  3FM3 A;  4RAF A;  3AL0 B;  1FBU A;  2LFB A;  2MBF A;  5FLX Z;  2Y31 A;  3TKY A;  2HKX A;  3PQK A;  3ECH A;  3JTH A;  2W24 A;  1HKQ A;  1X1A A;  3L2C A;  2Q2E A;  3WGI A;  2H27 A;  2K9Q A;  3HGG A;  4M6V A;  5E1W A;  2GQQ A;  1Z1D A;  4P5O A;  1YTY A;  2R7D A;  2GXA A;  2K9S A;  2DA2 A;  3M4O J;  3GTP J;  2XB5 A;  1U9O A;  3K9T A;  1VQ4 I;  4I99 C;  1LE8 B;  4KMU X;  2CGP A;  2M3A A;  3MCZ A;  1OPC A;  3DLA A;  1ON1 A;  4MQ9 F;  2HKO A;  3IUO A;  3LAJ A;  4L9J A;  3M9A A;  1HLV A;  4XSX F;  3BTI A;  4BXU A;  4BJT A;  3K69 A;  2EZI A;  2KZV A;  4KNY A;  1EH6 A;  4RGX A;  5B5E C;  2K4J A;  1BJZ A;  1AKH A;  3FKJ A;  5E17 F;  1O3S A;  1LVA A;  2EZH A;  5IP7 J;  2FQ3 A;  1XPX A;  1IUF A;  3A03 A;  2JQ7 A;  3ZMZ A;  5F1J A;  3W6V A;  4FTH A;  1R22 A;  2HYJ A;  2RNG A;  3WU2 C;  1KZH A;  1HW5 A;  3FX3 A;  2AQE A;  2FUG 2;  1VFC A;  3CLQ A;  2A5Y B;  1X1D A;  5D4S A;  3L00 A;  1K7A A;  1C0W A;  2DOE A;  1IRZ A;  2RC4 A;  2VJJ A;  4OMZ A;  2Z2S B;  1T33 A;  5K7H A;  5HS9 A;  3NAU A;  4HQM A;  3KZI C;  2ZB9 A;  4KUM A;  4AVP A;  1MMN A;  4B8X A;  1QA6 A;  2H8W A;  2R5Y B;  1FOK A;  3KP3 A;  4IHY A;  3A02 A;  3ZMV A;  2AXL A;  1EH8 A;  3W2V A;  1KQ0 A;  4YFK F;  2W82 A;  5GAD J;  2UZK A;  2BGC A;  3HSE A;  2Y2Z A;  3TDU C;  4E7I A;  3IP4 B;  2LK2 A;  3CDH A;  4MFE A;  4P9F A;  1UHW A;  2OBP A;  2QGU A;  2NRA C;  3DF8 A;  1K4S A;  1ZHF A;  2M0M A;  2CSO A;  2NS0 A;  2ZJP F;  1S7E A;  1WJA A;  3AG2 H;  1R36 A;  5J6X A;  5GPC A;  4KT6 A;  2STW A;  4ZDP A;  1YIO A;  1ZGW A;  2XHK A;  3S15 J;  2B63 J;  3I4P A;  3ULQ B;  3N97 A;  3WE3 A;  3NAR A;  3S32 A;  4OWR B;  1FY7 A;  3PM1 A;  2GWR A;  1BI1 A;  1J2X A;  3AAF A;  1B1B A;  4ZZL A;  5FO5 A;  1MGT A;  4ESJ A;  3OYE A;  4ZDO A;  2GM4 A;  5K5R A;  2JA8 J;  4EM2 A;  4A5N A;  3D5R C;  1XMK A;  1UFM A;  2HYG D;  1V5F A;  3PFI A;  4O6J A;  1PJR A;  1AA7 A;  2QM3 A;  1IJW C;  4DBR A;  2CO5 A;  1ZRD A;  4A3C J;  1U8B A;  4UUV A;  2HXI A;  1M1E B;  2M34 A;  3KET A;  3M8J A;  1KON A;  2CH0 A;  2KDO A;  2QZ8 A;  1BC7 C;  3KEQ A;  4X0G A;  4CUG A;  3FF5 A;  3QP6 A;  1ETQ A;  4BL0 B;  1U8R A;  2QQB A;  1I3Q J;  3DKY A;  2NVQ J;  3DBL B;  1B6A A;  3U1K A;  4ZYD A;  2VQH A;  3W6J B;  4BHP A;  3BOQ A;  3ZMS A;  5J8F A;  3HTS B;  3ESW B;  4F55 A;  3L2U A;  1RKT A;  2Y0S N;  3FXR A;  2A6T A;  2VE8 A;  3HRM A;  3G71 I;  3VOE A;  3J80 K;  3PJR A;  1EF4 A;  3JRD A;  1JUM A;  1WPK A;  1QHH D;  2WWY A;  2L9R A;  3HOV J;  1JKR C;  3FIS A;  4HNT A;  5HLH A;  2O0Y A;  3TOB A;  5LFA A;  1JI8 A;  4BQO A;  1I3A A;  2O9L A;  3ZPL A;  1W7P A;  4WX9 A;  4RM3 A;  1HQC A;  1OCC H;  3BJ6 A;  4C3I J;  1ZR2 A;  4IPA A;  5L3D A;  4UVC A;  4XL9 A;  1O3Q A;  2K9L A;  3I56 I;  1I6H J;  2AXT C;  4UUS A;  3SQN A;  4XKC A;  3CP8 A;  5F0C A;  1J75 A;  1ZG5 A;  1S9H A;  4JBA A;  2D1H A;  5EYR A;  2ZFU A;  1MIJ A;  4Y3O A;  1IRG A;  5ICC A;  4CCL A;  2EV0 A;  1IN6 A;  4WWC A;  1SFE A;  5F6F A;  1O7L A;  4PFP A;  5KAF C;  4FIS A;  5D4R A;  3F8F A;  1R1V A;  3MKY B;  3HPH A;  1APL C;  1QQI A;  1KA8 A;  4OIO F;  3KPH A;  4D7M A;  3E1S A;  2ZJR F;  2CRG A;  4KT5 C;  4GDF A;  1ODD A;  2RVC A;  3IH3 A;  1VQ7 I;  2XV4 S;  4Q47 A;  3FMS A;  4YIF A;  2EBI A;  3DWL E;  4RM2 A;  1N77 A;  4NQW A;  1OFC X;  1R1T A;  3L2Q A;  2ZO4 A;  1WZ2 A;  4DYQ A;  3UNG C;  1OCZ H;  1X19 A;  4A5M A;  4BAC A;  1K6O A;  2E35 A;  2PMZ N;  5E3L A;  4JX6 A;  2L0K A;  1FMV A;  3BTC A;  2BHY A;  3C2H A;  4M9X A;  1U5T C;  1F1Z A;  2VON A;  3J7Y J;  3FIW A;  5LGN A;  3CO6 C;  2LY2 A;  1YJW I;  1YRN B;  3H3Z A;  4MFD A;  1VND A;  2DI3 A;  5FLV A;  1UST A;  1FWZ A;  1FPQ A;  2QEN A;  2IAI A;  4ZYA A;  1RC9 A;  5TGT A;  3ABU A;  1J5Y A;  2FD5 A;  1RI7 A;  2DQR A;  4AU7 A;  4CIC A;  1V5G A;  1B8I B;  3D1N I;  1QZY A;  2W57 A;  3RPU A;  2R7S A;  1G2H A;  4RLF A;  2OQR A;  4XOT A;  1SC7 A;  1WH7 A;  3HOX J;  4KIT B;  4IF4 A;  3V7S A;  2R5Z B;  2XF7 A;  5D8L B;  1ULY A;  3I71 A;  2F48 A;  2LY9 A;  3BTL A;  3S17 J;  1B4A A;  3DEW A;  4C9Y A;  1IXR C;  2YSR A;  3CDL A;  1S8N A;  2EJR A;  2LKX A;  2V1D A;  2PEX A;  3BTJ A;  4G8X A;  1JJ6 C;  4MEX F;  1Z67 A;  3LOC A;  3L2R A;  5B3S H;  3WTU C;  2HVS A;  2CYY A;  2FXA A;  3HOY J;  4BE2 A;  3SFI A;  2X85 A;  4E7J A;  2GIV A;  3M1C A;  5AIP A;  3M8E A;  4DNC A;  3ONQ A;  1K61 A;  2OU2 A;  3HSR A;  2GXB A;  3GEZ A;  2RQP A;  5FD6 A;  1X58 A;  4JYK A;  5IY5 H;  3RSN A;  4QPQ A;  3RQI A;  1JT6 A;  1JHH A;  3CME I;  1Y1V J;  3G73 A;  1O3T A;  1XG1 A;  4I6Z A;  2IXS A;  1RR7 A;  5DD8 A;  3BJO A;  4HYE A;  2DDB A;  5FRO A;  5EF6 A;  3B6A A;  2VJ5 A;  3H5A A;  2WAD A;  3EPZ A;  2GBY A;  1S7A A;  2OZ6 A;  4RGS A;  3BC8 A;  3HKZ N;  2OAZ A;  1HST A;  1LDD A;  2H6C A;  1UG0 A;  3P5J A;  2HU9 A;  2YS9 A;  3I3L A;  1Z21 A;  2FF4 A;  3TW7 A;  4XNF A;  1KQ9 A;  1ZAO A;  1V55 H;  1E17 A;  2LYC A;  4IRH A;  3T1B A;  3K1P A;  4OIQ F;  1TW2 A;  2OPT A;  2P6S A;  2GOM A;  2L7F P;  1D3Y A;  2D2W A;  4XLA A;  1UAA A;  2F5D A;  5JHF A;  2O6G E;  5IYC J;  3IRR A;  4M9Z A;  4NC7 A;  3S16 J;  4UB6 C;  3BG5 A;  3FXK A;  4LIU A;  3BR0 A;  2XAG A;  3C18 A;  2W00 A;  3S3M A;  3BG3 A;  4IQ4 A;  4M6Y A;  1MBE A;  3OYI A;  2LC2 A;  1T98 A;  2DU9 A;  1W5S A;  2TCT A;  1BR1 A;  5FLX K;  1ZKG A;  3I59 A;  2CV1 A;  5A2Q Z;  2KLO A;  2OUM A;  4LLL A;  2DDA A;  4XKW A;  5J4V A;  4WXD A;  4HNV A;  1FOY A;  3SZG A;  2R0Q C;  3F6O A;  1FOX A;  3OYG A;  2F5C A;  1HOM A;  2VBW A;  2R3S A;  3EUH C;  2Z1D A;  2ELJ A;  2LSO A;  4Z6Y A;  3J7A Y;  2D5V A;  3H5R A;  4IHX A;  2DJI A;  1WJD A;  2HPI A;  1YS7 A;  1DGW Y;  3REO A;  5EG0 A;  3MQ0 A;  3N05 A;  4Q48 A;  1IRF A;  3R0J A;  2AO9 A;  4UB8 C;  2V1N A;  5F0H A;  2OCE A;  2M30 A;  2Y69 H;  1X2N A;  2DYS H;  1FYK A;  2VPR A;  3AG1 H;  2GZW A;  1JUS A;  1R5H A;  1YX5 A;  5L3C A;  2E5N A;  2G9W A;  3FM5 A;  3OWT A;  3SZT A;  1N78 A;  2XDV A;  1D8K A;  1WFX A;  2PMZ A;  1LPQ A;  1KGS A;  5FFZ A;  4BQA A;  2WAF A;  1LVK A;  3CDI A;  4G7H F;  1I50 J;  5CLS A;  4D5F A;  3HJE A;  1E3O C;  2O3F A;  1VQ9 I;  1ZLJ A;  1DP3 A;  4E70 A;  4HDV A;  2EIJ H;  3OS0 A;  1AKH B;  3WE2 A;  4A6E A;  4AIH A;  2YU3 A;  4BE0 A;  2M9H A;  3J80 Z;  2JA5 J;  4KIF A;  3DPL C;  4M71 A;  3WOD F;  1MKM A;  1MMG A;  2IGN A;  1XCB A;  1P92 A;  1MMS A;  2JK3 A;  1J0R A;  1ETX A;  3V4G A;  2QSH X;  4RB0 A;  1UB9 A;  1SFO J;  1SFK A;  3MEX A;  4XLH A;  5E18 F;  1PDN C;  3PSI A;  1YO5 C;  4J00 A;  1SVM A;  3CJT B;  1A6I A;  3TED A;  3CCL I;  2BE5 F;  3G1L A;  3P9K A;  3OOP A;  3BP8 A;  1RET A;  2XSJ C;  2W1O A;  4UNO A;  2Z5U A;  4BYY A;  2ZME C;  2LF8 A;  4U7D A;  4D0P A;  2VKD A;  3IL2 A;  3OIP A;  1OMI A;  5ILS A;  4LB5 A;  3E6C C;  3AG4 H;  3MVP A;  1R5I D;  1SMT A;  2P6T A;  1ZRC A;  4KA4 A;  4HAM A;  1U78 A;  2ID6 A;  5GAG J;  2JZY A;  4RLQ A;  3COA C;  3IH4 A;  3IV5 A;  2XGX A;  4M3G A;  4CA0 A;  1MND A;  3T0Y A;  4HV6 A;  4LG0 A;  1U3E M;  1Z91 A;  2I10 A;  1P7I A;  2VB6 A;  4PSW A;  4LIT A;  2ZSH B;  2NVU B;  2EZL A;  3FZV A;  3BDD A;  3CCV I;  5GAE J;  1H9G A;  2A61 A;  3V8L A;  3S3N A;  5GP9 A;  1Y0U A;  2VUM J;  2KJC A;  4NUB A;  5CVV A;  3ROU A;  2IGM A;  1U5T A;  3HPG A;  2CUJ A;  5BOX A;  2YUS A;  4CCM A;  4LG3 A;  2KT0 A;  1GXQ A;  1YS6 A;  1FEX A;  1ACI A;  3FXM A;  4M3E A;  4HF1 A;  1D1C A;  3GZN B;  1PUF A;  5EEG A;  1TWF J;  5E8I A;  1BR2 A;  1QU3 A;  3CCQ I;  4MO7 A;  2XIG A;  3LSK A;  5KVR A;  2ZFW A;  1NTC A;  3QYB A;  5E3N A;  4DZP A;  3S93 A;  2M2E A;  2R7Q A;  3M8F A;  2DLL A;  3X2Q H;  4AUX A;  4PJ0 C;  3R6S A;  2G7U A;  1RIO H;  3IRQ A;  2HQA A;  4AM3 A;  3ERM A;  3ELK A;  3K4K A;  4E7S A;  2LLK A;  4HOB A;  1NHA A;  1EH7 A;  3HZJ A;  1WVR A;  2LF7 A;  5LHI A;  1FZP B;  2UXX A;  3K7A J;  3LAP A;  4ZTF A;  5CYV A;  3H9J A;  3Q9V A;  2X1D A;  4AVZ A;  4IOC F;  2DOF A;  4J01 A;  4IHT A;  4B48 A;  4HW0 A;  3J7A O;  3QPH A;  2HDC A;  4I98 B;  1GHC A;  1U0J A;  3QYE A;  2MD5 A;  4AYB A;  2LNB A;  3OYL A;  3FXU A;  4LJZ F;  2NXN B;  2DA3 A;  2F4M B;  2OCC H;  4HZF A;  1BR4 A;  2BVL A;  4GFB A;  1FNN A;  3H1C A;  3J7Z I;  4A3K J;  4IRG A;  2IA1 A;  4ZC3 A;  2JTV A;  1HF0 A;  1BL0 A;  4HV5 A;  2KFD A;  3U2R A;  4Y33 A;  4BAY A;  1N25 A;  4V2G A;  4OIN F;  2M1B A;  1FIP A;  1IZ1 A;  3HHH A;  3K10 A;  1X4O A;  4XRM A;  3SZP A;  4BU2 A;  1XMA A;  3GLL A;  3OR2 C;  5LEJ A;  2JJ7 A;  4PZJ A;  3GTQ J;  4RB1 A;  2DA1 A;  4QPO A;  1G3S A;  2OF7 A;  2QVO A;  3I4M J;  4RAG A;  5IT3 A;  1KYZ A;  1IN8 A;  1FTT A;  4I0B A;  4BS9 A;  5ILU A;  1MSF C;  1RZ4 A;  3TGN A;  4R8H A;  3HG9 A;  3QOD A;  4P1W A;  3B02 A;  4XKV A;  1TWH J;  1OCR H;  3RKY A;  2ZNZ A;  3K70 D;  1K83 J;  2ZXW H;  3ASO H;  3E7L A;  3UR3 C;  2EIL H;  3WTW C;  4EEF G;  1FMW A;  4NQW B;  2X4H A;  2EA4 A;  2BW3 A;  2XF6 A;  3DU5 A;  3FK7 A;  4X6A J;  5JLX A;  2H1K A;  5K1Y A;  3P9I A;  3DPT A;  2DMP A;  2YX4 A;  3M3Y J;  3SYT A;  2CQQ A;  1LUJ B;  2FBH A;  1ZRE A;  3EUH A;  2XKO A;  1UHS A;  1TQP A;  3E5X A;  3JTG A;  3HSF A;  1J7K A;  1VQM I;  1D0X A;  2ECB A;  1R71 A;  3OYF A;  2HQ5 A;  1VI0 A;  2BZT A;  3LFU A;  2FU4 A;  4MLO A;  1SFU A;  1SEU A;  1HW1 A;  2J5O A;  4YFN F;  2DJN A;  4AID A;  2P7V B;  1JKO C;  1OYW A;  4G7O F;  1O7F A;  3LL7 A;  1T08 B;  4ZH4 F;  2JSC A;  1FJL A;  1YW8 A;  1X1P A;  2FQ4 A;  3JSP A;  3NWT A;  1DPU A;  3LSM A;  5GPA A;  3ZQ7 A;  3ABL H;  2H6B A;  5L3F A;  2G7H A;  2UXN A;  2WY7 Q;  4CSW A;  4IXA A;  2XAQ A;  2E71 A;  2DTZ A;  2E1C A;  1XSX A;  2HPM A;  2WAQ A;  1MJ9 A;  1P6R A;  4GYI A;  2XRN A;  4M3F A;  4HF0 A;  4XRS A;  1SD4 A;  5BPD A;  4A3F J;  5IYB J;  3VEP A;  2M8E A;  4RB3 C;  4KJZ A;  2QA4 I;  4P9U A;  2DFE A;  3OY9 A;  3TQN A;  4A3J J;  3G3Z A;  1BM9 A;  4A3B J;  5LGU A;  1PVE A;  2IJL A;  1IDZ A;  4BKX A;  2W48 A;  3PUB A;  2XPV A;  3GX4 X;  2FRH A;  1X3U A;  2V9V A;  5DYM A;  1KU2 A;  4CZZ A;  2L9S A;  3GTK J;  2QUF A;  2VIX A;  2WAE A;  2HYF A;  1WQ2 A;  2CG4 A;  4M73 A;  4ZDL A;  5LRS A;  2EIM H;  5M5W J;  2E1M C;  2BY3 A;  1WGX A;  2K5C A;  3R60 A;  3DP7 A;  1I6X A;  2F5E A;  3IWZ A;  3NEU A;  1K78 A;  3EUK L;  3DKX A;  1T2K A;  2ZME A;  3DQV C;  2Z99 A;  5CKT A;  5M5X J;  1B59 A;  4C2M J;  4WXH A;  2BY0 A;  1HBX G;  1XCV A;  3DBH B;  3EDP A;  2QCO A;  2MLK A;  1GV5 A;  1BC8 C;  1TQM A;  2E7W A;  2WY8 Q;  1ZG1 A;  1J59 A;  3FBN B;  2VBZ A;  1F43 A;  5DV5 A;  3I55 I;  2W25 A;  2DO7 A;  3K4J A;  3F6V A;  3QU3 A;  3ZOB A;  5E20 A;  1R1U A;  4ZYE A;  3I5U A;  2XAJ A;  5DDG A;  2EB7 A;  5A2Q K;  3TP3 A;  4G6T B;  4QSH A;  1WRJ A;  3ZR8 X;  3MAJ A;  1XMX A;  3QWL A;  1IAW A;  5FLM J;  4HEA 2;  3FMQ A;  4G94 A;  2M45 A;  5ERI A;  3M7G A;  4AD9 A;  2K4B A;  5EGO A;  1I1S A;  4ITV A;  1OR7 C;  2P8T A;  2FBI A;  1FP1 D;  1X3W B;  4ABZ A;  1BN5 A;  2P5V A;  2V9K A;  5C3E J;  2FML A;  3I59 B;  4Y15 A;  2R7W A;  1H8A C;  3TBI A;  2MD0 A;  3C3W A;  4FCY A;  4U7B A;  1MD0 A;  4AC0 A;  4A12 A;  3V42 A;  1LEB A;  1AOY A;  1MBF A;  2DA5 A;  3BQY A;  5IP9 J;  2EFP A;  1P9Q C;  3S14 J;  2DPU A;  4A2U A;  3GVA A;  1JTY A;  3ABM H;  3HYI A;  3D5S C;  4L9N A;  4BNC A;  1BIA A;  3A01 A;  1Z6R A;  3ZQL A;  2ZBK A;  3U21 A;  4LK0 F;  3KLO A;  5H20 A;  5EG0 B;  4DJA A;  1OCT C;  4E7K A;  4E7Z A;  2L7Z A;  3S1N J;  3CUO A;  5L3G A;  1IN5 A;  1ZRF A;  4BDZ A;  4ENK A;  1TC3 C;  3K0L A;  3L2V A;  2X6W A;  5ICF A;  1R7J A;  4HX4 A;  1VQL I;  3VOD A;  5F1R A;  1ZGA A;  2I5U A;  2CS3 A;  2VI6 A;  3PQJ A;  4U88 A;  1LFP A;  3ABK H;  2CU7 A;  4MHG A;  4BXF A;  2D45 A;  1CGP A;  1GDT A;  2BVM A;  2COB A;  1MBG A;  3HHG A;  5FRM A;  1XSD A;  1Z7U A;  1TW3 A;  2F2E A;  2X9D A;  3L09 A;  3U9G A;  5KK1 A;  2ME0 A;  3LSJ A;  4QWQ A;  1IF1 A;  1DPR A;  4MTD A;  1WSU A;  4HRI A;  3CF5 F;  4GYG A;  2JVH A;  1IXC A;  5TIS C;  1Q1H A;  2Q8K A;  5M3M J;  3VPR A;  1H88 C;  3OSG A;  3KZZ A;  1ETO A;  2EA2 A;  5DCF A;  3CCJ I;  1IN4 A;  4P55 A;  3MWM A;  2VL8 A;  1R58 A;  2F4I A;  3EYI A;  3Q9S A;  4I2O A;  4DOZ A;  5KHD A;  1SAN A;  3SEZ A;  3J81 Z;  2JVG A;  1HXD A;  2AS5 F;  2VT2 A;  2M8G X;  4YRV A;  4EGZ A;  2EV5 A;  4YEJ A;  2RN7 A;  4ZTJ A;  4CH7 A;  3BLY A;  3GTJ J;  2DOD A;  3BR5 A;  4CCK A;  1JE8 A;  2KRC A;  4PJN A;  4BQQ A;  2COM A;  3DXJ F;  2ZSI B;  4F93 B;  3MZH A;  5JFR A;  2DA7 A;  3HTU A;  4OOI A;  2OA4 A;  2JRM A;  3JSO A;  2CV2 A;  3QOE A;  2JA2 A;  4LG0 B;  3OYK A;  1TZL A;  3I54 A;  4C3J J;  1P7J A;  5HLT A;  3ZP5 A;  3SJM A;  4MEY F;  1B72 A;  3WU0 A;  2QEX I;  2RRE A;  1WKM A;  4U0W A;  2VC1 A;  4A0Y A;  3S2W A;  3RPU D;  5FB2 A;  4XMY A;  4KIB A;  4B44 A;  2CUE A;  4M6X A;  3FK6 A;  3DV8 A;  3WHC A;  3IWF A;  3MN2 A;  3NRV A;  5FKL A;  4BJ6 C;  1U5T B;  1W4M A;  1QVT A;  3CJQ B;  2XC7 A;  1S72 I;  2E1N A;  3VYR B;  1JTX A;  2Z16 A;  3SDG A;  2O7O A;  4IX7 A;  2W7N A;  3T8R A;  1QPI A;  1PUF B;  1D0Y A;  2P0W A;  1Y8Q B;  4F52 A;  3H35 A;  1ON2 A;  3LA2 A;  2CQK A;  4ETS A;  4IEJ A;  4RBO A;  5BQT A;  3WTS C;  3PIP F;  1OYY A;  4IL6 C;  5LEK A;  1XGO A;  2DBB A;  4XLC A;  2YU9 J;  2Z3Y A;  3SHF A;  3HUG A;  2CQ7 A;  1GT0 C;  2IPQ X;  1ETY A;  2E1O A;  1JUP A;  3P7N A;  3Q0U A;  5BPI A;  4U87 A;  3TO9 A;  4I7H A;  2H8R A;  3Q0V A;  3BWG A;  4NC6 A;  1OKR A;  1IXS B;  2LVS A;  1LQ1 A;  3JRF A;  2JUG A;  1E0E A;  1Z77 A;  3MFK A;  2R7V A;  4XN0 A;  1WJF A;  3HDD A;  3CLO A;  3E6B A;  3G1O A;  2RQQ A;  1NK2 P;  2X48 A;  4BBR J;  1K6Y A;  2W84 A;  3KLN A;  3FXO A;  3R61 A;  3H92 A;  3CO7 C;  3CCE I;  4BDY A;  1ZYR F;  4PUS A;  3A0B C;  4YEL A;  5J40 A;  1LE8 A;  4EM0 B;  4L5E A;  2ISZ A;  4JK1 X;  4XLF A;  4ZYH A;  3Q3S A;  1RKW A;  3WTY C;  3JRE A;  3OYM A;  2CQN A;  1DGR M;  1H9T A;  1RES A;  3DTK A;  1D0Z A;  2MSY A;  3FBI B;  4HX8 A;  4LGW A;  1TTY A;  1MJB A;  4A0X A;  1R49 A;  3GWZ A;  1I27 A;  1XX5 A;  2KIQ A;  1YJN I;  3GME A;  4BBS J;  3PNV A;  2V1X A;  3IH2 A;  3V7C A;  1XGN A;  2Y0M A;  4N0B A;  1LDK B;  4RS8 A;  2JRT A;  2ISY A;  2WB1 A;  5LHH A;  1QZE A;  2XB0 X;  1TNT A;  2DMN A;  2DOA A;  4EVI A;  2HR3 A;  4B3A A;  3FWE A;  4Y52 J;  4Q5S F;  2NS8 A;  3M1E A;  1IG7 A;  5LRR A;  3GTL J;  4DYR A;  5K7Z A;  4RGU A;  3JAM Z;  4ZJZ A;  2FMY A;  3S1Q J;  3MZY A;  2L7M P;  1MSE C;  3BRO A;  3G4S I;  3CD6 I;  1SD7 A;  2QYO A;  5C4X J;  3HIF A;  3HRU A;  3FXJ A;  5FKK A;  2STT A;  5D5X B;  4CO8 A;  4AIK A;  1FOW A;  1V3F A;  4Y17 A;  1BOA A;  1FC3 A;  5JHU A;  3L7W A;  3QU6 A;  2EWN A;  2W85 A;  2QKL B;  3OYJ A;  2Z9O A;  1QHG A;  2PQ8 A;  3OYA A;  1OR7 A;  5CVU A;  1TWC J;  2DA6 A;  3BG6 A;  2FSW A;  3ZQI A;  4U0Y A;  2LR8 A;  2BW3 B;  5D5U B;  1Z7L A;  2L7K A;  2JUC A;  3WTT C;  2PMU A;  5ICG A;  1MJA A;  2E2J J;  1VQ6 I;  2P5K A;  2E2I J;  3VYU B;  3IKT A;  3DU6 A;  1I5Z A;  1UHM A;  1FSE A;  1KU3 A;  1X1C A;  2JSP A;  1YLF A;  2KQR A;  5CQG A;  5BS6 A;  5HS8 A;  5JR3 A;  5DD4 A;  1ZTR A;  5K5O A;  2JT1 A;  3E0J B;  4HST A;  5FKN A;  1PUE E;  4AYB N;  3RKQ A;  5ICE A;  5EZH A;  4ZZD A;  4ESF A;  4MNU A;  4DBQ A;  2CUF A;  2KHM A;  4PFO A;  3VDX A;  3H0G J;  3B73 A;  3CF2 A;  4ANJ A;  2Q2E B;  5EDN A;  3CCR I;  2A07 F;  3RKX A;  1BJA A;  1OIS A;  3H36 A;  1LNW A;  5HNH A;  3RDI A;  4HX7 A;  2VXD A;  2HWV A;  2J5P A;  3O8H A;  3OIQ A;  1F4K A;  1SD5 A;  5GAH J;  3LNQ A;  4XLP F;  4F7Z A;  3FMR A;  2G0E A;  3R0A A;  1UG2 A;  1JKP C;  2LH9 A;  3CCY A;  4RA2 A;  4D1Q A;  2DA4 A;  2QSG X;  3GFL A;  3L2W A;  2BHZ A;  3HL2 A;  1IRX A;  4ENN A;  1VTN C;  2B9S A;  2IP2 A;  4MGR A;  1KU9 A;  3K4L A;  1RRJ A;  2GXG A;  2EPF A;  2X1E A;  2ZXJ A;  4LMY A;  5E3O A;  4DQ2 A;  2UV1 A;  2HVQ A;  2M87 A;  1FLI A;  2L5Q A;  4WCG A;  3JRI A;  4B09 A;  3TOA A;  2ACJ A;  3GXO A;  1OLT A;  4XRF A;  1X4P A;  4KDP A;  2K9M A;  3JRC A;  5JVT A;  1OYI A;  3GFJ A;  5F0F A;  1Z0X A;  1T95 A;  2BXY A;  2IVM A;  1STZ A;  1K78 B;  2VOO A;  3VSK A;  2ZME B;  3HGY A;  2V9P A;  4RDU A;  3TW6 A;  5CPR B;  4IRI A;  4UV9 A;  3ML6 A;  3HB9 A;  3K2A A;  1YJ9 I;  4BEH A;  1KQ8 A;  2ZCW A;  2QQA A;  1ZGJ A;  2PMH A;  2PLY A;  1SVL A;  1IW7 F;  5ILV A;  1OCO H;  1JGS A;  2M5W A;  1ZN2 A;  2OJE D;  1E2X A;  4FET A;  5DTD A;  2LRE A;  2V6E A;  1W36 C;  1ERD A;  2EFN A;  2MW8 A;  1SMY F;  3S2H J;  2L3D A;  3BJA A;  2MAB A;  5CJ9 A;  3H9G A;  4L9T A;  4OAZ A;  3RZO J;  4EJU A;  3BPV A;  1ETK A;  3S8P A;  2XF5 A;  3P9C A;  4CZC A;  2JA6 J;  2WAQ N;  3ZQC A;  1B9M A;  3IHU A;  3KYD B;  2E36 A;  3TO7 A;  2DFI A;  1ZLK A;  3HC7 A;  1IC8 A;  2OTL I;  2PJR A;  2Y75 A;  3QP5 A;  4EGY A;  1XC5 A;  3V8K A;  1Y1W J;  4BHC A;  4NNJ A;  2DMT A;  4MQV A;  4B1R A;  2VE9 A;  3EET A;  5BMZ A;  3LSI A;  3VWB A;  4AIJ A;  2XGD A;  3LQR A;  1YOV B;  3KIO A;  3WU1 B;  2CW7 A;  2HOS A;  1S29 A;  3RI4 A;  5HS7 A;  3KP4 A;  2L2O A;  2K86 A;  3E5Q A;  2VT3 A;  5K7F A;  3F72 A;  1T56 A;  3CMM A;  4P96 A;  2PN6 A;  5IOY A;  2FOK A;  5CVI A;  2NOJ B;  1D1B A;  5KNL A;  1BI0 A;  1Y6I A;  1MH3 A;  4FX4 A;  1R4N B;  4XLE A;  1K79 A;  2LY1 A;  2VBX A;  1YE9 A;  1GV2 A;  4XK4 A;  2DMU A;  1Y56 A;  1SVO A;  3GTG J;  1FT9 A;  2K3P A;  3CUQ C;  5LHG A;  5JLW A;  1XD7 A;  2LKS A;  3MKL A;  2EFO A;  2JA7 J;  2XVC A;  1VF9 A;  5D6E A;  3OIO A;  1WI3 A;  4HA8 A;  2IEK A;  2HI3 A;  3KZY A;  3T8T A;  5E8G A;  3OSF A;  3BR6 A;  2PFB A;  4PK4 A;  1FYM A;  1XSV A;  4XSZ F;  2ME6 A;  1ETV A;  3CMA I;  3J81 K;  1W7P B;  4A93 J;  2IRF G;  1FP2 A;  2L02 A;  2V4J C;  2GLO A;  3CC7 I;  2E60 A;  4IOA F;  3U1D A;  3LA7 A;  3TDZ C;  5J47 A;  5EZG A;  4B47 A;  4LIV A;  2OV7 A;  3N4M A;  4UUS B;  1IO2 A;  2KIU A;  4UVB A;  4Y4R A;  3RYR A;  3HOS A;  4IHW A;  5KAI C;  4YIR X;  4E6K G;  2XRO A;  5HDN A;  2NS7 A;  4I0A A;  4FE4 A;  2NOG A;  2X6X A;  3OOU A;  2JPB A;  1FTZ A;  3OL3 A;  3ASN H;  1RNL A;  3WHB A;  1GVJ A;  5M3F J;  4ENM A;  2YPR A;  3CJR B;  3VSL A;  2JN6 A;  2HEO A;  2OC6 A;  4ENJ A;  4NBQ A;  3LST A;  2DW4 A;  2DT5 A;  4UVA A;  5C4J J;  1DU0 A;  4A69 C;  2ZC2 A;  2TDX A;  3LSR A;  4NB5 A;  2M0C A;  1P4A A;  3A4C A;  2M4G A;  4M74 A;  4V19 K;  1YI2 I;  2VBY A;  1TL8 A;  2DFH A;  5CQE A;  2XUB A;  4XBF A;  2D1V A;  2IGK A;  2PJP A;  3FHN A;  5LD2 C;  1LFB A;  3KEO A;  2BY2 A;  2CMP A;  2V26 A;  2ETH A;  2AQF A;  3LFK A;  3ZXS A;  1B72 B;  1WH5 A;  2JMW A;  4BHB A;  2VQL A;  3PNT A;  2KJB A;  5D5W B;  3ZRG A;  4CDG A;  1H0M A;  2IS6 A;  5KCM A;  1D5Y A;  2RDP A;  1JHF A;  3GZ5 A;  2MG4 A;  3ZMU A;  2EK5 A;  1XTA A;  5D5V B;  3AKZ A;  2E34 A;  1G8X A;  4BH9 A;  4R1H A;  2HDD A;  4KMF A;  4MTE A;  1E3P A;  1MBH A;  2KRH A;  2CFO A;  3GTM J;  4CXF A;  4LOC A;  1TBX A;  2EV6 A;  3RTR A;  2P81 A;  3R4K A;  2L9V A;  2QWW A;  3GYH X;  4JQF A;  4B43 A;  2MYS A;  3ZQF A;  4EJT A;  5EEH A;  2K9N A;  2VJ4 A;  2WA0 A;  2ESH A;  2OZU A;  1TT5 B;  1GUU A;  3LSG A;  3W2W A;  2VXZ A;  2BYV E;  4XOP A;  2GOX B;  2UUZ A;  3LQQ A;  4PGG A;  3DBR B;  2RNJ A;  1XN7 A;  4GXO A;  1G6N A;  2HXO A;  2V79 A;  4K2E A;  5IPA A;  3F22 A;  1CQT A;  3GBG A;  3AL0 C;  3I4N J;  1EKE A;  4JX5 A;  2VAS A;  2P7C B;  1TQI A;  1R00 A;  3ISP A;  1YIJ I;  3G2B A;  4XKB A;  3OV8 A;  2ECC A;  5F27 A;  3PNY A;  3HOZ J;  2RGV A;  1QO0 D;  4EM1 A;  2LDU A;  3HRS A;  2DCE A;  4I01 A;  2VPL A;  2EFQ A;  2KDZ A;  1BI2 A;  2ELH A;  3OR1 C;  3LSP A;  3I9V 2;  2E1M B;  4UV8 A;  2RAE A;  2MC4 A;  1W36 D;  1V4R A;  4UY8 I;  4M3D A;  2EQR A;  3GFI A;  4Z2Y A;  4IO9 F;  3JAM K;  5F04 A;  2LD5 A;  1EJ9 A;  1UEL B;  2LMD A;  4B4C A;  1TWA J;  3DLL F;  2LBF A;  3VYS B;  2CW0 F;  3QYF A;  1USS A;  3BY6 A;  3S1M J;  3JRA A;  4QIW N;  1JT0 A;  2HNH A;  5F08 A;  2CWE A;  1IN7 A;  2VQC A;  5DEQ A;  1YG2 A;  2L4M A;  4A3E J;  4X1E A;  3BG9 A;  2HTS A;  4PSX A;  2Y9Y A;  5IT9 Z;  3DTI A;  3OYH A;  1PP8 F;  1JGG A;  3JRB A;  5FKM A;  2DPD A;  4CYD A;  2C6Y A;  1X1B A;  3BT9 A;  1W0U A;  4C2U A;  1WJE A;  2BXZ A;  2DTR A;  5J1R A;  2QLZ A;  3BG7 A;  2DK8 A;  4FX0 A;  2LOO A;  2UWM A;  3V8J A;  1R23 A;  2JWT A;  1FYL A;  1DUX C;  1FBQ A;  3HBL A;  1R5G A;  1BA5 A;  2EIN H;  2V7F A;  3ZN0 A;  3AG3 H;  3K2Z A;  4F3Q A;  2XSD C;  3GW2 A;  3BR2 A;  4A6D A;  3H5N A;  1ITY A;  5DUI A;  2MGQ A;  4S0H B;  3PFY A;  1GVD A;  4G12 A;  2V1U A;  3OS2 A;  3RZD J;  2OQG A;  4NHJ A;  2ZJQ F;  1G3T A;  2YR2 A;  1T39 A;  1YQA A;  2AHQ A;  3Q0W A;  2LP0 A;  5EJC A;  1A5J A;  3K4N A;  3H9Q A;  4HSR A;  1Y39 A;  3LWF A;  2A6H F;  2L54 A;  2NVT J;  1ZAR A;  1EA3 A;  1R6R A;  2NAZ A;  1W7P D;  2WC2 A;  4LFU A;  1W5C C;  5FRN A;  4E7H A;  1WJC A;  1YYV A;  1XDU A;  3O3K A;  1VQ8 I;  2GA1 A;  1HKS A;  3GFM A;  1GLN A;  1S3J A;  2CUZ A;  5HOO A;  3HRT A;  5CVJ A;  4KYW A;  2IS1 A;  4G6Q A;  3CUQ A;  4JX4 A;  4RAY A;  2EIK H;  2WB1 N;  5H6R A;  3LA3 A;  2Y9Z A;  4IKF A;  3QPS A;  5DCM A;  1POG A;  4KN7 X;  4QLC U;  5IOZ A;  2ZXI A;  5DS9 A;  1CF7 A;  2A6E F;  3C1D A;  1A31 A;  4DYC A;  2XPW A;  3IAM 2;  3K4M A;  1MMD A;  1SD6 A;  2XRL A;  2E2H J;  3VYT B;  3L1P A;  1U9N A;  5B1B H;  4EJW A;  4ON0 A;  4IZZ A;  4BY7 J;  2KKO A;  4D5C A;  5H6Q A;  2HQR A;  3O6B B;  1UMQ A;  2VKH A;  3OMY A;  1K4T A;  5L3B A;  1Z3X A;  1MMA A;  4KIS A;  4HBL A;  2QQ9 A;  1A6Q A;  2VKV A;  5C44 J;  1BOB A;  3MZ8 A;  3QPT A;  4W1U A;  4M3B A;  3RIR A;  2KMU A;  2DT6 A;  4H0E A;  3Q5F A;  4HPQ A;  4N9H A;  2ELK A;  2MA3 A;  2L4A A;  4EAT A;  1NH3 A;  4M9S A;  5HNF A;  1BW5 A;  4JP0 A;  4EQQ A;  3K6G A;  2FA5 A;  2O61 A;  2FEZ A;  3KX2 A;  1F9N A;  2P5L C;  4RAZ A;  1NG7 A;  2ID3 A;  3ZMD A;  3WTV C;  4XIC A;  2EFW A;  1LB2 A;  2R7F A;  4N4N B;  4BEH B;  3GF2 A;  4GRI A;  1WJB A;  3F23 A;  2H1L A;  2HTJ A;  2VN2 A;  2ZJ2 A;  4BUP A;  3ABT A;  4G7Z F;  1ZQ3 P;  3CC2 I;  3KE2 A;  3RPQ A;  3ECO A;  2KIM A;  1A35 A;  9ANT A;  5TJJ A;  2IS4 A;  1R9T J;  1MDM A;  2DAO A;  5ED4 A;  5E1X A;  5J1Y A;  3CMY A;  5GTI C;  2R93 J;  2K3F A;  5E79 C;  1XGS A;  1TNS A;  1T38 A;  3BQZ A;  2LRD A;  1ZG3 A;  4Y7N J;  2K7L A;  3I0T A;  1IDY A;  3GLX A;  3JRH A;  4L9V A;  1Z6T A;  1W1W E;  2DXI A;  4H4K C;  2NNN A;  2H09 A;  3KFW X;  2PJR B;  4XM3 A;  1G4D A;  3NWS A;  1YHQ I;  3F8C A;  4KIG A;  3ZN1 A;  3GTO J;  1GXP A;  4Q4Z F;  3GZ6 A;  3QOP A;  4FQG A;  2O8X A;  4O5V A;  2QBY A;  1YW7 A;  4IVN A;  2JPC A;  1XDS A;  1U6G A;  1P4X A;  5FFX A;  3KYC B;  4RMN A;  3T5X A;  3GCM A;  1HCR A;  2NVX J;  2K02 A;  3WTX C;  3CQZ J;  2O03 A;  2ZXH A;  3TP0 A;  2KIS A;  4G9Y A;  2W4S A;  4NDL A;  2DFF A;  4CYC A;  5JVG F;  4D9J A;  2R7T A;  3RKW A;  2A5W A;  4Y13 A;  3DFG A;  2MH2 A;  4RB2 C;  3QRF F;  1QZZ A;  4C30 A;  1OQY A;  6PAX A;  1PYV A;  3F8N A;  1YFH A;  1SAX A;  1J9I A;  1QBJ A;  2H94 A;  5EEA A;  4XLN F; 
#chains in the Genus database with same CATH homology
 3G6E I;  3I55 I;  2E35 A;  3CCV I;  5GAE J;  1YIT I;  1VQ5 I;  1HC8 A;  4UY8 I;  3J7Y J;  2FOW A;  4IO9 F;  1YJW I;  1FOX A;  1FOY A;  3G4S I;  3DLL F;  3CD6 I;  1YJ9 I;  1FOW A;  1ACI A;  2QEX I;  1VQ4 I;  3CCQ I;  4V19 K;  1VQM I;  1YI2 I;  3CCS I;  1VQO I;  3G71 I;  1S72 I;  1VQ6 I;  3CC2 I;  2E36 A;  2JQ7 A;  3CC4 I;  2OTL I;  1VQK I;  3PIP F;  2K3F A;  2E34 A;  1VQ9 I;  4IOC F;  5DM6 F;  3I56 I;  1VQL I;  2ZJQ F;  3CME I;  1VQP I;  1QA6 A;  2H8W A;  3CCR I;  5DM7 F;  2QA4 I;  2NXN B;  1YHQ I;  1VQN I;  2OTJ I;  1MMS A;  5GAD J;  1Y39 A;  3J7Z I;  5GAH J;  3CJT B;  3CF5 F;  3PIO F;  3CCL I;  1VQ8 I;  3CCE I;  2ZJP F;  5JVG F;  3CCJ I;  2ZJR F;  1VQ7 I;  1YIJ I;  3CMA I;  5GAG J;  3CCM I;  1YJN I;  3CC7 I;  4IOA F;  3CCU I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...