3CCUV

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482c
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ccuV00
1Q81W 1KD1W 3I56V 3G71V 3CCUV 1VQOV 1W2BU 1YJ9V 1VQ7V 3CCSV 4WFAV 1JJ2U 3CC2V 3CC4V 3CCMV 1VQ9V 3CC7V 3CXCU 1VQ4V 3OW2U 4WCEV 1YHQV 1YJWV 1VQ5V 1S72V 5DM6V 1QVFU 1R73A 2QA4V 1VQ8V 3G6EV 3CMEV 3CCLV 3CPWU 1YI2V 3I55V 1VQPV 2D3OW 1K8AW 1VQLV 3CCJV 1M90W 1Q7YW 1Q82W 1YITV 1VQ6V 1VQMV 1VQNV 2OTJV 2QEXV 1M1KW 3CD6V 1YJNV 3CCEV 3G4SV 3CCRV 3CCVV 1VQKV 1Q86W 1K73W 1KC8W 3CMAV 4WFBV 1QVGU 1N8RW 1YIJV 3CCQV 1KQSU 4WF9V 1K9MW 2OTLV 1NJIW
chains in the Genus database with same CATH superfamily
3F5WC 4DR4O 4N21A 5J2TB 1SQQH 2BSKA 5LGNA 3JD4A 3ZRWA 4RQFA 2KQXA 3E22B 2YI9A 3ZHQA 4B7KA 2JEXA 1LUVA 3RYIA 4FJCC 4RO2A 3L74H 1GO3F 1P49A 1DTOA 2IJKA 2PUSA 2VRZA 1M57C 1W0JG 3VQYA 4HNAA 1R3IC 2P67A 1AJPA 1RM1B 2A06H 2VQEO 2JVDA 4DK1A 3CCUV 1KP2A 5IWAO 3UQ8A 5IY5B 1B3QA 3LDEA 1BHAA 1JJOA 1GMGA 3RYFA 5FNVB 1QQCA 4PA4A 4DR5B 3B2EE 1OCZB 3MD0A 1I5YA 1JCHA 4IIJA 3E89A 1R6KA 1LNQA 1Q81W 1SA0B 3E8HA 1BSMA 1VQ7V 2WLLA 2DWEC 2E5LB 3RN4A 1BE3H 2KB1A 1J5EO 4L8JA 4X65O 3J81N 1PM9A 4JYCA 2A7WA 4MS2A 4BWAA 2A0LA 1IBKB 1P7BA 3OMAB 2PZSA 3F7VC 1M4UA 2R72A 1NTMH 3HKCB 3ZHTA 3ZMSA 1YVWA 3AG3C 4ABMA 2AZ0A 1N32B 5LMNO 3ABLC 1XI1A 2ZT9B 5L3BA 4PA3A 3RGBA 3VQWA 4NR1A 4WFAV 2FTKA 2NLJC 2HR3A 4JAVA 3ZIAG 1WPXA 2Q73A 3FFQA 1EZVH 2YXLA 4IYIA 5GTIZ 1IBLO 3IC7A 1COWG 1TAEA 3AG1B 5LBQA 1T5EA 1XL6A 2YDEA 4WFHA 1NU1H 5LMUO 3OT7A 5J2UB 4PA7A 4EFBA 3RW0A 1OCCC 1PKXA 2VWKA 1IVSA 2DYRC 3DC6A 4DR7B 3E86A 3K79A 2EILB 3CCVV 3TETA 4FLYA 3AG7A 3K57A 1XEQA 3K5LA 4O4IB 3JASB 3H1LH 4GZRB 1NJIW 1VQOV 1PNKA 5DECA 1OCRC 2Z3YA 1O9HA 2HVJC 4LH6A 3RT3C 4DW0A 3JYCA 4BIZA 2ZXWB 3E35A 3L71H 4BW9A 4NXNB 3QG5A 5J9PC 4FM1A 4LF5O 1HR0B 2A3QA 4B3RB 3AK1A 5DEDA 2QGNA 1I94O 1VQ4V 1OZ0A 2ZE8A 3ZMVA 3F7YC 4JZ2A 4O4HB 4UB8Z 2IBZH 5BXZA 1M1KW 3M7MX 2YUAA 2QJ1A 1K4DC 1NT2B 4YHHO 1HNWB 2JRIA 5LHGA 1RM1C 1J95A 5GW7A 3T2MA 2PI5A 4PJ0Z 2ZKOA 1IBMB 2IH3C 3THOA 2A79B 2O57A 1JFFB 2F93B 5IY5C 1VEWA 1TVKB 3HKBB 1GM9A 4TV9A 5H2FZ 4JASA 4MTGA 1CP9A 4IL6Z 3ABMB 4LF7B 1BL8A 2IM9A 1OCZC 4X1IB 1V54C 1WA8B 2VQEB 1SETA 4RQEA 2R70A 1XREA 4X62O 4X1KA 1FXVA 1XNQO 1NBMG 2WLMA 3OTOO 2NR5A 3SJCC 5LA6A 2Q8VA 1K8AW 1EN5A 1R3JC 1M90W 3HKDB 4LF4B 1AR4A 4DXWA 3K9SA 4JI5O 2WLKA 4DR2O 4DR1O 1FFTB 5HFMA 1YDXA 2K9PA 2EZOA 5IJ9B 3C90A 3OFNG 3GVMA 4G27B 1KU9A 2RMKB 2V1DA 1PNMA 1ZX3A 1L8DA 1F7YA 1P4RA 4FPPA 2IJJA 2OTJV 2ARHA 3ABKB 2ODMA 2ZR2A 1BT8A 4PI2A 3WB1A 5KX5B 5J2TA 3AK3A 3AG1C 5B66Z 5LMNB 3OR7C 3E22A 2ZNIA 4C7UA 4O2AB 4H0LB 1AJNA 5EBMC 1RP3B 1JOYA 3JAMN 3DGEA 1AP6A 2BE3A 2Y0PA 3OGIB 4UCVA 3JCZA 4RUEA 4U3JB 3OUSA 2EILC 4KUMA 1SZXA 2EIMB 3B77A 2PYLA 2CTQA 4MVRA 1JJ2U 5FNVA 4ZIBA 2WLIB 3G80A 2PI4A 3STZC 5KA5A 3SYPA 4DR3O 3E8FA 2YSUB 4AI8A 3CSXA 1F4NA 3ZRWB 2ZXWC 4EEQA 1NVPB 1AI6A 1SA0A 1L1FA 3A2FA 1LR1A 1XMOO 1JA8A 2UUAO 4NXMO 5H5NA 5IE9A 2QKAA 4JI1O 2F4VB 1G6UA 1WNSA 1Q8IA 4HNAB 3SPIA 4ZI7B 1OHHG 2QTOA 2Q7HA 3ZHSA 1GN4A 1Q6UA 1VQ8V 2DYSC 1BS3A 3HKCA 3VBBA 3HR0A 3WG7B 1YXBA 3B8MA 4CS3A 4PA6A 1NZ6A 4D7SA 4JI6B 1YEWA 4TUYA 4O4LB 4LBEC 1AI4A 2HG5C 2GUZB 3QTCA 3JD2A 4JAAA 1QLNA 1QR9A 2LW1A 3K0DA 4HAMA 2IJIA 4FVMA 4I9WA 2EX3A 1VF5B 2WLLB 2RNBA 3ZN1A 3UO2A 4LFBB 2V4DA 4D6TH 2WSSG 5IYZB 5JJJB 5LP6C 5BY1A 5J2UA 4YJ2B 1WJZA 4HBNA 4K0KO 3AK2A 4J7ZA 3ASOB 1ROPA 4TQFA 1N4CA 1B04A 3H01A 5HFLA 3JD1A 4BAYA 2N74A 3CCJV 4O4IA 3K59A 1N0NA 1EBOA 3CCEV 2XUMA 2NNUA 4PDLA 1Z2GA 3KG2A 3CCQV 3ZCCA 2PYJA 5A9GA 1DF5A 4MVQA 4P9OA 5K1XA 4X62B 3CHXA 2GSMB 4H13B 4KP4A 4GUNA 3UM7A 3BA9A 3RYCA 4O2BB 3CRQA 2AHZA 2Q0OC 3DC5A 1S5HC 4DV5O 1Q86W 1MMMA 4LFAB 1NI8A 4F4LA 3D3QA 3CMAV 4JI5B 2WA4A 5EBLC 4DR1B 3LSUA 5CBFA 3G67A 2W6JG 2ZE6A 4O4HA 4LF8B 3JSLA 1FS0G 1XDCA 1YJWV 4J10A 4DV6B 3TCUA 2WLNA 3BAAA 1KKDA 1QLEB 1HNZO 2P4KA 1G8MA 4UCSA 3CYOA 5EC1C 2RCVA 5EK0A 2KG7B 1X4TA 1H2NA 1K9MW 4DV2O 1JFFA 1NR1A 4H44B 2EIMC 3CJHB 3HKBA 3WB0A 5E1AC 1G4YB 4EB6A 3JARB 3BFRA 4CZZA 2P6JA 3UCSC 3D8CA 3H9VA 4X1IA 3JSNA 1PL0A 4EFEA 5BMVB 1WA8A 5GONB 5GTHZ 3A8TA 5KHKA 2W0XA 1LUWA 3ZEDA 3PN1A 1GN3A 4DYLA 4ZKIA 2QWPB 4YY3O 4DUYO 1NR7A 1Y74B 3FAVB 3SPGA 1EN6A 3OMIB 3HKDA 3G6EV 3BHPA 2ZDIC 5CMUA 4B7EA 4I50B 4X89A 2IH1C 4RUFA 1S5LZ 4JI3B 1KP3A 3WG7C 1H2KA 5IJ9A 4FLTA 2WA3A 2LO1A 3APOA 3EHBB 2AGAA 4LF9O 2UUAB 1HDJA 3LNMB 3DSQA 4JI1B 4NVPA 2F1MA 4NTWA 1CEZA 2FL4A 2P22C 1MSWD 4AQYB 5KX5A 2QM4A 3HPLC 4F6RB 2LJ2A 1E1QG 4JV5O 2XAFA 3CCRV 2Z5UA 1YIJV 3JATB 3KCYA 4O2AA 4DV1O 2QE7G 4NTXA 1YJ9V 3QVNA 1YHQV 4UFZA 3ASOC 4U3JA 2CAZC 3CMEV 3SYCA 5JVDA 4DV3B 4KXRA 1Q82W 1WP8A 4J9ZB 1N34O 1VQKV 2AZ2A 4WF9V 2ZNJA 2WLIA 4UVBA 2YIBD 1FPOA 2Q6AA 4ZHQA 2LFRA 5BZBA 1RFYA 3K5MA 4Z1MG 1MG1A 3G4SV 4AHCA 3T4ZA 2F95B 1TUBB 4ZI7A 5BR8O 3FD9A 2H94A 2ZDIA 1L0NH 1K5QA 1UFIA 2DW4A 1XHZA 1A32A 1SESA 4TV8B 3CCSV 2AXTZ 2DE0X 2YC0A 1E79G 4PD4F 2E75B 3CCLV 4MVZA 1I7FA 1QLEC 4U3FH 1NH2D 2CK3G 4LR3A 4B3SO 1K4CC 4O4LA 4DV5B 3CP1A 3T1CA 4JI0B 1URFA 2GUZA 3VQVA 3T1YO 3N2KA 1I5XA 2YXHA 1Z5VA 4PHZA 1M5IA 1XOUA 3KCXA 4JI2O 5KUKA 3ZMUA 2JGDB 1HNZB 4JI4O 1UJWB 5IYZA 3ETQA 4YJ2A 1MNGA 2KKWA 2ZM6B 3WFVA 3H1KH 1Y6XA 1HNXO 2F23A 1US6A 1AVMA 1U97A 4R6ZA 3W7UA 1XUQA 4DV2B 1GH6A 3CB2A 1FYJA 1Q43A 4TUYB 3L75H 4XDLA 2ZE5A 5EIBC 4MW3A 4B3MB 2W6IG 2XAQA 2Q68A 3UKMA 1AJQA 2A9HA 1XILA 4P30A 4X88A 1SF9A 2VQFB 3GWOA 3CRMA 2HHHO 1KD1W 4UV8A 2RQ6A 4O2BA 5JJNB 5IYDO 1E1RG 3O65A 4H33A 4DUYB 5LL6Y 1ZWIC 2Y69B 4GX2A 1JQ0A 4QE7A 2UXBO 1JX9A 2ZIMA 1ORQC 4J9YB 1F51A 1MOFA 1H2SB 4B3TO 3SPJA 1BQZA 1SS3A 4LF6O 4I55B 3L70H 1FXKB 1BMFG 4FLWA 3BEHA 4PDMA 4LP8A 4JTDB 1R6NA 1W0KG 3VOUA 3G6BA 3P3PA 2K1EA 2KG7A 2RN9A 2R9RB 3ZRVA 1V55B 1YCIA 3F5TA 2UU9O 3H1JH 3RYCB 2PY5A 4RAIA 4I0XB 4PDRA 5L3CA 3CJHA 3UO3A 2ITDC 1D2DA 3JARA 3K0GA 3N27A 4X66O 3SJBC 4G28B 5BMVA 4LFCO 5GONA 1Q7YW 3ETEA 1AB3A 3IC9A 3BABA 3K58A 1YJNV 5B5EZ 1TA8A 2RDCA 3OEEG 1N36O 4WFBV 2GV9A 3NR7A 1Y74A 2HJDA 3FAVA 1JMKC 2P5OA 4GKKB 4XDKA 4N23A 2JS3A 4UXNA 4EKWA 1ZAUA 4DR4B 4I50A 1L0LH 1IXMA 3TGUH 5TISZ 2X6AA 5JH7A 3LNNA 4U7OA 2OCCB 1H38A 2VS0A 1ENVA 3EXAA 4HZ3A 3K5NA 2UUCO 2PTMA 2WWWA 4EB6B 4LWSB 1GN2A 1I08A 2LP7A 2BOBC 1BGYH 3P3NA 4JGSA 4E4EA 2B9ZA 1FAFA 4K35A 5IWAB 1S72V 4F6RA 1R73A 2F66C 4ZOLB 1ZSPA 4FLVA 1Q6IA 3NXSA 3JATA 1H8EG 4FZ0A 4XBFA 3TK1A 1QNMA 4J11A 2EBOA 1EZJA 5KHHA 2YXYA 3A0RA 1XMQO 3M8AA 3P32A 4I5SA 4GX5A 2OTLV 2Q67A 3GB7C 4U7NA 2V7QG 3FB5C 3RVYA 4H37A 2RJZA 2GTSA 4FLXA 2JJ2G 1WAZA 4JI4B 1J5EB 2X6CA 4X65B 4DV7O 4ICGA 4MVOA 3I5DA 2IJHA 3ETGA 1OCOB 4J41A 3S3WA 5B1AB 5B1BB 2DOSA 3SJQC 4TQDA 4OX9O 3X2QB 1GTOA 4PI0A 2Y69C 2UXNA 5CA3A 1TUBA 4GCZA 1N0JA 1M93A 5JVDB 1IBLB 4TV8A 4JTCB 1S5JA 4YIPA 2JIZG 5A2QN 3Q4HB 1GRJA 1H2LA 2DJVA 3UT5B 2QKCA 5LMUB 5AG2A 3ZRSA 2HVKC 3JAKB 4P9PA 2ADQB 2XOKG 4ZHQB 1I0HA 2ZCEA 3E83A 1Q6HA 1Y66A 2EIJB 2BTQB 1DLBA 4GLXA 4FLZA 2JJ1G 2JGDA 3ABUA 3CC4V 4X64O 4X1YB 1Q90D 4YJ3A 2MK3A 3WU2Z 4YIOA 5LXTB 1YITV 1P84F 2FMLA 2EULA 4Z2WA 3SPCA 3MHSC 1M56B 2XTAA 4DV0O 2FYUH 3FB7C 4P2ZA 4FM2A 1IX9A 4OPAA 4LF5B 1IXBA 4R50A 3C3SA 1Y76A 4WBNB 4UVAA 4J80A 4OPHA 1YTFD 3PJSK 2JGUA 3JAWB 4TT3G 1I94B 1S0VA 3N2KB 1AILA 1GAXA 3ZN0A 1VQLV 2OCCC 3CRAA 5IYCO 1PPJH 2P7TC 5EC2C 2XNDG 3OGCC 3HKEB 4KHPO 3O9OA 4TSFG 4YHHB 3ABMC 1YSCA 5D5QA 3JCUZ 3RWRD 5KA6A 3MHHC 5KLVH 3SDLA 3OTFA 2Q0AA 4XDJA 4X20B 5JQGB 2MW2B 1PL4A 1QU7A 4UV9A 4I55A 1VQNV 1FXKA 4QJFB 1RPRA 1WLEA 2DQ0A 5CBHA 3L9DA 4QPKA 2LQTA 2ZE7A 2LW7A 4UVCA 1EM1A 1XL4A 2QWRB 1SQXH 1QHTA 4WCEV 4B08A 3ZHVA 1XNQB 5L3GA 1K97A 1G1XB 3OTOB 3CS5A 2FKXA 2D3OW 1NH2B 4I0XA 4MT8A 5KMGA 5CN0A 2PGGA 1KMIZ 4R7CA 3ABKC 3SJAC 4DR2B 1MZFA 1KKCA 3IJ4A 2L35A 4FMTA 1SQFA 3I56V 1XNRO 3BY6A 1UPGA 5B1BC 3B8NA 2YICA 3RYHB 5FPRA 3X2QC 1ZUQA 2XASA 1NKDA 4TWKA 1AR5A 1R3KC 4LNUB 4DR5O 4UCRA 1FJGO 3J7AU 5B1NA 1DGSA 1V9PA 4GYCB 1BCCH 3VQXA 4DV4O 2E5LO 2QDOA 4MTOA 1MABG 5E79Z 2QA4V 3LUTB 4Z1VA 2D2CB 1GN6A 4LWSA 4NYKA 2YEVB 1VF6A 2XAJA 4ZBMA 1Y4MA 1IBKO 3FX7A 1AR1B 3H1IH 3OMNB 1QR8A 4CS4A 2CTRA 2KSDA 3DXRB 1N32O 4CS2A 1RPOA 2QR4A 1OJHA 2EIJC 1H8HG 2R9AA 2M6YA 4OGQB 4ZOLA 4W4KA 5EBWC 1SKVA 1MZEA 3ZHRA 1PD3A 3R65A 2HKOA 4HYOA 4DR3B 2IU3A 1VF7A 5IT9N 4F6EA 5JH7B 1XQ8A 4K3AA 1M56C 4BIUA 1H2GA 1WPBA 3ABTA 4NKGB 2EIKB 2DMXA 4Q20A 4JI8O 1XMOB 4DRXA 4NXMB 1KYOF 1THZA 1VQ9V 1P7GA 4PELA 3I55V 4DR7O 5B1OA 3JD3A 1B6QA 1WN7A 2QEXV 2Q4PA 1NQTA 3A0HZ 5CA0B 3CEIA 5LYJB 1W59A 1KB9F 1SRYA 2QWNB 5KHIA 2YIAA 3CXHF 4FIPC 4JI7O 5H6QA 1OCCB 2UXDO 5LGUA 3IGAC 5H9CA 4WFGA 3FYIB 1SQPH 3QNEA 4E2LA 4MVMA 4NXNO 2H3OA 2HP8A 4FZ1A 3CX5F 1NTKH 3Q4HA 4QPJA 3UT5A 5FLXN 2YIDA 4BR6A 3JAKA 5KHGA 2ZQMA 4K0KB 3CCMV 2HFEC 1DK1A 5IDJA 3CPWU 2DWDC 4K8ZA 2H8PC 2BTQA 1HNWO 1WB7A 1SERA 5LHIA 2ZR3A 4X1YA 1IBMO 3FYEB 5IJ0B 4I9QA 2JEUA 4ASUG 5L3DA 4PA9A 5LXTA 3SPHA 1ZL8B 4O4JA 1B06A 4UCUA 4LC1A 1R3LC 1AROP 1X59A 4J7KA 4WBNA 2EZPA 4LF7O 1K3EA 1KC8W 1VMGA 1H2MA 3K9AA 2B1IA 3JAWA 4JYYA 2EJRA 3LSSA 4G2KA 3T1HO 5CA1B 1XNRB 4DR6O 2F43G 2X7RB 1GKFA 1K34A 3SYOA 3HKEA 3BA8A 4LF4O 2JS5A 1FJGB 4UCTA 4YJ3B 2YIBA 1V54B 5KAFZ 2YI8A 1D5NA 5FPOA 2Q69A 4X20A 5JQGA 2PF4E 4DV4B 1TUEB 5DM6V 1Y76B 3WB2A 3K04A 2E74B 4BW5A 3K03A 4MVSA 2Q9LA 3ZBHA 3CWBH 4J42A 4X9QA 2QM8A 5KAIZ 2EIKC 2XAHA 5ITZA 5FL7G 4MTFA 2E76B 4YY3B 3CXCU 1F4MA 1VARA 4FK5C 4IT5A 3T4DA 3OUFA 4BIOA 1JR9A 3W7XA 2QWQB 2UXCO 3ZX6A 2CH7B 2UUBO 2DN9A 4X8AA 4DO2A 4GKJO 4LF9B 3RYHA 4JI8B 2N04A 4IHJB 4GT1A 3BRCA 4FFBB 2HEPA 3ICXA 3AG4B 4LNUA 5EIBD 1BZKA 3AG2B 3ZS8C 1SZTA 5L3EA 2EINB 3QO5A 2QTSA 1U96A 4CBCA 4CH4A 3A0BZ 3DTUB 3ETDA 4JV5B 2OYQA 4Q6GA 5KMGB 5LGTA 4MTXA 2X6BA 4JYBA 2F4VO 3JALB 4DV1B 3TJTA 1YTFB 4JI7B 2JK5C 5LHHA 2CUGA 2YEVA 3BCCH 2UXDB 3L73H 2Y48A 1WB8A 3W7SA 2B1GA 1KBHA 4A5UB 4IYHA 3DXRA 2FB5A 2ILMA 3LDCA 1FFXB 4JI6O 1SQBH 1N34B 1PNLA 1QBZA 3OAAG 2IU0A 2BCCH 2GHYA 1IURA 1EN4A 2QKSA 2DYSB 3ZRXA 3N2GA 4D7TA 4DUZO 2OWOA 2QWOB 1S3JA 3E8BA 1K33A 4LFBO 5L3FA 2AW9A 2CTWA 3JD0A 1AP5A 3K5OA 3ZMTA 3U0ZA 5C8YB 3QF7A 3U11A 3LSQA 5BR8B 3G71V 1KECA 1MSDA 2Z0AA 2OT5A 2ETNA 3SR2C 3SGIA 4GX0A 2E3CA 5CA0A 5LYJA 5LOVA 1ZLZA 2YS8A 4WFFA 5LP6B 4B3SB 2JDIG 3ASNB 2ITCC 1JPXA 4J7JA 1VIBA 3T1YB 1CPYA 3FB8C 3STLC 3T1HB 3OM3B 3CC2V 2XT9A 4DR6B 4I4TB 4JI2B 3ZHUA 2P4VA 4DRXB 1XBLA 1HP8A 3U10A 5CB4B 4LFAO 3E8GA 5EYPB 1RSOB 2ATKC 1GK9A 1KQSU 1HNXB 3SYQA 2GDSA 3M99B 3SYAA 1BQ0A 5IYBO 4LF8O 1BHBA 2BTOA 4DV6O 5DN6G 1IDSA 1NTZH 2CTPA 5EZYB 3OR6C 3CD6V 1EFRG 3HB3B 4FM0A 1QVGU 5IJ0A 5C93A 2BOCC 1D5AA 2OIGA 1N33O 4IGGA 1HW7A 2EJ7A 1FXKC 1AI7A 1ZL8A 2CGOA 1W2BU 2HHHB 3IAYA 3TXSA 2M7WA 5D5PA 1OV9A 3AG4C 3CE2A 3AG2C 2VWJA 2UXBB 3BPZA 1VQ6V 2EINC 5JJEB 2LGWA 2CDYA 2HLDG 4JF3A 1V55C 5CA1A 4JYAO 2Y0IA 4B3TB 4AILC 2UXCB 4LF6B 3E2EA 2UUBB 4GKJB 3P30A 4JTAB 2XAGA 3ZMZA 3K06A 4QE9A 1R1BA 3S3XA 3D36C 3K3WA 3L72H 2BSKB 4JI3O 4PV1B 4O4JB 1M9NA 3RFRA 3RYIB 4JAUA 5H6RA 2UU9B 1K92A 2QM7A 2G38A 2GTAA 2UXXA 1ZTEA 5B3SB 4JPRA 1HWYA 4DW1A 2IW5A 2CE4A 3B4SA 4X66B 1YI2V 5CBGA 4AQYO 4CH6A 2ZD9A 4CH3A 4LFCB 1R6TA 3MDSA 1K7DA 1GM7A 1N8RW 1Y67A 3RYFB 1N36B 5JCOC 1Z5WA 3ZJZA 1VF6C 4KL1A 4IIJB 2P06A 2ZINA 4DV3O 4DUZB 3RBZA 4LH7A 2CH7A 1VQMV 4KFMA 1FXHA 3CRCA 2UUCB 4PDVA 4CC5A 1SC5B 2Q7EA 4NB5A 2Q5ZA 3ASNC 4IHJA 4FFBA 2C2AA 1KUQA 1WP7A 2OCHA 1YZBA 4MW8A 4MVUA 1GM8A 3OW2U 1K5SA 4QIWF 2WPDG 1YF2A 1F23A 5ITZB 1XHXA 3JASA 1MA1A 3JALA 2DQ3A 1IZ3A 1XMQB 2WLJA 1OCOC 3D36A 4NTYA 1TGOA 5B1AC 4OXSA 1VQ5V 1FFXA 3FB6C 4UUJC 2CGNA 1M57B 4DV7B 5KUMA 4JI0O 1K73W 5K1PA 4CH5A 5JWPA 5KHJA 2L6LA 2WLHA 3CC7V 1VP7A 3EFFK 4OX9B 1SQGA 1VQPV 3AEIA 1Q3EA 5JCOA 5C8YA 2ZM6O 3W7WA 4I7ZB 1S77D 4UCOA 3APQA 1CXZB 2LFSA 2NN4A 2LGQA 3BVOA 4TOIA 4K8XA 1N33B 2Y4TA 3EVKA 4R8CA 4RWUA 1TVKA 4L87A 4YXWG 3KZIZ 3CRRA 4GX1A 3OEHG 4B3MO 1QCEA 4DK0A 1QVFU 3OE7G 5LP6A 2Q7GA 4W4LA 3TXQA 3RVZA 4FLUA 3N2GB 1JVMA 4QGPA 1Q5OA 3AG3B 2VQFO 4JYAB 3ABLB 4I4TA 2R9IA 2Y4UA 3IFXA 5B3SC 3H1HH 1FD9A 2P90A 3B09A 5CB4A 4X64B 3W7TA 4MSWC 5EYPA 1AI5A 1RSOA 3D3IA 4UB6Z 3KKYA 3MAQA 2X0LA 1NVPD 2AHYA 4TV9B 5F2VO 4DV0B 5LOVB 2B5UA 4CC6A 3ML0A 3OD4A 2N05A 2WAMA 3J80N 1PV0A 2OIEA 4LCUC 5EZYA 1SQVH 3K08A 2DYRB 4X1KB 2XHBA 4WFEA 3GWKC 4JZGA 1FKAO 5LA6B 1NS1A 4FFKA 3R66A 2GBOA 1O9GA 4KHPB 1HR0O 2ZIOA 3B40A 2ADPA 3QO8A 4B3RO 2W0FC 1OCRB 3QO7A 1DF4A 4QNHB 3FKSG 3LDDA 2QSAA 2HJFC 1S76D 4GKKO 1PP9H 3C3TA
chains in the Genus database with same CATH topology
3F5WC 1YTFB 4N21A 2JK5C 5LHHA 2YEVA 5LGNA 1FS0G 2Y48A 3JD4A 3ZRWA 1YJWV 4RQFA 3ZRSA 2HVKC 2B1GA 2WLNA 4P9PA 3TCUA 3W7SA 1KKDA 1QLEB 2JEXA 1G8MA 3CYOA 3LDCA 4FJCC 2XOKG 5EC1C 3E83A 4RO2A 1GO3F 1DTOA 2IJKA 1M57C 1W0JG 5EK0A 1R3IC 1Y66A 2P67A 1AJPA 1RM1B 2EIJB 1K9MW 1PNLA 1QBZA 1DLBA 3OAAG 2IU0A 1NR1A 3CCUV 2JJ1G 1KP2A 2EIMC 2GHYA 3ABUA 3CC4V 5E1AC 2QKSA 1G4YB 2DYSB 3LDEA 5IY5B 3ZRXA 1BHAA 4CZZA 2P6JA 2MK3A 1S3JA 3E8BA 1K33A 1GMGA 5L3FA 1YITV 4PA4A 3SPCA 3MHSC 1M56B 1PL0A 3JD0A 1OCZB 3MD0A 3ZMTA 1I5YA 3FB7C 4P2ZA 1JCHA 4R50A 3E89A 1R6KA 3LSQA 4UVAA 1LNQA 1Q81W 4ZKIA 3E8HA 3G71V 1VQ7V 1KECA 1YTFD 3PJSK 1NR7A 2OT5A 3SPGA 2WLLA 2DWEC 4TT3G 3OMIB 1S0VA 3G6EV 2KB1A 2ZDIC 4GX0A 3ZN0A 5CMUA 1VQLV 2OCCC 4X89A 4JYCA 2IH1C 5IYCO 4RUFA 4MS2A 1KP3A 4WFFA 2P7TC 2A0LA 5EC2C 3WG7C 2XNDG 2JDIG 3OGCC 1P7BA 3OMAB 3ASNB 3F7VC 2ITCC 3ZMSA 1JPXA 3EHBB 3AG3C 4TSFG 3ABMC 3ABLC 3LNMB 1YSCA 1CPYA 4PA3A 5L3BA 3FB8C 3STLC 3OM3B 4WFAV 5KA6A 3CC2V 3MHHC 2FTKA 2NLJC 2HR3A 4JAVA 3ZIAG 1CEZA 4XDJA 4UV9A 1WPXA 1VQNV 1MSWD 1FXKA 3HPLC 4QJFB 1E1QG 1RPRA 2XAFA 3E8GA 3CCRV 3IC7A 1COWG 2Z5UA 1WLEA 2DQ0A 5CBHA 1YIJV 3AG1B 5LBQA 2ATKC 1GK9A 1KQSU 4QPKA 3M99B 3SYQA 2QE7G 3SYAA 1XL6A 4UVCA 5IYBO 1XL4A 4WFHA 1YJ9V 1BHBA 4PA7A 5DN6G 4WCEV 1YHQV 3RW0A 3ASOC 1OCCC 1PKXA 5L3GA 1K97A 3CMEV 3SYCA 2D3OW 1NH2B 2DYRC 4MT8A 1Q82W 5CN0A 3E86A 3K79A 3OR6C 2EILB 4J9ZB 3CD6V 1EFRG 3HB3B 3CCVV 1VQKV 3TETA 4R7CA 1QVGU 3ABKC 5C93A 2BOCC 4WF9V 2WLIA 4FMTA 1NJIW 1FXKC 3I56V 1AI7A 1VQOV 1W2BU 1PNKA 4UVBA 1OCRC 3BY6A 5B1BC 2M7WA 2Z3YA 2Q6AA 2LFRA 3B8NA 5BZBA 2HVJC 3AG4C 3X2QC 2XASA 3JYCA 1NKDA 3AG2C 4TWKA 4BIZA 2ZXWB 3E35A 1R3KC 1VQ6V 2EINC 4Z1MG 1MG1A 3G4SV 2HLDG 3T4ZA 4JF3A 1V55C 5B1NA 5J9PC 3E2EA 2H94A 2ZDIA 1K5QA 2DW4A 3P30A 4JTAB 2XAGA 3ZMZA 3K06A 1SESA 3CCSV 4QE9A 1VQ4V 1OZ0A 4MTOA 1MABG 1E79G 3ZMVA 2QA4V 3LUTB 3F7YC 3CCLV 3K3WA 4MVZA 1QLEC 2YEVB 1NH2D 2CK3G 2XAJA 4ZBMA 1K4CC 1Y4MA 1AR1B 1M1KW 3OMNB 1QR8A 3CP1A 1K4DC 3T1CA 1M9NA 4JAUA 5H6RA 1RPOA 1K92A 2QM7A 1I5XA 5LHGA 1RM1C 2EIJC 2UXXA 1J95A 1H8HG 5GW7A 3T2MA 2PI5A 5B3SB 4JPRA 2IH3C 1HWYA 2A79B 5KUKA 2IW5A 5EBWC 3ZMUA 5IY5C 1YI2V 5CBGA 1UJWB 1GM9A 1PD3A 3R65A 2HKOA 2ZD9A 4HYOA 4JASA 2IU3A 4MTGA 1K7DA 1CP9A 1GM7A 3WFVA 1N8RW 3ABMB 1M56C 1BL8A 4BIUA 1H2GA 3ABTA 1OCZC 2EIKB 1V54C 3ZJZA 4Q20A 4R6ZA 3W7UA 1SETA 4RQEA 1THZA 1VQ9V 1FXVA 4XDLA 1NBMG 2WLMA 4MW3A 4PELA 3I55V 2W6IG 2XAQA 5B1OA 2Q68A 1K8AW 1R3JC 1AJQA 3RBZA 3UKMA 3JD3A 1M90W 1VQMV 1B6QA 4KFMA 2A9HA 2QEXV 1FXHA 1NQTA 4P30A 4X88A 4PDVA 4DXWA 2WLKA 1SRYA 3ASNC 3GWOA 1FFTB 5HFMA 2C2AA 2EZOA 4FIPC 1KD1W 4UV8A 3OFNG 4G27B 5H6QA 5IYDO 4MW8A 1OCCB 1E1RG 4MVUA 1GM8A 4H33A 2V1DA 1PNMA 5LGUA 3OW2U 1ZWIC 1K5SA 3IGAC 5H9CA 2Y69B 4GX2A 1JQ0A 3FYIB 3QNEA 1P4RA 4QE7A 4WFGA 4QIWF 4E2LA 4MVMA 1JX9A 2WPDG 4FPPA 1F23A 1ORQC 4J9YB 1F51A 2IJJA 2OTJV 1MOFA 3ABKB 2ZR2A 3SPJA 2DQ3A 4QPJA 1BMFG 1FXKB 3AG1C 2WLJA 1OCOC 3BEHA 3D36A 4PDMA 4LP8A 3OR7C 5B1AC 2ZQMA 4JTDB 3CCMV 1R6NA 4OXSA 1AJNA 1VQ5V 1W0KG 2HFEC 3FB6C 3VOUA 4UUJC 5EBMC 1JOYA 5IDJA 3CPWU 3DGEA 2K1EA 2DWDC 2R9RB 2H8PC 3JCZA 1V55B 3ZRVA 1M57B 4RUEA 3OUSA 5KUMA 1K73W 2EILC 1SERA 4RAIA 4PDRA 4KUMA 5L3CA 5LHIA 2ITDC 2ZR3A 2EIMB 3FYEB 3B77A 2WLHA 2JEUA 4MVRA 1JJ2U 3K0GA 4ASUG 5L3DA 3CC7V 4PA9A 4G28B 3SPHA 2WLIB 3EFFK 2PI4A 1VQPV 3AEIA 3STZC 5KA5A 3SYPA 1Q7YW 3E8FA 3ETEA 4LC1A 2YSUB 3W7WA 1F4NA 1S77D 3ZRWB 1R3LC 2ZXWC 1AROP 1YJNV 2EZPA 1NVPB 1AI6A 1K3EA 3OEEG 2LFSA 1KC8W 4WFBV 1L1FA 3K9AA 2B1IA 2EJRA 4XDKA 3LSSA 4N23A 4G2KA 4R8CA 4UXNA 4EKWA 4L87A 4YXWG 2F43G 2X7RB 3SPIA 1GKFA 1OHHG 1IXMA 4GX1A 3OEHG 2QTOA 1QCEA 1K34A 2X6AA 1QVFU 1VQ8V 3OE7G 4U7OA 2DYSC 2OCCB 1H38A 1ENVA 3SYOA 3RVZA 3VBBA 4HZ3A 3WG7B 2WWWA 3B8MA 1JVMA 4PA6A 1V54B 3AG3B 2LP7A 3ABLB 2BOBC 2R9IA 4LBEC 2Q69A 4JGSA 1AI4A 2HG5C 3IFXA 3JD2A 5B3SC 1QLNA 1TUEB 1QR9A 2P90A 3K0DA 5DM6V 1S72V 3W7TA 1R73A 3K04A 4HAMA 2IJIA 4MSWC 4BW5A 1AI5A 3K03A 4MVSA 4I9WA 3D3IA 2WLLB 3NXSA 3ZN1A 1H8EG 4XBFA 3TK1A 2EBOA 2WSSG 1EZJA 2X0LA 1NVPD 2AHYA 3A0RA 3P32A 4I5SA 2QM8A 4GX5A 2B5UA 3ML0A 2Q67A 2OTLV 2EIKC 2WAMA 3GB7C 4U7NA 2V7QG 3FB5C 2XAHA 4LCUC 3RVYA 5FL7G 4MTFA 3ASOB 3CXCU 1F4MA 3K08A 1ROPA 4H37A 4FK5C 2DYRB 3H01A 5HFLA 2JJ2G 3JD1A 3T4DA 4BAYA 3CCJV 2X6CA 3OUFA 4MVOA 4WFEA 1EBOA 3CCEV 2IJHA 3ETGA 2NNUA 4PDLA 3W7XA 3KG2A 1OCOB 3CCQV 3ZCCA 4X8AA 4DO2A 5B1AB 3QO8A 1DF5A 2W0FC 1OCRB 4MVQA 5B1BB 3QO7A 4P9OA 3SJQC 4GT1A 1DF4A 3AG4B 2GSMB 3X2QB 3AG2B 1GTOA 4KP4A 3UM7A 4QNHB 1SZTA 3FKSG 5L3EA 2AHZA 2Y69C 2UXNA 2EINB 5CA3A 4GCZA 3QO5A 3LDDA 1S5HC 4CBCA 1Q86W 3DTUB 4F4LA 3CMAV 2HJFC 3ETDA 1S76D 5EBLC 4JTCB 5LGTA 4MTXA 5CBFA 2X6BA 4JYBA 2W6JG 2JIZG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q81 W;  1KD1 W;  3I56 V;  3G71 V;  3CCU V;  1VQO V;  1W2B U;  1YJ9 V;  1VQ7 V;  3CCS V;  4WFA V;  1JJ2 U;  3CC2 V;  3CC4 V;  3CCM V;  1VQ9 V;  3CC7 V;  3CXC U;  1VQ4 V;  3OW2 U;  4WCE V;  1YHQ V;  1YJW V;  1VQ5 V;  1S72 V;  5DM6 V;  1QVF U;  1R73 A;  2QA4 V;  1VQ8 V;  3G6E V;  3CME V;  3CCL V;  3CPW U;  1YI2 V;  3I55 V;  1VQP V;  2D3O W;  1K8A W;  1VQL V;  3CCJ V;  1M90 W;  1Q7Y W;  1Q82 W;  1YIT V;  1VQ6 V;  1VQM V;  1VQN V;  2OTJ V;  2QEX V;  1M1K W;  3CD6 V;  1YJN V;  3CCE V;  3G4S V;  3CCR V;  3CCV V;  1VQK V;  1Q86 W;  1K73 W;  1KC8 W;  3CMA V;  4WFB V;  1QVG U;  1N8R W;  1YIJ V;  3CCQ V;  1KQS U;  4WF9 V;  1K9M W;  2OTL V;  1NJI W; 
#chains in the Genus database with same CATH topology
 3F5W C;  4DR4 O;  4N21 A;  5J2T B;  1SQQ H;  2BSK A;  5LGN A;  3JD4 A;  3ZRW A;  4RQF A;  2KQX A;  3E22 B;  2YI9 A;  3ZHQ A;  4B7K A;  2JEX A;  1LUV A;  3RYI A;  4FJC C;  4RO2 A;  3L74 H;  1GO3 F;  1P49 A;  1DTO A;  2IJK A;  2PUS A;  2VRZ A;  1M57 C;  1W0J G;  3VQY A;  4HNA A;  1R3I C;  2P67 A;  1AJP A;  1RM1 B;  2A06 H;  2VQE O;  2JVD A;  4DK1 A;  3CCU V;  1KP2 A;  5IWA O;  3UQ8 A;  5IY5 B;  1B3Q A;  3LDE A;  1BHA A;  1JJO A;  1GMG A;  3RYF A;  5FNV B;  1QQC A;  4PA4 A;  4DR5 B;  3B2E E;  1OCZ B;  3MD0 A;  1I5Y A;  1JCH A;  4IIJ A;  3E89 A;  1R6K A;  1LNQ A;  1Q81 W;  1SA0 B;  3E8H A;  1BSM A;  1VQ7 V;  2WLL A;  2DWE C;  2E5L B;  3RN4 A;  1BE3 H;  2KB1 A;  1J5E O;  4L8J A;  4X65 O;  3J81 N;  1PM9 A;  4JYC A;  2A7W A;  4MS2 A;  4BWA A;  2A0L A;  1IBK B;  1P7B A;  3OMA B;  2PZS A;  3F7V C;  1M4U A;  2R72 A;  1NTM H;  3HKC B;  3ZHT A;  3ZMS A;  1YVW A;  3AG3 C;  4ABM A;  2AZ0 A;  1N32 B;  5LMN O;  3ABL C;  1XI1 A;  2ZT9 B;  5L3B A;  4PA3 A;  3RGB A;  3VQW A;  4NR1 A;  4WFA V;  2FTK A;  2NLJ C;  2HR3 A;  4JAV A;  3ZIA G;  1WPX A;  2Q73 A;  3FFQ A;  1EZV H;  2YXL A;  4IYI A;  5GTI Z;  1IBL O;  3IC7 A;  1COW G;  1TAE A;  3AG1 B;  5LBQ A;  1T5E A;  1XL6 A;  2YDE A;  4WFH A;  1NU1 H;  5LMU O;  3OT7 A;  5J2U B;  4PA7 A;  4EFB A;  3RW0 A;  1OCC C;  1PKX A;  2VWK A;  1IVS A;  2DYR C;  3DC6 A;  4DR7 B;  3E86 A;  3K79 A;  2EIL B;  3CCV V;  3TET A;  4FLY A;  3AG7 A;  3K57 A;  1XEQ A;  3K5L A;  4O4I B;  3JAS B;  3H1L H;  4GZR B;  1NJI W;  1VQO V;  1PNK A;  5DEC A;  1OCR C;  2Z3Y A;  1O9H A;  2HVJ C;  4LH6 A;  3RT3 C;  4DW0 A;  3JYC A;  4BIZ A;  2ZXW B;  3E35 A;  3L71 H;  4BW9 A;  4NXN B;  3QG5 A;  5J9P C;  4FM1 A;  4LF5 O;  1HR0 B;  2A3Q A;  4B3R B;  3AK1 A;  5DED A;  2QGN A;  1I94 O;  1VQ4 V;  1OZ0 A;  2ZE8 A;  3ZMV A;  3F7Y C;  4JZ2 A;  4O4H B;  4UB8 Z;  2IBZ H;  5BXZ A;  1M1K W;  3M7M X;  2YUA A;  2QJ1 A;  1K4D C;  1NT2 B;  4YHH O;  1HNW B;  2JRI A;  5LHG A;  1RM1 C;  1J95 A;  5GW7 A;  3T2M A;  2PI5 A;  4PJ0 Z;  2ZKO A;  1IBM B;  2IH3 C;  3THO A;  2A79 B;  2O57 A;  1JFF B;  2F93 B;  5IY5 C;  1VEW A;  1TVK B;  3HKB B;  1GM9 A;  4TV9 A;  5H2F Z;  4JAS A;  4MTG A;  1CP9 A;  4IL6 Z;  3ABM B;  4LF7 B;  1BL8 A;  2IM9 A;  1OCZ C;  4X1I B;  1V54 C;  1WA8 B;  2VQE B;  1SET A;  4RQE A;  2R70 A;  1XRE A;  4X62 O;  4X1K A;  1FXV A;  1XNQ O;  1NBM G;  2WLM A;  3OTO O;  2NR5 A;  3SJC C;  5LA6 A;  2Q8V A;  1K8A W;  1EN5 A;  1R3J C;  1M90 W;  3HKD B;  4LF4 B;  1AR4 A;  4DXW A;  3K9S A;  4JI5 O;  2WLK A;  4DR2 O;  4DR1 O;  1FFT B;  5HFM A;  1YDX A;  2K9P A;  2EZO A;  5IJ9 B;  3C90 A;  3OFN G;  3GVM A;  4G27 B;  1KU9 A;  2RMK B;  2V1D A;  1PNM A;  1ZX3 A;  1L8D A;  1F7Y A;  1P4R A;  4FPP A;  2IJJ A;  2OTJ V;  2ARH A;  3ABK B;  2ODM A;  2ZR2 A;  1BT8 A;  4PI2 A;  3WB1 A;  5KX5 B;  5J2T A;  3AK3 A;  3AG1 C;  5B66 Z;  5LMN B;  3OR7 C;  3E22 A;  2ZNI A;  4C7U A;  4O2A B;  4H0L B;  1AJN A;  5EBM C;  1RP3 B;  1JOY A;  3JAM N;  3DGE A;  1AP6 A;  2BE3 A;  2Y0P A;  3OGI B;  4UCV A;  3JCZ A;  4RUE A;  4U3J B;  3OUS A;  2EIL C;  4KUM A;  1SZX A;  2EIM B;  3B77 A;  2PYL A;  2CTQ A;  4MVR A;  1JJ2 U;  5FNV A;  4ZIB A;  2WLI B;  3G80 A;  2PI4 A;  3STZ C;  5KA5 A;  3SYP A;  4DR3 O;  3E8F A;  2YSU B;  4AI8 A;  3CSX A;  1F4N A;  3ZRW B;  2ZXW C;  4EEQ A;  1NVP B;  1AI6 A;  1SA0 A;  1L1F A;  3A2F A;  1LR1 A;  1XMO O;  1JA8 A;  2UUA O;  4NXM O;  5H5N A;  5IE9 A;  2QKA A;  4JI1 O;  2F4V B;  1G6U A;  1WNS A;  1Q8I A;  4HNA B;  3SPI A;  4ZI7 B;  1OHH G;  2QTO A;  2Q7H A;  3ZHS A;  1GN4 A;  1Q6U A;  1VQ8 V;  2DYS C;  1BS3 A;  3HKC A;  3VBB A;  3HR0 A;  3WG7 B;  1YXB A;  3B8M A;  4CS3 A;  4PA6 A;  1NZ6 A;  4D7S A;  4JI6 B;  1YEW A;  4TUY A;  4O4L B;  4LBE C;  1AI4 A;  2HG5 C;  2GUZ B;  3QTC A;  3JD2 A;  4JAA A;  1QLN A;  1QR9 A;  2LW1 A;  3K0D A;  4HAM A;  2IJI A;  4FVM A;  4I9W A;  2EX3 A;  1VF5 B;  2WLL B;  2RNB A;  3ZN1 A;  3UO2 A;  4LFB B;  2V4D A;  4D6T H;  2WSS G;  5IYZ B;  5JJJ B;  5LP6 C;  5BY1 A;  5J2U A;  4YJ2 B;  1WJZ A;  4HBN A;  4K0K O;  3AK2 A;  4J7Z A;  3ASO B;  1ROP A;  4TQF A;  1N4C A;  1B04 A;  3H01 A;  5HFL A;  3JD1 A;  4BAY A;  2N74 A;  3CCJ V;  4O4I A;  3K59 A;  1N0N A;  1EBO A;  3CCE V;  2XUM A;  2NNU A;  4PDL A;  1Z2G A;  3KG2 A;  3CCQ V;  3ZCC A;  2PYJ A;  5A9G A;  1DF5 A;  4MVQ A;  4P9O A;  5K1X A;  4X62 B;  3CHX A;  2GSM B;  4H13 B;  4KP4 A;  4GUN A;  3UM7 A;  3BA9 A;  3RYC A;  4O2B B;  3CRQ A;  2AHZ A;  2Q0O C;  3DC5 A;  1S5H C;  4DV5 O;  1Q86 W;  1MMM A;  4LFA B;  1NI8 A;  4F4L A;  3D3Q A;  3CMA V;  4JI5 B;  2WA4 A;  5EBL C;  4DR1 B;  3LSU A;  5CBF A;  3G67 A;  2W6J G;  2ZE6 A;  4O4H A;  4LF8 B;  3JSL A;  1FS0 G;  1XDC A;  1YJW V;  4J10 A;  4DV6 B;  3TCU A;  2WLN A;  3BAA A;  1KKD A;  1QLE B;  1HNZ O;  2P4K A;  1G8M A;  4UCS A;  3CYO A;  5EC1 C;  2RCV A;  5EK0 A;  2KG7 B;  1X4T A;  1H2N A;  1K9M W;  4DV2 O;  1JFF A;  1NR1 A;  4H44 B;  2EIM C;  3CJH B;  3HKB A;  3WB0 A;  5E1A C;  1G4Y B;  4EB6 A;  3JAR B;  3BFR A;  4CZZ A;  2P6J A;  3UCS C;  3D8C A;  3H9V A;  4X1I A;  3JSN A;  1PL0 A;  4EFE A;  5BMV B;  1WA8 A;  5GON B;  5GTH Z;  3A8T A;  5KHK A;  2W0X A;  1LUW A;  3ZED A;  3PN1 A;  1GN3 A;  4DYL A;  4ZKI A;  2QWP B;  4YY3 O;  4DUY O;  1NR7 A;  1Y74 B;  3FAV B;  3SPG A;  1EN6 A;  3OMI B;  3HKD A;  3G6E V;  3BHP A;  2ZDI C;  5CMU A;  4B7E A;  4I50 B;  4X89 A;  2IH1 C;  4RUF A;  1S5L Z;  4JI3 B;  1KP3 A;  3WG7 C;  1H2K A;  5IJ9 A;  4FLT A;  2WA3 A;  2LO1 A;  3APO A;  3EHB B;  2AGA A;  4LF9 O;  2UUA B;  1HDJ A;  3LNM B;  3DSQ A;  4JI1 B;  4NVP A;  2F1M A;  4NTW A;  1CEZ A;  2FL4 A;  2P22 C;  1MSW D;  4AQY B;  5KX5 A;  2QM4 A;  3HPL C;  4F6R B;  2LJ2 A;  1E1Q G;  4JV5 O;  2XAF A;  3CCR V;  2Z5U A;  1YIJ V;  3JAT B;  3KCY A;  4O2A A;  4DV1 O;  2QE7 G;  4NTX A;  1YJ9 V;  3QVN A;  1YHQ V;  4UFZ A;  3ASO C;  4U3J A;  2CAZ C;  3CME V;  3SYC A;  5JVD A;  4DV3 B;  4KXR A;  1Q82 W;  1WP8 A;  4J9Z B;  1N34 O;  1VQK V;  2AZ2 A;  4WF9 V;  2ZNJ A;  2WLI A;  4UVB A;  2YIB D;  1FPO A;  2Q6A A;  4ZHQ A;  2LFR A;  5BZB A;  1RFY A;  3K5M A;  4Z1M G;  1MG1 A;  3G4S V;  4AHC A;  3T4Z A;  2F95 B;  1TUB B;  4ZI7 A;  5BR8 O;  3FD9 A;  2H94 A;  2ZDI A;  1L0N H;  1K5Q A;  1UFI A;  2DW4 A;  1XHZ A;  1A32 A;  1SES A;  4TV8 B;  3CCS V;  2AXT Z;  2DE0 X;  2YC0 A;  1E79 G;  4PD4 F;  2E75 B;  3CCL V;  4MVZ A;  1I7F A;  1QLE C;  4U3F H;  1NH2 D;  2CK3 G;  4LR3 A;  4B3S O;  1K4C C;  4O4L A;  4DV5 B;  3CP1 A;  3T1C A;  4JI0 B;  1URF A;  2GUZ A;  3VQV A;  3T1Y O;  3N2K A;  1I5X A;  2YXH A;  1Z5V A;  4PHZ A;  1M5I A;  1XOU A;  3KCX A;  4JI2 O;  5KUK A;  3ZMU A;  2JGD B;  1HNZ B;  4JI4 O;  1UJW B;  5IYZ A;  3ETQ A;  4YJ2 A;  1MNG A;  2KKW A;  2ZM6 B;  3WFV A;  3H1K H;  1Y6X A;  1HNX O;  2F23 A;  1US6 A;  1AVM A;  1U97 A;  4R6Z A;  3W7U A;  1XUQ A;  4DV2 B;  1GH6 A;  3CB2 A;  1FYJ A;  1Q43 A;  4TUY B;  3L75 H;  4XDL A;  2ZE5 A;  5EIB C;  4MW3 A;  4B3M B;  2W6I G;  2XAQ A;  2Q68 A;  3UKM A;  1AJQ A;  2A9H A;  1XIL A;  4P30 A;  4X88 A;  1SF9 A;  2VQF B;  3GWO A;  3CRM A;  2HHH O;  1KD1 W;  4UV8 A;  2RQ6 A;  4O2B A;  5JJN B;  5IYD O;  1E1R G;  3O65 A;  4H33 A;  4DUY B;  5LL6 Y;  1ZWI C;  2Y69 B;  4GX2 A;  1JQ0 A;  4QE7 A;  2UXB O;  1JX9 A;  2ZIM A;  1ORQ C;  4J9Y B;  1F51 A;  1MOF A;  1H2S B;  4B3T O;  3SPJ A;  1BQZ A;  1SS3 A;  4LF6 O;  4I55 B;  3L70 H;  1FXK B;  1BMF G;  4FLW A;  3BEH A;  4PDM A;  4LP8 A;  4JTD B;  1R6N A;  1W0K G;  3VOU A;  3G6B A;  3P3P A;  2K1E A;  2KG7 A;  2RN9 A;  2R9R B;  3ZRV A;  1V55 B;  1YCI A;  3F5T A;  2UU9 O;  3H1J H;  3RYC B;  2PY5 A;  4RAI A;  4I0X B;  4PDR A;  5L3C A;  3CJH A;  3UO3 A;  2ITD C;  1D2D A;  3JAR A;  3K0G A;  3N27 A;  4X66 O;  3SJB C;  4G28 B;  5BMV A;  4LFC O;  5GON A;  1Q7Y W;  3ETE A;  1AB3 A;  3IC9 A;  3BAB A;  3K58 A;  1YJN V;  5B5E Z;  1TA8 A;  2RDC A;  3OEE G;  1N36 O;  4WFB V;  2GV9 A;  3NR7 A;  1Y74 A;  2HJD A;  3FAV A;  1JMK C;  2P5O A;  4GKK B;  4XDK A;  4N23 A;  2JS3 A;  4UXN A;  4EKW A;  1ZAU A;  4DR4 B;  4I50 A;  1L0L H;  1IXM A;  3TGU H;  5TIS Z;  2X6A A;  5JH7 A;  3LNN A;  4U7O A;  2OCC B;  1H38 A;  2VS0 A;  1ENV A;  3EXA A;  4HZ3 A;  3K5N A;  2UUC O;  2PTM A;  2WWW A;  4EB6 B;  4LWS B;  1GN2 A;  1I08 A;  2LP7 A;  2BOB C;  1BGY H;  3P3N A;  4JGS A;  4E4E A;  2B9Z A;  1FAF A;  4K35 A;  5IWA B;  1S72 V;  4F6R A;  1R73 A;  2F66 C;  4ZOL B;  1ZSP A;  4FLV A;  1Q6I A;  3NXS A;  3JAT A;  1H8E G;  4FZ0 A;  4XBF A;  3TK1 A;  1QNM A;  4J11 A;  2EBO A;  1EZJ A;  5KHH A;  2YXY A;  3A0R A;  1XMQ O;  3M8A A;  3P32 A;  4I5S A;  4GX5 A;  2OTL V;  2Q67 A;  3GB7 C;  4U7N A;  2V7Q G;  3FB5 C;  3RVY A;  4H37 A;  2RJZ A;  2GTS A;  4FLX A;  2JJ2 G;  1WAZ A;  4JI4 B;  1J5E B;  2X6C A;  4X65 B;  4DV7 O;  4ICG A;  4MVO A;  3I5D A;  2IJH A;  3ETG A;  1OCO B;  4J41 A;  3S3W A;  5B1A B;  5B1B B;  2DOS A;  3SJQ C;  4TQD A;  4OX9 O;  3X2Q B;  1GTO A;  4PI0 A;  2Y69 C;  2UXN A;  5CA3 A;  1TUB A;  4GCZ A;  1N0J A;  1M93 A;  5JVD B;  1IBL B;  4TV8 A;  4JTC B;  1S5J A;  4YIP A;  2JIZ G;  5A2Q N;  3Q4H B;  1GRJ A;  1H2L A;  2DJV A;  3UT5 B;  2QKC A;  5LMU B;  5AG2 A;  3ZRS A;  2HVK C;  3JAK B;  4P9P A;  2ADQ B;  2XOK G;  4ZHQ B;  1I0H A;  2ZCE A;  3E83 A;  1Q6H A;  1Y66 A;  2EIJ B;  2BTQ B;  1DLB A;  4GLX A;  4FLZ A;  2JJ1 G;  2JGD A;  3ABU A;  3CC4 V;  4X64 O;  4X1Y B;  1Q90 D;  4YJ3 A;  2MK3 A;  3WU2 Z;  4YIO A;  5LXT B;  1YIT V;  1P84 F;  2FML A;  2EUL A;  4Z2W A;  3SPC A;  3MHS C;  1M56 B;  2XTA A;  4DV0 O;  2FYU H;  3FB7 C;  4P2Z A;  4FM2 A;  1IX9 A;  4OPA A;  4LF5 B;  1IXB A;  4R50 A;  3C3S A;  1Y76 A;  4WBN B;  4UVA A;  4J80 A;  4OPH A;  1YTF D;  3PJS K;  2JGU A;  3JAW B;  4TT3 G;  1I94 B;  1S0V A;  3N2K B;  1AIL A;  1GAX A;  3ZN0 A;  1VQL V;  2OCC C;  3CRA A;  5IYC O;  1PPJ H;  2P7T C;  5EC2 C;  2XND G;  3OGC C;  3HKE B;  4KHP O;  3O9O A;  4TSF G;  4YHH B;  3ABM C;  1YSC A;  5D5Q A;  3JCU Z;  3RWR D;  5KA6 A;  3MHH C;  5KLV H;  3SDL A;  3OTF A;  2Q0A A;  4XDJ A;  4X20 B;  5JQG B;  2MW2 B;  1PL4 A;  1QU7 A;  4UV9 A;  4I55 A;  1VQN V;  1FXK A;  4QJF B;  1RPR A;  1WLE A;  2DQ0 A;  5CBH A;  3L9D A;  4QPK A;  2LQT A;  2ZE7 A;  2LW7 A;  4UVC A;  1EM1 A;  1XL4 A;  2QWR B;  1SQX H;  1QHT A;  4WCE V;  4B08 A;  3ZHV A;  1XNQ B;  5L3G A;  1K97 A;  1G1X B;  3OTO B;  3CS5 A;  2FKX A;  2D3O W;  1NH2 B;  4I0X A;  4MT8 A;  5KMG A;  5CN0 A;  2PGG A;  1KMI Z;  4R7C A;  3ABK C;  3SJA C;  4DR2 B;  1MZF A;  1KKC A;  3IJ4 A;  2L35 A;  4FMT A;  1SQF A;  3I56 V;  1XNR O;  3BY6 A;  1UPG A;  5B1B C;  3B8N A;  2YIC A;  3RYH B;  5FPR A;  3X2Q C;  1ZUQ A;  2XAS A;  1NKD A;  4TWK A;  1AR5 A;  1R3K C;  4LNU B;  4DR5 O;  4UCR A;  1FJG O;  3J7A U;  5B1N A;  1DGS A;  1V9P A;  4GYC B;  1BCC H;  3VQX A;  4DV4 O;  2E5L O;  2QDO A;  4MTO A;  1MAB G;  5E79 Z;  2QA4 V;  3LUT B;  4Z1V A;  2D2C B;  1GN6 A;  4LWS A;  4NYK A;  2YEV B;  1VF6 A;  2XAJ A;  4ZBM A;  1Y4M A;  1IBK O;  3FX7 A;  1AR1 B;  3H1I H;  3OMN B;  1QR8 A;  4CS4 A;  2CTR A;  2KSD A;  3DXR B;  1N32 O;  4CS2 A;  1RPO A;  2QR4 A;  1OJH A;  2EIJ C;  1H8H G;  2R9A A;  2M6Y A;  4OGQ B;  4ZOL A;  4W4K A;  5EBW C;  1SKV A;  1MZE A;  3ZHR A;  1PD3 A;  3R65 A;  2HKO A;  4HYO A;  4DR3 B;  2IU3 A;  1VF7 A;  5IT9 N;  4F6E A;  5JH7 B;  1XQ8 A;  4K3A A;  1M56 C;  4BIU A;  1H2G A;  1WPB A;  3ABT A;  4NKG B;  2EIK B;  2DMX A;  4Q20 A;  4JI8 O;  1XMO B;  4DRX A;  4NXM B;  1KYO F;  1THZ A;  1VQ9 V;  1P7G A;  4PEL A;  3I55 V;  4DR7 O;  5B1O A;  3JD3 A;  1B6Q A;  1WN7 A;  2QEX V;  2Q4P A;  1NQT A;  3A0H Z;  5CA0 B;  3CEI A;  5LYJ B;  1W59 A;  1KB9 F;  1SRY A;  2QWN B;  5KHI A;  2YIA A;  3CXH F;  4FIP C;  4JI7 O;  5H6Q A;  1OCC B;  2UXD O;  5LGU A;  3IGA C;  5H9C A;  4WFG A;  3FYI B;  1SQP H;  3QNE A;  4E2L A;  4MVM A;  4NXN O;  2H3O A;  2HP8 A;  4FZ1 A;  3CX5 F;  1NTK H;  3Q4H A;  4QPJ A;  3UT5 A;  5FLX N;  2YID A;  4BR6 A;  3JAK A;  5KHG A;  2ZQM A;  4K0K B;  3CCM V;  2HFE C;  1DK1 A;  5IDJ A;  3CPW U;  2DWD C;  4K8Z A;  2H8P C;  2BTQ A;  1HNW O;  1WB7 A;  1SER A;  5LHI A;  2ZR3 A;  4X1Y A;  1IBM O;  3FYE B;  5IJ0 B;  4I9Q A;  2JEU A;  4ASU G;  5L3D A;  4PA9 A;  5LXT A;  3SPH A;  1ZL8 B;  4O4J A;  1B06 A;  4UCU A;  4LC1 A;  1R3L C;  1ARO P;  1X59 A;  4J7K A;  4WBN A;  2EZP A;  4LF7 O;  1K3E A;  1KC8 W;  1VMG A;  1H2M A;  3K9A A;  2B1I A;  3JAW A;  4JYY A;  2EJR A;  3LSS A;  4G2K A;  3T1H O;  5CA1 B;  1XNR B;  4DR6 O;  2F43 G;  2X7R B;  1GKF A;  1K34 A;  3SYO A;  3HKE A;  3BA8 A;  4LF4 O;  2JS5 A;  1FJG B;  4UCT A;  4YJ3 B;  2YIB A;  1V54 B;  5KAF Z;  2YI8 A;  1D5N A;  5FPO A;  2Q69 A;  4X20 A;  5JQG A;  2PF4 E;  4DV4 B;  1TUE B;  5DM6 V;  1Y76 B;  3WB2 A;  3K04 A;  2E74 B;  4BW5 A;  3K03 A;  4MVS A;  2Q9L A;  3ZBH A;  3CWB H;  4J42 A;  4X9Q A;  2QM8 A;  5KAI Z;  2EIK C;  2XAH A;  5ITZ A;  5FL7 G;  4MTF A;  2E76 B;  4YY3 B;  3CXC U;  1F4M A;  1VAR A;  4FK5 C;  4IT5 A;  3T4D A;  3OUF A;  4BIO A;  1JR9 A;  3W7X A;  2QWQ B;  2UXC O;  3ZX6 A;  2CH7 B;  2UUB O;  2DN9 A;  4X8A A;  4DO2 A;  4GKJ O;  4LF9 B;  3RYH A;  4JI8 B;  2N04 A;  4IHJ B;  4GT1 A;  3BRC A;  4FFB B;  2HEP A;  3ICX A;  3AG4 B;  4LNU A;  5EIB D;  1BZK A;  3AG2 B;  3ZS8 C;  1SZT A;  5L3E A;  2EIN B;  3QO5 A;  2QTS A;  1U96 A;  4CBC A;  4CH4 A;  3A0B Z;  3DTU B;  3ETD A;  4JV5 B;  2OYQ A;  4Q6G A;  5KMG B;  5LGT A;  4MTX A;  2X6B A;  4JYB A;  2F4V O;  3JAL B;  4DV1 B;  3TJT A;  1YTF B;  4JI7 B;  2JK5 C;  5LHH A;  2CUG A;  2YEV A;  3BCC H;  2UXD B;  3L73 H;  2Y48 A;  1WB8 A;  3W7S A;  2B1G A;  1KBH A;  4A5U B;  4IYH A;  3DXR A;  2FB5 A;  2ILM A;  3LDC A;  1FFX B;  4JI6 O;  1SQB H;  1N34 B;  1PNL A;  1QBZ A;  3OAA G;  2IU0 A;  2BCC H;  2GHY A;  1IUR A;  1EN4 A;  2QKS A;  2DYS B;  3ZRX A;  3N2G A;  4D7T A;  4DUZ O;  2OWO A;  2QWO B;  1S3J A;  3E8B A;  1K33 A;  4LFB O;  5L3F A;  2AW9 A;  2CTW A;  3JD0 A;  1AP5 A;  3K5O A;  3ZMT A;  3U0Z A;  5C8Y B;  3QF7 A;  3U11 A;  3LSQ A;  5BR8 B;  3G71 V;  1KEC A;  1MSD A;  2Z0A A;  2OT5 A;  2ETN A;  3SR2 C;  3SGI A;  4GX0 A;  2E3C A;  5CA0 A;  5LYJ A;  5LOV A;  1ZLZ A;  2YS8 A;  4WFF A;  5LP6 B;  4B3S B;  2JDI G;  3ASN B;  2ITC C;  1JPX A;  4J7J A;  1VIB A;  3T1Y B;  1CPY A;  3FB8 C;  3STL C;  3T1H B;  3OM3 B;  3CC2 V;  2XT9 A;  4DR6 B;  4I4T B;  4JI2 B;  3ZHU A;  2P4V A;  4DRX B;  1XBL A;  1HP8 A;  3U10 A;  5CB4 B;  4LFA O;  3E8G A;  5EYP B;  1RSO B;  2ATK C;  1GK9 A;  1KQS U;  1HNX B;  3SYQ A;  2GDS A;  3M99 B;  3SYA A;  1BQ0 A;  5IYB O;  4LF8 O;  1BHB A;  2BTO A;  4DV6 O;  5DN6 G;  1IDS A;  1NTZ H;  2CTP A;  5EZY B;  3OR6 C;  3CD6 V;  1EFR G;  3HB3 B;  4FM0 A;  1QVG U;  5IJ0 A;  5C93 A;  2BOC C;  1D5A A;  2OIG A;  1N33 O;  4IGG A;  1HW7 A;  2EJ7 A;  1FXK C;  1AI7 A;  1ZL8 A;  2CGO A;  1W2B U;  2HHH B;  3IAY A;  3TXS A;  2M7W A;  5D5P A;  1OV9 A;  3AG4 C;  3CE2 A;  3AG2 C;  2VWJ A;  2UXB B;  3BPZ A;  1VQ6 V;  2EIN C;  5JJE B;  2LGW A;  2CDY A;  2HLD G;  4JF3 A;  1V55 C;  5CA1 A;  4JYA O;  2Y0I A;  4B3T B;  4AIL C;  2UXC B;  4LF6 B;  3E2E A;  2UUB B;  4GKJ B;  3P30 A;  4JTA B;  2XAG A;  3ZMZ A;  3K06 A;  4QE9 A;  1R1B A;  3S3X A;  3D36 C;  3K3W A;  3L72 H;  2BSK B;  4JI3 O;  4PV1 B;  4O4J B;  1M9N A;  3RFR A;  3RYI B;  4JAU A;  5H6R A;  2UU9 B;  1K92 A;  2QM7 A;  2G38 A;  2GTA A;  2UXX A;  1ZTE A;  5B3S B;  4JPR A;  1HWY A;  4DW1 A;  2IW5 A;  2CE4 A;  3B4S A;  4X66 B;  1YI2 V;  5CBG A;  4AQY O;  4CH6 A;  2ZD9 A;  4CH3 A;  4LFC B;  1R6T A;  3MDS A;  1K7D A;  1GM7 A;  1N8R W;  1Y67 A;  3RYF B;  1N36 B;  5JCO C;  1Z5W A;  3ZJZ A;  1VF6 C;  4KL1 A;  4IIJ B;  2P06 A;  2ZIN A;  4DV3 O;  4DUZ B;  3RBZ A;  4LH7 A;  2CH7 A;  1VQM V;  4KFM A;  1FXH A;  3CRC A;  2UUC B;  4PDV A;  4CC5 A;  1SC5 B;  2Q7E A;  4NB5 A;  2Q5Z A;  3ASN C;  4IHJ A;  4FFB A;  2C2A A;  1KUQ A;  1WP7 A;  2OCH A;  1YZB A;  4MW8 A;  4MVU A;  1GM8 A;  3OW2 U;  1K5S A;  4QIW F;  2WPD G;  1YF2 A;  1F23 A;  5ITZ B;  1XHX A;  3JAS A;  1MA1 A;  3JAL A;  2DQ3 A;  1IZ3 A;  1XMQ B;  2WLJ A;  1OCO C;  3D36 A;  4NTY A;  1TGO A;  5B1A C;  4OXS A;  1VQ5 V;  1FFX A;  3FB6 C;  4UUJ C;  2CGN A;  1M57 B;  4DV7 B;  5KUM A;  4JI0 O;  1K73 W;  5K1P A;  4CH5 A;  5JWP A;  5KHJ A;  2L6L A;  2WLH A;  3CC7 V;  1VP7 A;  3EFF K;  4OX9 B;  1SQG A;  1VQP V;  3AEI A;  1Q3E A;  5JCO A;  5C8Y A;  2ZM6 O;  3W7W A;  4I7Z B;  1S77 D;  4UCO A;  3APQ A;  1CXZ B;  2LFS A;  2NN4 A;  2LGQ A;  3BVO A;  4TOI A;  4K8X A;  1N33 B;  2Y4T A;  3EVK A;  4R8C A;  4RWU A;  1TVK A;  4L87 A;  4YXW G;  3KZI Z;  3CRR A;  4GX1 A;  3OEH G;  4B3M O;  1QCE A;  4DK0 A;  1QVF U;  3OE7 G;  5LP6 A;  2Q7G A;  4W4L A;  3TXQ A;  3RVZ A;  4FLU A;  3N2G B;  1JVM A;  4QGP A;  1Q5O A;  3AG3 B;  2VQF O;  4JYA B;  3ABL B;  4I4T A;  2R9I A;  2Y4U A;  3IFX A;  5B3S C;  3H1H H;  1FD9 A;  2P90 A;  3B09 A;  5CB4 A;  4X64 B;  3W7T A;  4MSW C;  5EYP A;  1AI5 A;  1RSO A;  3D3I A;  4UB6 Z;  3KKY A;  3MAQ A;  2X0L A;  1NVP D;  2AHY A;  4TV9 B;  5F2V O;  4DV0 B;  5LOV B;  2B5U A;  4CC6 A;  3ML0 A;  3OD4 A;  2N05 A;  2WAM A;  3J80 N;  1PV0 A;  2OIE A;  4LCU C;  5EZY A;  1SQV H;  3K08 A;  2DYR B;  4X1K B;  2XHB A;  4WFE A;  3GWK C;  4JZG A;  1FKA O;  5LA6 B;  1NS1 A;  4FFK A;  3R66 A;  2GBO A;  1O9G A;  4KHP B;  1HR0 O;  2ZIO A;  3B40 A;  2ADP A;  3QO8 A;  4B3R O;  2W0F C;  1OCR B;  3QO7 A;  1DF4 A;  4QNH B;  3FKS G;  3LDD A;  2QSA A;  2HJF C;  1S76 D;  4GKK O;  1PP9 H;  3C3T A; 
#chains in the Genus database with same CATH homology
 3F5W C;  1YTF B;  4N21 A;  2JK5 C;  5LHH A;  2YEV A;  5LGN A;  1FS0 G;  2Y48 A;  3JD4 A;  3ZRW A;  1YJW V;  4RQF A;  3ZRS A;  2HVK C;  2B1G A;  2WLN A;  4P9P A;  3TCU A;  3W7S A;  1KKD A;  1QLE B;  2JEX A;  1G8M A;  3CYO A;  3LDC A;  4FJC C;  2XOK G;  5EC1 C;  3E83 A;  4RO2 A;  1GO3 F;  1DTO A;  2IJK A;  1M57 C;  1W0J G;  5EK0 A;  1R3I C;  1Y66 A;  2P67 A;  1AJP A;  1RM1 B;  2EIJ B;  1K9M W;  1PNL A;  1QBZ A;  1DLB A;  3OAA G;  2IU0 A;  1NR1 A;  3CCU V;  2JJ1 G;  1KP2 A;  2EIM C;  2GHY A;  3ABU A;  3CC4 V;  5E1A C;  2QKS A;  1G4Y B;  2DYS B;  3LDE A;  5IY5 B;  3ZRX A;  1BHA A;  4CZZ A;  2P6J A;  2MK3 A;  1S3J A;  3E8B A;  1K33 A;  1GMG A;  5L3F A;  1YIT V;  4PA4 A;  3SPC A;  3MHS C;  1M56 B;  1PL0 A;  3JD0 A;  1OCZ B;  3MD0 A;  3ZMT A;  1I5Y A;  3FB7 C;  4P2Z A;  1JCH A;  4R50 A;  3E89 A;  1R6K A;  3LSQ A;  4UVA A;  1LNQ A;  1Q81 W;  4ZKI A;  3E8H A;  3G71 V;  1VQ7 V;  1KEC A;  1YTF D;  3PJS K;  1NR7 A;  2OT5 A;  3SPG A;  2WLL A;  2DWE C;  4TT3 G;  3OMI B;  1S0V A;  3G6E V;  2KB1 A;  2ZDI C;  4GX0 A;  3ZN0 A;  5CMU A;  1VQL V;  2OCC C;  4X89 A;  4JYC A;  2IH1 C;  5IYC O;  4RUF A;  4MS2 A;  1KP3 A;  4WFF A;  2P7T C;  2A0L A;  5EC2 C;  3WG7 C;  2XND G;  2JDI G;  3OGC C;  1P7B A;  3OMA B;  3ASN B;  3F7V C;  2ITC C;  3ZMS A;  1JPX A;  3EHB B;  3AG3 C;  4TSF G;  3ABM C;  3ABL C;  3LNM B;  1YSC A;  1CPY A;  4PA3 A;  5L3B A;  3FB8 C;  3STL C;  3OM3 B;  4WFA V;  5KA6 A;  3CC2 V;  3MHH C;  2FTK A;  2NLJ C;  2HR3 A;  4JAV A;  3ZIA G;  1CEZ A;  4XDJ A;  4UV9 A;  1WPX A;  1VQN V;  1MSW D;  1FXK A;  3HPL C;  4QJF B;  1E1Q G;  1RPR A;  2XAF A;  3E8G A;  3CCR V;  3IC7 A;  1COW G;  2Z5U A;  1WLE A;  2DQ0 A;  5CBH A;  1YIJ V;  3AG1 B;  5LBQ A;  2ATK C;  1GK9 A;  1KQS U;  4QPK A;  3M99 B;  3SYQ A;  2QE7 G;  3SYA A;  1XL6 A;  4UVC A;  5IYB O;  1XL4 A;  4WFH A;  1YJ9 V;  1BHB A;  4PA7 A;  5DN6 G;  4WCE V;  1YHQ V;  3RW0 A;  3ASO C;  1OCC C;  1PKX A;  5L3G A;  1K97 A;  3CME V;  3SYC A;  2D3O W;  1NH2 B;  2DYR C;  4MT8 A;  1Q82 W;  5CN0 A;  3E86 A;  3K79 A;  3OR6 C;  2EIL B;  4J9Z B;  3CD6 V;  1EFR G;  3HB3 B;  3CCV V;  1VQK V;  3TET A;  4R7C A;  1QVG U;  3ABK C;  5C93 A;  2BOC C;  4WF9 V;  2WLI A;  4FMT A;  1NJI W;  1FXK C;  3I56 V;  1AI7 A;  1VQO V;  1W2B U;  1PNK A;  4UVB A;  1OCR C;  3BY6 A;  5B1B C;  2M7W A;  2Z3Y A;  2Q6A A;  2LFR A;  3B8N A;  5BZB A;  2HVJ C;  3AG4 C;  3X2Q C;  2XAS A;  3JYC A;  1NKD A;  3AG2 C;  4TWK A;  4BIZ A;  2ZXW B;  3E35 A;  1R3K C;  1VQ6 V;  2EIN C;  4Z1M G;  1MG1 A;  3G4S V;  2HLD G;  3T4Z A;  4JF3 A;  1V55 C;  5B1N A;  5J9P C;  3E2E A;  2H94 A;  2ZDI A;  1K5Q A;  2DW4 A;  3P30 A;  4JTA B;  2XAG A;  3ZMZ A;  3K06 A;  1SES A;  3CCS V;  4QE9 A;  1VQ4 V;  1OZ0 A;  4MTO A;  1MAB G;  1E79 G;  3ZMV A;  2QA4 V;  3LUT B;  3F7Y C;  3CCL V;  3K3W A;  4MVZ A;  1QLE C;  2YEV B;  1NH2 D;  2CK3 G;  2XAJ A;  4ZBM A;  1K4C C;  1Y4M A;  1AR1 B;  1M1K W;  3OMN B;  1QR8 A;  3CP1 A;  1K4D C;  3T1C A;  1M9N A;  4JAU A;  5H6R A;  1RPO A;  1K92 A;  2QM7 A;  1I5X A;  5LHG A;  1RM1 C;  2EIJ C;  2UXX A;  1J95 A;  1H8H G;  5GW7 A;  3T2M A;  2PI5 A;  5B3S B;  4JPR A;  2IH3 C;  1HWY A;  2A79 B;  5KUK A;  2IW5 A;  5EBW C;  3ZMU A;  5IY5 C;  1YI2 V;  5CBG A;  1UJW B;  1GM9 A;  1PD3 A;  3R65 A;  2HKO A;  2ZD9 A;  4HYO A;  4JAS A;  2IU3 A;  4MTG A;  1K7D A;  1CP9 A;  1GM7 A;  3WFV A;  1N8R W;  3ABM B;  1M56 C;  1BL8 A;  4BIU A;  1H2G A;  3ABT A;  1OCZ C;  2EIK B;  1V54 C;  3ZJZ A;  4Q20 A;  4R6Z A;  3W7U A;  1SET A;  4RQE A;  1THZ A;  1VQ9 V;  1FXV A;  4XDL A;  1NBM G;  2WLM A;  4MW3 A;  4PEL A;  3I55 V;  2W6I G;  2XAQ A;  5B1O A;  2Q68 A;  1K8A W;  1R3J C;  1AJQ A;  3RBZ A;  3UKM A;  3JD3 A;  1M90 W;  1VQM V;  1B6Q A;  4KFM A;  2A9H A;  2QEX V;  1FXH A;  1NQT A;  4P30 A;  4X88 A;  4PDV A;  4DXW A;  2WLK A;  1SRY A;  3ASN C;  3GWO A;  1FFT B;  5HFM A;  2C2A A;  2EZO A;  4FIP C;  1KD1 W;  4UV8 A;  3OFN G;  4G27 B;  5H6Q A;  5IYD O;  4MW8 A;  1OCC B;  1E1R G;  4MVU A;  1GM8 A;  4H33 A;  2V1D A;  1PNM A;  5LGU A;  3OW2 U;  1ZWI C;  1K5S A;  3IGA C;  5H9C A;  2Y69 B;  4GX2 A;  1JQ0 A;  3FYI B;  3QNE A;  1P4R A;  4QE7 A;  4WFG A;  4QIW F;  4E2L A;  4MVM A;  1JX9 A;  2WPD G;  4FPP A;  1F23 A;  1ORQ C;  4J9Y B;  1F51 A;  2IJJ A;  2OTJ V;  1MOF A;  3ABK B;  2ZR2 A;  3SPJ A;  2DQ3 A;  4QPJ A;  1BMF G;  1FXK B;  3AG1 C;  2WLJ A;  1OCO C;  3BEH A;  3D36 A;  4PDM A;  4LP8 A;  3OR7 C;  5B1A C;  2ZQM A;  4JTD B;  3CCM V;  1R6N A;  4OXS A;  1AJN A;  1VQ5 V;  1W0K G;  2HFE C;  3FB6 C;  3VOU A;  4UUJ C;  5EBM C;  1JOY A;  5IDJ A;  3CPW U;  3DGE A;  2K1E A;  2DWD C;  2R9R B;  2H8P C;  3JCZ A;  1V55 B;  3ZRV A;  1M57 B;  4RUE A;  3OUS A;  5KUM A;  1K73 W;  2EIL C;  1SER A;  4RAI A;  4PDR A;  4KUM A;  5L3C A;  5LHI A;  2ITD C;  2ZR3 A;  2EIM B;  3FYE B;  3B77 A;  2WLH A;  2JEU A;  4MVR A;  1JJ2 U;  3K0G A;  4ASU G;  5L3D A;  3CC7 V;  4PA9 A;  4G28 B;  3SPH A;  2WLI B;  3EFF K;  2PI4 A;  1VQP V;  3AEI A;  3STZ C;  5KA5 A;  3SYP A;  1Q7Y W;  3E8F A;  3ETE A;  4LC1 A;  2YSU B;  3W7W A;  1F4N A;  1S77 D;  3ZRW B;  1R3L C;  2ZXW C;  1ARO P;  1YJN V;  2EZP A;  1NVP B;  1AI6 A;  1K3E A;  3OEE G;  2LFS A;  1KC8 W;  4WFB V;  1L1F A;  3K9A A;  2B1I A;  2EJR A;  4XDK A;  3LSS A;  4N23 A;  4G2K A;  4R8C A;  4UXN A;  4EKW A;  4L87 A;  4YXW G;  2F43 G;  2X7R B;  3SPI A;  1GKF A;  1OHH G;  1IXM A;  4GX1 A;  3OEH G;  2QTO A;  1QCE A;  1K34 A;  2X6A A;  1QVF U;  1VQ8 V;  3OE7 G;  4U7O A;  2DYS C;  2OCC B;  1H38 A;  1ENV A;  3SYO A;  3RVZ A;  3VBB A;  4HZ3 A;  3WG7 B;  2WWW A;  3B8M A;  1JVM A;  4PA6 A;  1V54 B;  3AG3 B;  2LP7 A;  3ABL B;  2BOB C;  2R9I A;  4LBE C;  2Q69 A;  4JGS A;  1AI4 A;  2HG5 C;  3IFX A;  3JD2 A;  5B3S C;  1QLN A;  1TUE B;  1QR9 A;  2P90 A;  3K0D A;  5DM6 V;  1S72 V;  3W7T A;  1R73 A;  3K04 A;  4HAM A;  2IJI A;  4MSW C;  4BW5 A;  1AI5 A;  3K03 A;  4MVS A;  4I9W A;  3D3I A;  2WLL B;  3NXS A;  3ZN1 A;  1H8E G;  4XBF A;  3TK1 A;  2EBO A;  2WSS G;  1EZJ A;  2X0L A;  1NVP D;  2AHY A;  3A0R A;  3P32 A;  4I5S A;  2QM8 A;  4GX5 A;  2B5U A;  3ML0 A;  2Q67 A;  2OTL V;  2EIK C;  2WAM A;  3GB7 C;  4U7N A;  2V7Q G;  3FB5 C;  2XAH A;  4LCU C;  3RVY A;  5FL7 G;  4MTF A;  3ASO B;  3CXC U;  1F4M A;  3K08 A;  1ROP A;  4H37 A;  4FK5 C;  2DYR B;  3H01 A;  5HFL A;  2JJ2 G;  3JD1 A;  3T4D A;  4BAY A;  3CCJ V;  2X6C A;  3OUF A;  4MVO A;  4WFE A;  1EBO A;  3CCE V;  2IJH A;  3ETG A;  2NNU A;  4PDL A;  3W7X A;  3KG2 A;  1OCO B;  3CCQ V;  3ZCC A;  4X8A A;  4DO2 A;  5B1A B;  3QO8 A;  1DF5 A;  2W0F C;  1OCR B;  4MVQ A;  5B1B B;  3QO7 A;  4P9O A;  3SJQ C;  4GT1 A;  1DF4 A;  3AG4 B;  2GSM B;  3X2Q B;  3AG2 B;  1GTO A;  4KP4 A;  3UM7 A;  4QNH B;  1SZT A;  3FKS G;  5L3E A;  2AHZ A;  2Y69 C;  2UXN A;  2EIN B;  5CA3 A;  4GCZ A;  3QO5 A;  3LDD A;  1S5H C;  4CBC A;  1Q86 W;  3DTU B;  4F4L A;  3CMA V;  2HJF C;  3ETD A;  1S76 D;  5EBL C;  4JTC B;  5LGT A;  4MTX A;  5CBF A;  2X6B A;  4JYB A;  2W6J G;  2JIZ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...