3CCV3

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ccv300
1Q814 3CCS3 1NJI4 1VQ73 1YJW3 1QVG2 1K8A4 1VQP3 1YIT3 1VQO3 1QVF2 1W2B2 1S723 1VQ53 1YHQ3 1K9M4 3CCQ3 1KD14 1Q864 1M1K4 1KQS2 3CCU3 1VQN3 3CCR3 1YJN3 3CCM3 2QEX3 1VQL3 1VQ43 3CC43 3G4S3 3CCL3 1Q7Y4 3G713 1VQ83 2OTL3 3CMA3 3CD63 3I553 1VQK3 1VQ63 3CCJ3 3CME3 1VQ93 1VQM3 1Q824 3G6E3 1K734 1M904 2OTJ3 3CC73 3CC23 1KC84 1N8R4 3OW22 3CCE3 2QA43 3CXC2 3CCV3 1YI23 1YJ93 1JJ22 3CPW2 3I563 1YIJ3
chains in the Genus database with same CATH superfamily
2W04A 2CFDA 3UL6A 2P38A 3G16A 3LTAA 3FKAA 3URPA 3OWSA 1W02A 2O9UX 3L0RA 2GBXB 3FG4A 2HMOB 4K1UA 3T0UA 4XM4A 3EN8A 2GU1A 1HYFA 4XBTA 4EV5A 2KXGA 5KP4A 3QK9A 3PGBA 3WA2X 1X1XA 3PCRA 2C4BA 3DH2A 1FYSA 2ML6A 3ECFA 5G1LA 1RGHA 2XGLA 1EQKA 2ZL8A 2CFKA 2F5MA 3BIRA 3IJEB 2KAAA 2KF3A 3BU4A 1RMSA 3SOYA 1KC84 4DKIA 3WA3A 3BNEA 1NWWA 3LTBA 1E97A 3FG1A 3K5TA 5FW5A 1YJ93 1FGTA 5IG4A 2HMMB 1YJW3 1UDII 1JB5A 1LOYA 4R80A 5AIIA 3S29A 3X3YA 3X3XA 3K63A 3FG3A 4N6V0 5AYSC 1DMQA 1MGRA 1PY3A 1W7CA 1AV4A 1Q40B 1KD14 5BIRA 3DGOA 4G1MB 7STDA 1VQ43 1GOVA 2IYJA 5D81A 5EQLA 3PZWA 1RGLA 1GY5A 2F4YA 3K9MC 4RNYA 3A76A 4N3VA 4HBRA 3RGRA 1WNHA 1ZX2A 2W56A 3LH4A 4N6OB 1DVDA 2BU4A 3F8XA 1BRNL 1N5HA 6GSPA 1EA2A 1N8R4 2QA43 1WMOA 1PU4A 3D79A 2CW9A 3MG3A 4R1KA 3AGNA 3K7CA 1JJ22 1DVCA 4HM5B 1YIJ3 1QMAA 3DUKA 5BVBA 2E2UA 3Q3FA 1IVWA 3DY5A 3T8UA 1STFI 3OV4A 1BIRA 4HM6B 1IK3A 3SYUA 4GSPA 1KWIA 1BAOA 1TFOA 2FXTA 2L1SA 3HX8A 1BANA 3FGYA 3NUVA 3CCL3 4WWUC 1N9EA 3GZYB 4WYKB 3V92A 1JKGB 1VQ83 3NBBA 1RKYA 3CD63 1A67A 3WHOA 3B8LA 2F5WA 1JZDA 2IY2A 1OUNA 1BSDA 1UCLA 3B4OA 1OGZA 3H51A 4L7KA 1QAKA 4MJDA 1JBSA 1JBRA 2Z76A 1JNQA 2C10A 2F56A 2F98A 2XEPA 1O7HB 2H0HA 1ROAA 2BHMA 3LXUX 5A0OB 1ZS7A 2OQEA 3MHEA 3NV0A 6STDA 1RN1A 1OHOA 1TU5A 1K8A4 4FR9A 3CNXA 2BMOB 4JRFA 3D5GA 2XSHB 2V1LA 3PCSA 3NQZA 1W6GA 1NNVA 5CF2A 1OH0A 1BSAA 3DXOA 2CG0A 2W03A 3CCU3 1SPUA 4RBNA 1OACA 1JN5B 1GMQA 2CFGA 1RHLA 3DGYA 3LZAA 4LMIA 5CXOA 1C7HA 1W01A 2BMRB 3KFQC 1RGFA 2I9WA 4K61A 1AVLA 3FSDA 4J8TA 1TRQA 3CCJ3 3D3LA 2OOVA 3NX0A 3J7Yd 3CC73 5M1AA 1TTOA 2W0QA 4LYLB 3CCE3 1RGCA 1TJDA 2CIUA 4BTWA 1B27A 1FGRA 1CQSA 3CPW2 1IU7A 2L4VA 4R9KA 3HIIA 2CFLA 1B2UA 2GEYA 1ULIB 1B2SA 1JRQA 1B2ZA 3D9RA 4HJLB 1BNJA 1OHPA 3AMOB 1GY6A 3EQQB 2QIYA 3NHXA 3PXMA 1TRPA 2QEX3 1BRIA 3CC43 1FUTA 3EN1B 1J2BA 3AHWA 4EBGA 1B2MA 3RDEA 3HI7A 2D42A 3BNBA 4STDA 2W6JH 3X3ZA 4N6MA 5M18A 1L5GB 1FZUA 1VQK3 3GRDA 1VQ93 1RNTA 2C11A 1IVXA 1I3FA 1MGWA 3B4PA 1VQM3 1Q824 1BNEA 4WFOA 3SOAA 1RGGA 2HMJB 1GYBA 3OW22 1MWTA 3O8YA 3S5CA 3ROBA 4LSOA 1LRAA 2CK3H 1YI23 1RGEA 1YGWA 3SXXA 5HOHA 3A5EA 1I2FA 3LYGA 1QVF2 1BNFA 1O7PB 4IT7A 3F7XA 5KP1A 1G02A 1JZOA 1UI8A 2Y74A 1DMMA 4NHFA 1Q864 4O8SA 3NXJA 1NDOB 4WHAA 2JQ5A 2YFJB 1AQZA 1ISKA 3ALAA 3NM7A 3D5IA 5FGOA 1RGKA 1OF5B 3X41A 5AEUB 5KP3A 5IW9A 1CYVA 4JF8A 2GXFA 1T2IA 1ASKA 3HZPA 4HOHA 4NPBA 3B7CA 3FLJA 3RGAA 4HM0B 3Q2PA 1UCIA 1YVBI 1DMNA 1BSBA 3UNLA 3RNTA 1Q9EA 2P0XA 5CLKA 1IQ8A 4CCVA 3AGOA 1YVSA 1BGSA 4N6LA 1VQ73 3KKGA 3KZTA 2B24B 3Q90A 4FMCA 5G2GA 1HZ1A 1VZZA 1VQP3 5IEOA 1ZGXA 1IT7A 1EEJA 1FGOA 4WYKA 3N8BA 3T8NA 1OPYA 4HM1B 1VQN3 5LC7A 2B1XB 3GWRA 4CDLA 2CH9A 4K1VA 1RTUA 5STDA 2YX9A 4FMDA 2CKFB 1B20A 1JB2A 1TIJA 4X2OA 2SARA 3FF2A 1GMPA 1LQMB 1W00A 1YGEA 2Z77A 3BNCA 2W9QA 3I563 1RRHA 4GL6A 1FA3A 1I0VA 3V98A 1G96A 3N9HA 2OTL3 3OX9A 5IERA 1IVUA 1Q42A 4PEJA 1WMPA 2CX0A 1S5AA 2K0MA 1QVG2 4KFEA 3FZWA 5AYRB 4GB5A 2BNGA 1BNRA 1IV9A 4MMYB 1SJWA 3WR2A 3MKIA 1E3VA 3JUPA 2XR8B 3LTCA 1AY7A 4O2HA 1MOLA 5AI1A 1RNBA 1IQYA 2OQEC 1B21A 4L8OA 2W56B 3TDGA 2XFSA 2H0IA 1N5PA 1TUHA 2KCDA 1RCKA 4AEQA 2WOHA 3V99A 1W2ZA 3DM8A 1VQ63 3KCHA 4HM2B 1UCJA 4LGQA 1K734 2W9PA 1BUQA 1BRHA 4H61A 5D82A 1W5ZA 1JBTA 1CYUA 4EXRA 1KSIA 1C54A 1FUSA 3UJMA 4EV2A 3FH1A 1OHSA 2ML5A 3MG2A 2BIRA 1BRSA 5DREA 5DRVA 3ZFZA 3BLZA 8CHOA 4BIRA 3G0KA 3N54B 1IDPA 3NBRA 3X40A 4OUQA 3ZG5A 1BU4A 3EE1A 4IIAA 3VGNA 1CEWI 2INXA 2XF3A 1I0XA 3DZLA 3JUMA 1W6CA 2CHCA 4HAAA 1BRJA 2STDA 4N6UA 3SVAA 2CWTA 3HK4A 3LT9A 1QAFA 3G4S3 3S67A 1GY7A 3MG1A 4OVMA 1OF5A 3EB8A 3VF1A 1D6YA 1RJOA 1CH0A 1YNVX 1A2KA 1T2HA 3DGLA 4MMZB 4Q53A 1JKGA 1Q40A 2OTJ3 4LZIA 4LEHA 3VSYA 5D83A 5RNTA 1VQQA 1T5YA 2E2TA 3PS8A 1Z1SA 4CJNA 1MNLA 2Z6BA 9RNTA 5CF1A 1BSEA 4CPKA 5JPPA 1NU3A 4X2HA 3LOYA 5AIHA 2R4IA 4EW5A 3NV0B 2UX0A 2IUKA 2GSPA 1X1YA 2XFTA 2D1WA 2BMQB 1I8VA 1Q7HA 2MF7A 4RNZA 3ZG0A 1IQXA 1X1UA 3KN4A 3AMOA 1M9GA 7RNTA 1DE3A 1MWSA 2BO9B 1AR0A 3MPHA 2LYXA 1YJN3 2OWPA 1QALA 2HMKB 3MYTA 2WOFA 1GD4A 1PYLA 3EBTA 3NM2A 1A90A 3S28A 1K41A 1WTHA 1GOYA 1TP6A 2RCDA 2CX1A 2OCTA 4XB5A 1N8QA 2E2VA 2FNQA 2OOVC 3CXC2 1HKXA 1RSNA 2UUGC 3CCV3 1BSCA 1UUWB 1U5OA 4O3VA 1LXEA 3KIIA 3STDA 1AVKA 3Q1CA 1RN4A 5IG5A 1UUGB 7GSPA 1ZO2A 1RGAA 1YIT3 1EKMA 3GZXB 1JN5A 4HM7B 4HZ9B 4BTYA 1S723 4HM8B 4HYZA 4K90B 1YHQ3 1K9M4 5EEOA 2FGTA 1IYYA 1BVIA 3JVCA 5TGNA 3GAXA 3NBJA 3CCM3 3QRDA 1B2XA 4J5KA 3SEDA 3EBYA 3WOFB 2KRTA 4XDVA 4HM4B 1IV7A 4N6NB 1NO3A 1W4NA 1A2PA 2HMLB 2Q07A 2PNCA 1B3SA 1EG9B 3ER7A 3H3HA 4HM3B 4ORLA 4R9LA 3E99A 5JPUA 1BRKA 2P05A 4NREA 5ELUA 5IG3A 4FCJA 3SX1A 1GMRA 2GBWB 4BU4A 1ULJB 1BNIA 1I3IA 2JDIH 3HOHA 1US1A 1UW1A 1Q814 1RCLA 2YFIB 2CC3A 1NB3I 3I0YA 2KF5A 1G0TA 1F8NA 1BNSA 3KE7A 1UGHI 1IT8A 1LVNA 1FUWA 4KFDA 3LT8A 1W2B2 1BRGA 4KZ1A 5ELJA 3CU3A 4HZBB 1V58A 3CCR3 3FCSB 3OWYA 4KVHA 4U13A 2GU3A 5IG0A 1Q7Y4 3FF0A 1V74A 2Z7AA 3JUOA 3MWZA 1W6YA 4FMBA 1LNHA 3CME3 5HGRA 2RGQA 3LMLA 3F8HA 3DMCA 1M904 2AAEA 3F7SA 1A2VA 4XDWA 2SBLA 4I5QA 4MEIA 1O7MB 1UUVB 1STDA 3SLUA 5I97A 2P09A 2CWVA 2AADA 3K0ZA 3WOEB 1BUJA 2ZHXB 1O7GB 2M7OA 1JV2B 1VQO3 5IENA 5BU4A 4I4KA 1D6UA 2MC8A 2PZVA 2XSOB 1M1K4 1X1WA 2CWUA 2XH9A 4KFFA 1LOXA 5CK6A 1SIHA 2H0GA 4J5GA 3KSED 3I553 1SIIA 1FW7A 1GD3A 1MWRA 3WMDA 3UL5A 5BXQA 4FCMA 4AKYA 1MWUA 1D6ZA 2RNTA 3CC23 1DYUA 2CFWA 2KF4A 3F40A 3HIGA 2KF6A 2ZDJA 3CCS3 1NJI4 2P0MA 3U1WA 4EYCA 4BL2A 3IPTA 3LTDA 2RFRA 1RN7A 1UCKA 4HVNA 1UGIA 4RZMA 4TX4A 3EC9A 3G8ZA 5JBSA 2XRXB 4WP5A 3OXAA 5AIFA 4RNTA 4FCZA 1UI7A 4J9AA 1RRLA 4GHOA 1VQL3 1SQWA 1R4CA 3G713 1I2GA 2IA7A 1BOXA 3KSPA 3JUQA 1FGQA 1E3RA 2WGOA 3G6E3 3GZBA 4XBYA 5M19A 1RLSA 3X42A 3EJVA 3GSPA 1QJGA 3WODG 2R41A 3DGMA 3OWUA 1OGXA 1T3BA 4O02B 1WMNA 1I70A 2A15A 4QWTA 3CPOA 4BL3A 1LOVA 6RNTA 1IVVA 4H3UA 1VQ53 1O7WB 3DGNA 2HMNB 3CNMA 5IEPA 1RDSA 1FGMA 3CCQ3 4AKZA 1KQS2 1PFPA 4FMAA 3F14A 4R4KA 2QGUA 3S27A 2K3DA 2IMJA 2WGQA 2YFLB 1NB5I 3PYJA 3AHSA 4MMXB 3WDGB 4EC6A 2W2CA 1O7NB 1BNGA 8RNTA 4OK0A 2RSXA 3BB9A 3M8CA 2CG1A 3JUNA 5GSPA 1LOWA 4IPBA 3EF8A 3CMA3 2WO0A 3BNDA 1OCVA 4BTXA 1U8CB 4L8PA 1JB4A 2RBIA 1LNIA 2J8XB 5AEWB 2ZA4A 2BT3A 1ROVA 3D4AA 3NQYA 1N9JA 1Y4KA 1GSPA 5LC6A 1GS3A 1TFKA 2LQVA 1DETA 1R4YA 5G1KA 2O3OA 3EHCA 1I2EA 2K54A 1WQLB 3EX9A 3GZRA 4XBXA 5AIGA 4ZM8A 3UB1A 1LQGC 3F9SA 1K28A 4HKVB 5IF6A 2F86B 4KT3B 3U97A 3MSOA 1M1XB 2GEXA 3IMAB 4ILFA 2UGIA 1HU9A 1EUIC 2HOHA 2F99A 1GOUA 2XGNA 2IUJA 1V57A 4N6TA 1SARA 5EVHA 2Y73A
chains in the Genus database with same CATH topology
2W04A 2CFDA 3UL6A 2P38A 3G16A 3LTAA 3FKAA 3OWSA 1W02A 2O9UX 3L0RA 2GBXB 3FG4A 2HMOB 4K1UA 3T0UA 4XM4A 3EN8A 2GU1A 4XBTA 4EV5A 2KXGA 3QK9A 3PGBA 3WA2X 3PCRA 3ECFA 2ML6A 2XGLA 1EQKA 2ZL8A 2CFKA 3IJEB 3SOYA 1KC84 3WA3A 3BNEA 1NWWA 3LTBA 1E97A 3FG1A 3K5TA 5FW5A 1YJ93 1FGTA 5IG4A 2HMMB 1YJW3 1JB5A 4R80A 5AIIA 3S29A 3X3YA 3X3XA 3K63A 3FG3A 4N6V0 5AYSC 1DMQA 1W7CA 1AV4A 1Q40B 1KD14 3DGOA 4G1MB 7STDA 1VQ43 5D81A 5EQLA 3PZWA 1GY5A 3K9MC 4RNYA 3A76A 4N3VA 4HBRA 3RGRA 1WNHA 1ZX2A 2W56A 3LH4A 4N6OB 1DVDA 3F8XA 1N5HA 1EA2A 1N8R4 2QA43 1WMOA 1PU4A 2CW9A 3MG3A 4R1KA 1JJ22 3K7CA 1DVCA 4HM5B 1YIJ3 1QMAA 3DUKA 5BVBA 2E2UA 1IVWA 3DY5A 3T8UA 1STFI 3OV4A 4HM6B 1IK3A 1KWIA 1TFOA 2FXTA 3HX8A 3FGYA 3NUVA 3CCL3 4WWUC 1N9EA 3GZYB 4WYKB 3V92A 1JKGB 1VQ83 3NBBA 1RKYA 3CD63 1A67A 3B8LA 1OUNA 3B4OA 4L7KA 1OGZA 3H51A 4MJDA 1QAKA 2Z76A 1JNQA 2C10A 2F98A 2XEPA 1O7HB 5A0OB 1ROAA 2BHMA 3LXUX 6STDA 2OQEA 5KP4A 3MHEA 3NV0A 1TU5A 1OHOA 1K8A4 4FR9A 3CNXA 2BMOB 4JRFA 2XSHB 2V1LA 3PCSA 3NQZA 1W6GA 5CF2A 1OH0A 3DXOA 2CG0A 2W03A 3CCU3 1SPUA 4RBNA 1OACA 1JN5B 4LMIA 2CFGA 3LZAA 5CXOA 1C7HA 1W01A 2BMRB 3KFQC 4K61A 2I9WA 1AVLA 3FSDA 4J8TA 3CCJ3 3D3LA 2OOVA 3NX0A 3J7Yd 3CC73 2W0QA 3CCE3 4BTWA 2CIUA 1FGRA 1CQSA 3CPW2 1IU7A 2L4VA 4R9KA 3HIIA 2CFLA 2GEYA 1ULIB 1JRQA 3D9RA 4HJLB 1OHPA 3AMOB 1GY6A 3EQQB 2QIYA 3NHXA 3PXMA 2QEX3 3CC43 1J2BA 3EN1B 4EBGA 3RDEA 3HI7A 2D42A 3BNBA 4STDA 2W6JH 3X3ZA 4N6MA 1L5GB 1VQK3 3GRDA 1VQ93 2C11A 1VQM3 1IVXA 3B4PA 1Q824 4WFOA 3SOAA 2HMJB 1GYBA 3OW22 3O8YA 3S5CA 3ROBA 4LSOA 2CK3H 1YI23 3SXXA 3LYGA 1QVF2 1O7PB 4IT7A 3F7XA 5KP1A 1UI8A 2Y74A 1DMMA 4NHFA 1Q864 4O8SA 3NXJA 1NDOB 4WHAA 2JQ5A 2YFJB 1ISKA 3ALAA 3NM7A 5FGOA 1OF5B 3X41A 5AEUB 5KP3A 5IW9A 1CYVA 4JF8A 2GXFA 1ASKA 3HZPA 3B7CA 3FLJA 3RGAA 4HM0B 3Q2PA 1YVBI 1DMNA 3UNLA 2P0XA 4CCVA 5CLKA 1IQ8A 1VQ73 4N6LA 3KKGA 3KZTA 2B24B 3Q90A 4FMCA 5G2GA 1VZZA 1VQP3 5IEOA 1IT7A 1FGOA 4WYKA 3N8BA 3T8NA 1OPYA 4HM1B 1VQN3 5LC7A 2B1XB 3GWRA 4CDLA 2CH9A 4K1VA 5STDA 2YX9A 4FMDA 2CKFB 1JB2A 1TIJA 4X2OA 3FF2A 1W00A 1YGEA 2Z77A 3BNCA 2W9QA 3I563 1RRHA 4GL6A 1FA3A 3V98A 1G96A 3N9HA 2OTL3 3OX9A 5IERA 1IVUA 1Q42A 4PEJA 1WMPA 1S5AA 1QVG2 2K0MA 4KFEA 3FZWA 5AYRB 4GB5A 2BNGA 1IV9A 4MMYB 1SJWA 3MKIA 1E3VA 3JUPA 2XR8B 3LTCA 4O2HA 1MOLA 5AI1A 1IQYA 2OQEC 4L8OA 2W56B 3TDGA 2XFSA 1N5PA 1TUHA 2KCDA 4AEQA 2WOHA 3V99A 1W2ZA 3DM8A 1VQ63 4HM2B 4LGQA 1K734 2W9PA 1BUQA 4H61A 5D82A 1W5ZA 1CYUA 4EXRA 1KSIA 4EV2A 3UJMA 3FH1A 1OHSA 2ML5A 3MG2A 5DREA 8CHOA 5DRVA 3BLZA 3G0KA 3N54B 1IDPA 3NBRA 3X40A 4OUQA 3EE1A 4IIAA 3VGNA 1CEWI 2INXA 2XF3A 3DZLA 3JUMA 1W6CA 2CHCA 2STDA 4N6UA 3SVAA 2CWTA 3HK4A 3LT9A 1QAFA 3G4S3 3S67A 1GY7A 3MG1A 4OVMA 1OF5A 3EB8A 3VF1A 1D6YA 1RJOA 4Q53A 1A2KA 3DGLA 4MMZB 1JKGA 1Q40A 2OTJ3 4LZIA 4LEHA 3VSYA 5D83A 1T5YA 2E2TA 3PS8A 1Z1SA 1MNLA 2Z6BA 5CF1A 5JPPA 1NU3A 4X2HA 3LOYA 5AIHA 2R4IA 3NV0B 2UX0A 2IUKA 2XFTA 2D1WA 2BMQB 2MF7A 4RNZA 1IQXA 3KN4A 3AMOA 1M9GA 2BO9B 1AR0A 3MPHA 2LYXA 1YJN3 2OWPA 1QALA 2HMKB 3MYTA 2WOFA 1GD4A 3NM2A 3EBTA 1A90A 3S28A 1K41A 1WTHA 1TP6A 2RCDA 2OCTA 4XB5A 1N8QA 2E2VA 2FNQA 2OOVC 3CXC2 1HKXA 3CCV3 1UUWB 1U5OA 4O3VA 1LXEA 3KIIA 3STDA 1AVKA 3Q1CA 5IG5A 1ZO2A 1YIT3 1EKMA 3GZXB 1JN5A 4HM7B 4HZ9B 4BTYA 1S723 4HM8B 4HYZA 4K90B 1YHQ3 1K9M4 5EEOA 2FGTA 3JVCA 5TGNA 3GAXA 3NBJA 3CCM3 3QRDA 3SEDA 3EBYA 3WOFB 2KRTA 4XDVA 4HM4B 1IV7A 4N6NB 1NO3A 1W4NA 3ER7A 2HMLB 2Q07A 2PNCA 3H3HA 1EG9B 3PYJA 4HM3B 4ORLA 4R9LA 5JPUA 3E99A 5ELUA 2P05A 4NREA 5IG3A 4FCJA 3SX1A 2GBWB 1ULJB 2JDIH 1US1A 1UW1A 1Q814 2YFIB 1NB3I 2CC3A 3I0YA 3KE7A 1F8NA 1IT8A 1LVNA 1FUWA 4KFDA 3LT8A 1W2B2 4KZ1A 5ELJA 3CU3A 4HZBB 3CCR3 3FCSB 3OWYA 4KVHA 4U13A 2GU3A 5IG0A 1Q7Y4 3FF0A 1V74A 2Z7AA 3JUOA 3MWZA 1W6YA 4FMBA 1LNHA 3CME3 5HGRA 2RGQA 3LMLA 3F8HA 3DMCA 1M904 3F7SA 1A2VA 4XDWA 2SBLA 4MEIA 1O7MB 1UUVB 1STDA 3SLUA 5I97A 2P09A 2CWVA 3K0ZA 3WOEB 1O7GB 2M7OA 1JV2B 1VQO3 5IENA 4I4KA 1D6UA 2MC8A 2PZVA 2XSOB 1M1K4 2CWUA 2XH9A 4KFFA 1LOXA 5CK6A 1SIHA 3KSED 3I553 1SIIA 1GD3A 3WMDA 3UL5A 5BXQA 4FCMA 4AKYA 1D6ZA 3CC23 1DYUA 2CFWA 3F40A 3HIGA 2ZDJA 3CCS3 1NJI4 2P0MA 3U1WA 4EYCA 3IPTA 3LTDA 2RFRA 1RN7A 4HVNA 4RZMA 4TX4A 3EC9A 3G8ZA 5JBSA 2XRXB 4WP5A 3OXAA 5AIFA 4FCZA 1UI7A 4J9AA 1RRLA 1VQL3 1SQWA 1R4CA 3G713 2IA7A 3KSPA 3JUQA 1FGQA 1E3RA 2WGOA 3G6E3 3GZBA 4XBYA 3X42A 3EJVA 1QJGA 3WODG 3DGMA 3OWUA 1OGXA 4O02B 1WMNA 2A15A 4QWTA 3CPOA 1IVVA 4H3UA 1VQ53 1O7WB 3DGNA 2HMNB 3CNMA 5IEPA 1FGMA 3CCQ3 4AKZA 1KQS2 1PFPA 4FMAA 3F14A 4R4KA 2QGUA 3S27A 2IMJA 2WGQA 2YFLB 1NB5I 4MMXB 3WDGB 4EC6A 2W2CA 1O7NB 4OK0A 2RSXA 3BB9A 3M8CA 2CG1A 3JUNA 4IPBA 3EF8A 3CMA3 2WO0A 3BNDA 1OCVA 4BTXA 1U8CB 4L8PA 1JB4A 5AEWB 2BT3A 1ROVA 3NQYA 1N9JA 1Y4KA 5LC6A 1GS3A 1TFKA 2LQVA 2O3OA 3EHCA 3EX9A 2K54A 1WQLB 4XBXA 3GZRA 5AIGA 4ZM8A 3UB1A 3F9SA 1K28A 4HKVB 5IF6A 2F86B 3U97A 3MSOA 1M1XB 2GEXA 3IMAB 1HU9A 2F99A 2XGNA 2IUJA 4N6TA 5EVHA 2Y73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q81 4;  3CCS 3;  1NJI 4;  1VQ7 3;  1YJW 3;  1QVG 2;  1K8A 4;  1VQP 3;  1YIT 3;  1VQO 3;  1QVF 2;  1W2B 2;  1S72 3;  1VQ5 3;  1YHQ 3;  1K9M 4;  3CCQ 3;  1KD1 4;  1Q86 4;  1M1K 4;  1KQS 2;  3CCU 3;  1VQN 3;  3CCR 3;  1YJN 3;  3CCM 3;  2QEX 3;  1VQL 3;  1VQ4 3;  3CC4 3;  3G4S 3;  3CCL 3;  1Q7Y 4;  3G71 3;  1VQ8 3;  2OTL 3;  3CMA 3;  3CD6 3;  3I55 3;  1VQK 3;  1VQ6 3;  3CCJ 3;  3CME 3;  1VQ9 3;  1VQM 3;  1Q82 4;  3G6E 3;  1K73 4;  1M90 4;  2OTJ 3;  3CC7 3;  3CC2 3;  1KC8 4;  1N8R 4;  3OW2 2;  3CCE 3;  2QA4 3;  3CXC 2;  3CCV 3;  1YI2 3;  1YJ9 3;  1JJ2 2;  3CPW 2;  3I56 3;  1YIJ 3; 
#chains in the Genus database with same CATH topology
 2W04 A;  2CFD A;  3UL6 A;  2P38 A;  3G16 A;  3LTA A;  3FKA A;  3URP A;  3OWS A;  1W02 A;  2O9U X;  3L0R A;  2GBX B;  3FG4 A;  2HMO B;  4K1U A;  3T0U A;  4XM4 A;  3EN8 A;  2GU1 A;  1HYF A;  4XBT A;  4EV5 A;  2KXG A;  5KP4 A;  3QK9 A;  3PGB A;  3WA2 X;  1X1X A;  3PCR A;  2C4B A;  3DH2 A;  1FYS A;  2ML6 A;  3ECF A;  5G1L A;  1RGH A;  2XGL A;  1EQK A;  2ZL8 A;  2CFK A;  2F5M A;  3BIR A;  3IJE B;  2KAA A;  2KF3 A;  3BU4 A;  1RMS A;  3SOY A;  1KC8 4;  4DKI A;  3WA3 A;  3BNE A;  1NWW A;  3LTB A;  1E97 A;  3FG1 A;  3K5T A;  5FW5 A;  1YJ9 3;  1FGT A;  5IG4 A;  2HMM B;  1YJW 3;  1UDI I;  1JB5 A;  1LOY A;  4R80 A;  5AII A;  3S29 A;  3X3Y A;  3X3X A;  3K63 A;  3FG3 A;  4N6V 0;  5AYS C;  1DMQ A;  1MGR A;  1PY3 A;  1W7C A;  1AV4 A;  1Q40 B;  1KD1 4;  5BIR A;  3DGO A;  4G1M B;  7STD A;  1VQ4 3;  1GOV A;  2IYJ A;  5D81 A;  5EQL A;  3PZW A;  1RGL A;  1GY5 A;  2F4Y A;  3K9M C;  4RNY A;  3A76 A;  4N3V A;  4HBR A;  3RGR A;  1WNH A;  1ZX2 A;  2W56 A;  3LH4 A;  4N6O B;  1DVD A;  2BU4 A;  3F8X A;  1BRN L;  1N5H A;  6GSP A;  1EA2 A;  1N8R 4;  2QA4 3;  1WMO A;  1PU4 A;  3D79 A;  2CW9 A;  3MG3 A;  4R1K A;  3AGN A;  3K7C A;  1JJ2 2;  1DVC A;  4HM5 B;  1YIJ 3;  1QMA A;  3DUK A;  5BVB A;  2E2U A;  3Q3F A;  1IVW A;  3DY5 A;  3T8U A;  1STF I;  3OV4 A;  1BIR A;  4HM6 B;  1IK3 A;  3SYU A;  4GSP A;  1KWI A;  1BAO A;  1TFO A;  2FXT A;  2L1S A;  3HX8 A;  1BAN A;  3FGY A;  3NUV A;  3CCL 3;  4WWU C;  1N9E A;  3GZY B;  4WYK B;  3V92 A;  1JKG B;  1VQ8 3;  3NBB A;  1RKY A;  3CD6 3;  1A67 A;  3WHO A;  3B8L A;  2F5W A;  1JZD A;  2IY2 A;  1OUN A;  1BSD A;  1UCL A;  3B4O A;  1OGZ A;  3H51 A;  4L7K A;  1QAK A;  4MJD A;  1JBS A;  1JBR A;  2Z76 A;  1JNQ A;  2C10 A;  2F56 A;  2F98 A;  2XEP A;  1O7H B;  2H0H A;  1ROA A;  2BHM A;  3LXU X;  5A0O B;  1ZS7 A;  2OQE A;  3MHE A;  3NV0 A;  6STD A;  1RN1 A;  1OHO A;  1TU5 A;  1K8A 4;  4FR9 A;  3CNX A;  2BMO B;  4JRF A;  3D5G A;  2XSH B;  2V1L A;  3PCS A;  3NQZ A;  1W6G A;  1NNV A;  5CF2 A;  1OH0 A;  1BSA A;  3DXO A;  2CG0 A;  2W03 A;  3CCU 3;  1SPU A;  4RBN A;  1OAC A;  1JN5 B;  1GMQ A;  2CFG A;  1RHL A;  3DGY A;  3LZA A;  4LMI A;  5CXO A;  1C7H A;  1W01 A;  2BMR B;  3KFQ C;  1RGF A;  2I9W A;  4K61 A;  1AVL A;  3FSD A;  4J8T A;  1TRQ A;  3CCJ 3;  3D3L A;  2OOV A;  3NX0 A;  3J7Y d;  3CC7 3;  5M1A A;  1TTO A;  2W0Q A;  4LYL B;  3CCE 3;  1RGC A;  1TJD A;  2CIU A;  4BTW A;  1B27 A;  1FGR A;  1CQS A;  3CPW 2;  1IU7 A;  2L4V A;  4R9K A;  3HII A;  2CFL A;  1B2U A;  2GEY A;  1ULI B;  1B2S A;  1JRQ A;  1B2Z A;  3D9R A;  4HJL B;  1BNJ A;  1OHP A;  3AMO B;  1GY6 A;  3EQQ B;  2QIY A;  3NHX A;  3PXM A;  1TRP A;  2QEX 3;  1BRI A;  3CC4 3;  1FUT A;  3EN1 B;  1J2B A;  3AHW A;  4EBG A;  1B2M A;  3RDE A;  3HI7 A;  2D42 A;  3BNB A;  4STD A;  2W6J H;  3X3Z A;  4N6M A;  5M18 A;  1L5G B;  1FZU A;  1VQK 3;  3GRD A;  1VQ9 3;  1RNT A;  2C11 A;  1IVX A;  1I3F A;  1MGW A;  3B4P A;  1VQM 3;  1Q82 4;  1BNE A;  4WFO A;  3SOA A;  1RGG A;  2HMJ B;  1GYB A;  3OW2 2;  1MWT A;  3O8Y A;  3S5C A;  3ROB A;  4LSO A;  1LRA A;  2CK3 H;  1YI2 3;  1RGE A;  1YGW A;  3SXX A;  5HOH A;  3A5E A;  1I2F A;  3LYG A;  1QVF 2;  1BNF A;  1O7P B;  4IT7 A;  3F7X A;  5KP1 A;  1G02 A;  1JZO A;  1UI8 A;  2Y74 A;  1DMM A;  4NHF A;  1Q86 4;  4O8S A;  3NXJ A;  1NDO B;  4WHA A;  2JQ5 A;  2YFJ B;  1AQZ A;  1ISK A;  3ALA A;  3NM7 A;  3D5I A;  5FGO A;  1RGK A;  1OF5 B;  3X41 A;  5AEU B;  5KP3 A;  5IW9 A;  1CYV A;  4JF8 A;  2GXF A;  1T2I A;  1ASK A;  3HZP A;  4HOH A;  4NPB A;  3B7C A;  3FLJ A;  3RGA A;  4HM0 B;  3Q2P A;  1UCI A;  1YVB I;  1DMN A;  1BSB A;  3UNL A;  3RNT A;  1Q9E A;  2P0X A;  5CLK A;  1IQ8 A;  4CCV A;  3AGO A;  1YVS A;  1BGS A;  4N6L A;  1VQ7 3;  3KKG A;  3KZT A;  2B24 B;  3Q90 A;  4FMC A;  5G2G A;  1HZ1 A;  1VZZ A;  1VQP 3;  5IEO A;  1ZGX A;  1IT7 A;  1EEJ A;  1FGO A;  4WYK A;  3N8B A;  3T8N A;  1OPY A;  4HM1 B;  1VQN 3;  5LC7 A;  2B1X B;  3GWR A;  4CDL A;  2CH9 A;  4K1V A;  1RTU A;  5STD A;  2YX9 A;  4FMD A;  2CKF B;  1B20 A;  1JB2 A;  1TIJ A;  4X2O A;  2SAR A;  3FF2 A;  1GMP A;  1LQM B;  1W00 A;  1YGE A;  2Z77 A;  3BNC A;  2W9Q A;  3I56 3;  1RRH A;  4GL6 A;  1FA3 A;  1I0V A;  3V98 A;  1G96 A;  3N9H A;  2OTL 3;  3OX9 A;  5IER A;  1IVU A;  1Q42 A;  4PEJ A;  1WMP A;  2CX0 A;  1S5A A;  2K0M A;  1QVG 2;  4KFE A;  3FZW A;  5AYR B;  4GB5 A;  2BNG A;  1BNR A;  1IV9 A;  4MMY B;  1SJW A;  3WR2 A;  3MKI A;  1E3V A;  3JUP A;  2XR8 B;  3LTC A;  1AY7 A;  4O2H A;  1MOL A;  5AI1 A;  1RNB A;  1IQY A;  2OQE C;  1B21 A;  4L8O A;  2W56 B;  3TDG A;  2XFS A;  2H0I A;  1N5P A;  1TUH A;  2KCD A;  1RCK A;  4AEQ A;  2WOH A;  3V99 A;  1W2Z A;  3DM8 A;  1VQ6 3;  3KCH A;  4HM2 B;  1UCJ A;  4LGQ A;  1K73 4;  2W9P A;  1BUQ A;  1BRH A;  4H61 A;  5D82 A;  1W5Z A;  1JBT A;  1CYU A;  4EXR A;  1KSI A;  1C54 A;  1FUS A;  3UJM A;  4EV2 A;  3FH1 A;  1OHS A;  2ML5 A;  3MG2 A;  2BIR A;  1BRS A;  5DRE A;  5DRV A;  3ZFZ A;  3BLZ A;  8CHO A;  4BIR A;  3G0K A;  3N54 B;  1IDP A;  3NBR A;  3X40 A;  4OUQ A;  3ZG5 A;  1BU4 A;  3EE1 A;  4IIA A;  3VGN A;  1CEW I;  2INX A;  2XF3 A;  1I0X A;  3DZL A;  3JUM A;  1W6C A;  2CHC A;  4HAA A;  1BRJ A;  2STD A;  4N6U A;  3SVA A;  2CWT A;  3HK4 A;  3LT9 A;  1QAF A;  3G4S 3;  3S67 A;  1GY7 A;  3MG1 A;  4OVM A;  1OF5 A;  3EB8 A;  3VF1 A;  1D6Y A;  1RJO A;  1CH0 A;  1YNV X;  1A2K A;  1T2H A;  3DGL A;  4MMZ B;  4Q53 A;  1JKG A;  1Q40 A;  2OTJ 3;  4LZI A;  4LEH A;  3VSY A;  5D83 A;  5RNT A;  1VQQ A;  1T5Y A;  2E2T A;  3PS8 A;  1Z1S A;  4CJN A;  1MNL A;  2Z6B A;  9RNT A;  5CF1 A;  1BSE A;  4CPK A;  5JPP A;  1NU3 A;  4X2H A;  3LOY A;  5AIH A;  2R4I A;  4EW5 A;  3NV0 B;  2UX0 A;  2IUK A;  2GSP A;  1X1Y A;  2XFT A;  2D1W A;  2BMQ B;  1I8V A;  1Q7H A;  2MF7 A;  4RNZ A;  3ZG0 A;  1IQX A;  1X1U A;  3KN4 A;  3AMO A;  1M9G A;  7RNT A;  1DE3 A;  1MWS A;  2BO9 B;  1AR0 A;  3MPH A;  2LYX A;  1YJN 3;  2OWP A;  1QAL A;  2HMK B;  3MYT A;  2WOF A;  1GD4 A;  1PYL A;  3EBT A;  3NM2 A;  1A90 A;  3S28 A;  1K41 A;  1WTH A;  1GOY A;  1TP6 A;  2RCD A;  2CX1 A;  2OCT A;  4XB5 A;  1N8Q A;  2E2V A;  2FNQ A;  2OOV C;  3CXC 2;  1HKX A;  1RSN A;  2UUG C;  3CCV 3;  1BSC A;  1UUW B;  1U5O A;  4O3V A;  1LXE A;  3KII A;  3STD A;  1AVK A;  3Q1C A;  1RN4 A;  5IG5 A;  1UUG B;  7GSP A;  1ZO2 A;  1RGA A;  1YIT 3;  1EKM A;  3GZX B;  1JN5 A;  4HM7 B;  4HZ9 B;  4BTY A;  1S72 3;  4HM8 B;  4HYZ A;  4K90 B;  1YHQ 3;  1K9M 4;  5EEO A;  2FGT A;  1IYY A;  1BVI A;  3JVC A;  5TGN A;  3GAX A;  3NBJ A;  3CCM 3;  3QRD A;  1B2X A;  4J5K A;  3SED A;  3EBY A;  3WOF B;  2KRT A;  4XDV A;  4HM4 B;  1IV7 A;  4N6N B;  1NO3 A;  1W4N A;  1A2P A;  2HML B;  2Q07 A;  2PNC A;  1B3S A;  1EG9 B;  3ER7 A;  3H3H A;  4HM3 B;  4ORL A;  4R9L A;  3E99 A;  5JPU A;  1BRK A;  2P05 A;  4NRE A;  5ELU A;  5IG3 A;  4FCJ A;  3SX1 A;  1GMR A;  2GBW B;  4BU4 A;  1ULJ B;  1BNI A;  1I3I A;  2JDI H;  3HOH A;  1US1 A;  1UW1 A;  1Q81 4;  1RCL A;  2YFI B;  2CC3 A;  1NB3 I;  3I0Y A;  2KF5 A;  1G0T A;  1F8N A;  1BNS A;  3KE7 A;  1UGH I;  1IT8 A;  1LVN A;  1FUW A;  4KFD A;  3LT8 A;  1W2B 2;  1BRG A;  4KZ1 A;  5ELJ A;  3CU3 A;  4HZB B;  1V58 A;  3CCR 3;  3FCS B;  3OWY A;  4KVH A;  4U13 A;  2GU3 A;  5IG0 A;  1Q7Y 4;  3FF0 A;  1V74 A;  2Z7A A;  3JUO A;  3MWZ A;  1W6Y A;  4FMB A;  1LNH A;  3CME 3;  5HGR A;  2RGQ A;  3LML A;  3F8H A;  3DMC A;  1M90 4;  2AAE A;  3F7S A;  1A2V A;  4XDW A;  2SBL A;  4I5Q A;  4MEI A;  1O7M B;  1UUV B;  1STD A;  3SLU A;  5I97 A;  2P09 A;  2CWV A;  2AAD A;  3K0Z A;  3WOE B;  1BUJ A;  2ZHX B;  1O7G B;  2M7O A;  1JV2 B;  1VQO 3;  5IEN A;  5BU4 A;  4I4K A;  1D6U A;  2MC8 A;  2PZV A;  2XSO B;  1M1K 4;  1X1W A;  2CWU A;  2XH9 A;  4KFF A;  1LOX A;  5CK6 A;  1SIH A;  2H0G A;  4J5G A;  3KSE D;  3I55 3;  1SII A;  1FW7 A;  1GD3 A;  1MWR A;  3WMD A;  3UL5 A;  5BXQ A;  4FCM A;  4AKY A;  1MWU A;  1D6Z A;  2RNT A;  3CC2 3;  1DYU A;  2CFW A;  2KF4 A;  3F40 A;  3HIG A;  2KF6 A;  2ZDJ A;  3CCS 3;  1NJI 4;  2P0M A;  3U1W A;  4EYC A;  4BL2 A;  3IPT A;  3LTD A;  2RFR A;  1RN7 A;  1UCK A;  4HVN A;  1UGI A;  4RZM A;  4TX4 A;  3EC9 A;  3G8Z A;  5JBS A;  2XRX B;  4WP5 A;  3OXA A;  5AIF A;  4RNT A;  4FCZ A;  1UI7 A;  4J9A A;  1RRL A;  4GHO A;  1VQL 3;  1SQW A;  1R4C A;  3G71 3;  1I2G A;  2IA7 A;  1BOX A;  3KSP A;  3JUQ A;  1FGQ A;  1E3R A;  2WGO A;  3G6E 3;  3GZB A;  4XBY A;  5M19 A;  1RLS A;  3X42 A;  3EJV A;  3GSP A;  1QJG A;  3WOD G;  2R41 A;  3DGM A;  3OWU A;  1OGX A;  1T3B A;  4O02 B;  1WMN A;  1I70 A;  2A15 A;  4QWT A;  3CPO A;  4BL3 A;  1LOV A;  6RNT A;  1IVV A;  4H3U A;  1VQ5 3;  1O7W B;  3DGN A;  2HMN B;  3CNM A;  5IEP A;  1RDS A;  1FGM A;  3CCQ 3;  4AKZ A;  1KQS 2;  1PFP A;  4FMA A;  3F14 A;  4R4K A;  2QGU A;  3S27 A;  2K3D A;  2IMJ A;  2WGQ A;  2YFL B;  1NB5 I;  3PYJ A;  3AHS A;  4MMX B;  3WDG B;  4EC6 A;  2W2C A;  1O7N B;  1BNG A;  8RNT A;  4OK0 A;  2RSX A;  3BB9 A;  3M8C A;  2CG1 A;  3JUN A;  5GSP A;  1LOW A;  4IPB A;  3EF8 A;  3CMA 3;  2WO0 A;  3BND A;  1OCV A;  4BTX A;  1U8C B;  4L8P A;  1JB4 A;  2RBI A;  1LNI A;  2J8X B;  5AEW B;  2ZA4 A;  2BT3 A;  1ROV A;  3D4A A;  3NQY A;  1N9J A;  1Y4K A;  1GSP A;  5LC6 A;  1GS3 A;  1TFK A;  2LQV A;  1DET A;  1R4Y A;  5G1K A;  2O3O A;  3EHC A;  1I2E A;  2K54 A;  1WQL B;  3EX9 A;  3GZR A;  4XBX A;  5AIG A;  4ZM8 A;  3UB1 A;  1LQG C;  3F9S A;  1K28 A;  4HKV B;  5IF6 A;  2F86 B;  4KT3 B;  3U97 A;  3MSO A;  1M1X B;  2GEX A;  3IMA B;  4ILF A;  2UGI A;  1HU9 A;  1EUI C;  2HOH A;  2F99 A;  1GOU A;  2XGN A;  2IUJ A;  1V57 A;  4N6T A;  1SAR A;  5EVH A;  2Y73 A; 
#chains in the Genus database with same CATH homology
 2W04 A;  2CFD A;  3UL6 A;  2P38 A;  3G16 A;  3LTA A;  3FKA A;  3OWS A;  1W02 A;  2O9U X;  3L0R A;  2GBX B;  3FG4 A;  2HMO B;  4K1U A;  3T0U A;  4XM4 A;  3EN8 A;  2GU1 A;  4XBT A;  4EV5 A;  2KXG A;  3QK9 A;  3PGB A;  3WA2 X;  3PCR A;  3ECF A;  2ML6 A;  2XGL A;  1EQK A;  2ZL8 A;  2CFK A;  3IJE B;  3SOY A;  1KC8 4;  3WA3 A;  3BNE A;  1NWW A;  3LTB A;  1E97 A;  3FG1 A;  3K5T A;  5FW5 A;  1YJ9 3;  1FGT A;  5IG4 A;  2HMM B;  1YJW 3;  1JB5 A;  4R80 A;  5AII A;  3S29 A;  3X3Y A;  3X3X A;  3K63 A;  3FG3 A;  4N6V 0;  5AYS C;  1DMQ A;  1W7C A;  1AV4 A;  1Q40 B;  1KD1 4;  3DGO A;  4G1M B;  7STD A;  1VQ4 3;  5D81 A;  5EQL A;  3PZW A;  1GY5 A;  3K9M C;  4RNY A;  3A76 A;  4N3V A;  4HBR A;  3RGR A;  1WNH A;  1ZX2 A;  2W56 A;  3LH4 A;  4N6O B;  1DVD A;  3F8X A;  1N5H A;  1EA2 A;  1N8R 4;  2QA4 3;  1WMO A;  1PU4 A;  2CW9 A;  3MG3 A;  4R1K A;  1JJ2 2;  3K7C A;  1DVC A;  4HM5 B;  1YIJ 3;  1QMA A;  3DUK A;  5BVB A;  2E2U A;  1IVW A;  3DY5 A;  3T8U A;  1STF I;  3OV4 A;  4HM6 B;  1IK3 A;  1KWI A;  1TFO A;  2FXT A;  3HX8 A;  3FGY A;  3NUV A;  3CCL 3;  4WWU C;  1N9E A;  3GZY B;  4WYK B;  3V92 A;  1JKG B;  1VQ8 3;  3NBB A;  1RKY A;  3CD6 3;  1A67 A;  3B8L A;  1OUN A;  3B4O A;  4L7K A;  1OGZ A;  3H51 A;  4MJD A;  1QAK A;  2Z76 A;  1JNQ A;  2C10 A;  2F98 A;  2XEP A;  1O7H B;  5A0O B;  1ROA A;  2BHM A;  3LXU X;  6STD A;  2OQE A;  5KP4 A;  3MHE A;  3NV0 A;  1TU5 A;  1OHO A;  1K8A 4;  4FR9 A;  3CNX A;  2BMO B;  4JRF A;  2XSH B;  2V1L A;  3PCS A;  3NQZ A;  1W6G A;  5CF2 A;  1OH0 A;  3DXO A;  2CG0 A;  2W03 A;  3CCU 3;  1SPU A;  4RBN A;  1OAC A;  1JN5 B;  4LMI A;  2CFG A;  3LZA A;  5CXO A;  1C7H A;  1W01 A;  2BMR B;  3KFQ C;  4K61 A;  2I9W A;  1AVL A;  3FSD A;  4J8T A;  3CCJ 3;  3D3L A;  2OOV A;  3NX0 A;  3J7Y d;  3CC7 3;  2W0Q A;  3CCE 3;  4BTW A;  2CIU A;  1FGR A;  1CQS A;  3CPW 2;  1IU7 A;  2L4V A;  4R9K A;  3HII A;  2CFL A;  2GEY A;  1ULI B;  1JRQ A;  3D9R A;  4HJL B;  1OHP A;  3AMO B;  1GY6 A;  3EQQ B;  2QIY A;  3NHX A;  3PXM A;  2QEX 3;  3CC4 3;  1J2B A;  3EN1 B;  4EBG A;  3RDE A;  3HI7 A;  2D42 A;  3BNB A;  4STD A;  2W6J H;  3X3Z A;  4N6M A;  1L5G B;  1VQK 3;  3GRD A;  1VQ9 3;  2C11 A;  1VQM 3;  1IVX A;  3B4P A;  1Q82 4;  4WFO A;  3SOA A;  2HMJ B;  1GYB A;  3OW2 2;  3O8Y A;  3S5C A;  3ROB A;  4LSO A;  2CK3 H;  1YI2 3;  3SXX A;  3LYG A;  1QVF 2;  1O7P B;  4IT7 A;  3F7X A;  5KP1 A;  1UI8 A;  2Y74 A;  1DMM A;  4NHF A;  1Q86 4;  4O8S A;  3NXJ A;  1NDO B;  4WHA A;  2JQ5 A;  2YFJ B;  1ISK A;  3ALA A;  3NM7 A;  5FGO A;  1OF5 B;  3X41 A;  5AEU B;  5KP3 A;  5IW9 A;  1CYV A;  4JF8 A;  2GXF A;  1ASK A;  3HZP A;  3B7C A;  3FLJ A;  3RGA A;  4HM0 B;  3Q2P A;  1YVB I;  1DMN A;  3UNL A;  2P0X A;  4CCV A;  5CLK A;  1IQ8 A;  1VQ7 3;  4N6L A;  3KKG A;  3KZT A;  2B24 B;  3Q90 A;  4FMC A;  5G2G A;  1VZZ A;  1VQP 3;  5IEO A;  1IT7 A;  1FGO A;  4WYK A;  3N8B A;  3T8N A;  1OPY A;  4HM1 B;  1VQN 3;  5LC7 A;  2B1X B;  3GWR A;  4CDL A;  2CH9 A;  4K1V A;  5STD A;  2YX9 A;  4FMD A;  2CKF B;  1JB2 A;  1TIJ A;  4X2O A;  3FF2 A;  1W00 A;  1YGE A;  2Z77 A;  3BNC A;  2W9Q A;  3I56 3;  1RRH A;  4GL6 A;  1FA3 A;  3V98 A;  1G96 A;  3N9H A;  2OTL 3;  3OX9 A;  5IER A;  1IVU A;  1Q42 A;  4PEJ A;  1WMP A;  1S5A A;  1QVG 2;  2K0M A;  4KFE A;  3FZW A;  5AYR B;  4GB5 A;  2BNG A;  1IV9 A;  4MMY B;  1SJW A;  3MKI A;  1E3V A;  3JUP A;  2XR8 B;  3LTC A;  4O2H A;  1MOL A;  5AI1 A;  1IQY A;  2OQE C;  4L8O A;  2W56 B;  3TDG A;  2XFS A;  1N5P A;  1TUH A;  2KCD A;  4AEQ A;  2WOH A;  3V99 A;  1W2Z A;  3DM8 A;  1VQ6 3;  4HM2 B;  4LGQ A;  1K73 4;  2W9P A;  1BUQ A;  4H61 A;  5D82 A;  1W5Z A;  1CYU A;  4EXR A;  1KSI A;  4EV2 A;  3UJM A;  3FH1 A;  1OHS A;  2ML5 A;  3MG2 A;  5DRE A;  8CHO A;  5DRV A;  3BLZ A;  3G0K A;  3N54 B;  1IDP A;  3NBR A;  3X40 A;  4OUQ A;  3EE1 A;  4IIA A;  3VGN A;  1CEW I;  2INX A;  2XF3 A;  3DZL A;  3JUM A;  1W6C A;  2CHC A;  2STD A;  4N6U A;  3SVA A;  2CWT A;  3HK4 A;  3LT9 A;  1QAF A;  3G4S 3;  3S67 A;  1GY7 A;  3MG1 A;  4OVM A;  1OF5 A;  3EB8 A;  3VF1 A;  1D6Y A;  1RJO A;  4Q53 A;  1A2K A;  3DGL A;  4MMZ B;  1JKG A;  1Q40 A;  2OTJ 3;  4LZI A;  4LEH A;  3VSY A;  5D83 A;  1T5Y A;  2E2T A;  3PS8 A;  1Z1S A;  1MNL A;  2Z6B A;  5CF1 A;  5JPP A;  1NU3 A;  4X2H A;  3LOY A;  5AIH A;  2R4I A;  3NV0 B;  2UX0 A;  2IUK A;  2XFT A;  2D1W A;  2BMQ B;  2MF7 A;  4RNZ A;  1IQX A;  3KN4 A;  3AMO A;  1M9G A;  2BO9 B;  1AR0 A;  3MPH A;  2LYX A;  1YJN 3;  2OWP A;  1QAL A;  2HMK B;  3MYT A;  2WOF A;  1GD4 A;  3NM2 A;  3EBT A;  1A90 A;  3S28 A;  1K41 A;  1WTH A;  1TP6 A;  2RCD A;  2OCT A;  4XB5 A;  1N8Q A;  2E2V A;  2FNQ A;  2OOV C;  3CXC 2;  1HKX A;  3CCV 3;  1UUW B;  1U5O A;  4O3V A;  1LXE A;  3KII A;  3STD A;  1AVK A;  3Q1C A;  5IG5 A;  1ZO2 A;  1YIT 3;  1EKM A;  3GZX B;  1JN5 A;  4HM7 B;  4HZ9 B;  4BTY A;  1S72 3;  4HM8 B;  4HYZ A;  4K90 B;  1YHQ 3;  1K9M 4;  5EEO A;  2FGT A;  3JVC A;  5TGN A;  3GAX A;  3NBJ A;  3CCM 3;  3QRD A;  3SED A;  3EBY A;  3WOF B;  2KRT A;  4XDV A;  4HM4 B;  1IV7 A;  4N6N B;  1NO3 A;  1W4N A;  3ER7 A;  2HML B;  2Q07 A;  2PNC A;  3H3H A;  1EG9 B;  3PYJ A;  4HM3 B;  4ORL A;  4R9L A;  5JPU A;  3E99 A;  5ELU A;  2P05 A;  4NRE A;  5IG3 A;  4FCJ A;  3SX1 A;  2GBW B;  1ULJ B;  2JDI H;  1US1 A;  1UW1 A;  1Q81 4;  2YFI B;  1NB3 I;  2CC3 A;  3I0Y A;  3KE7 A;  1F8N A;  1IT8 A;  1LVN A;  1FUW A;  4KFD A;  3LT8 A;  1W2B 2;  4KZ1 A;  5ELJ A;  3CU3 A;  4HZB B;  3CCR 3;  3FCS B;  3OWY A;  4KVH A;  4U13 A;  2GU3 A;  5IG0 A;  1Q7Y 4;  3FF0 A;  1V74 A;  2Z7A A;  3JUO A;  3MWZ A;  1W6Y A;  4FMB A;  1LNH A;  3CME 3;  5HGR A;  2RGQ A;  3LML A;  3F8H A;  3DMC A;  1M90 4;  3F7S A;  1A2V A;  4XDW A;  2SBL A;  4MEI A;  1O7M B;  1UUV B;  1STD A;  3SLU A;  5I97 A;  2P09 A;  2CWV A;  3K0Z A;  3WOE B;  1O7G B;  2M7O A;  1JV2 B;  1VQO 3;  5IEN A;  4I4K A;  1D6U A;  2MC8 A;  2PZV A;  2XSO B;  1M1K 4;  2CWU A;  2XH9 A;  4KFF A;  1LOX A;  5CK6 A;  1SIH A;  3KSE D;  3I55 3;  1SII A;  1GD3 A;  3WMD A;  3UL5 A;  5BXQ A;  4FCM A;  4AKY A;  1D6Z A;  3CC2 3;  1DYU A;  2CFW A;  3F40 A;  3HIG A;  2ZDJ A;  3CCS 3;  1NJI 4;  2P0M A;  3U1W A;  4EYC A;  3IPT A;  3LTD A;  2RFR A;  1RN7 A;  4HVN A;  4RZM A;  4TX4 A;  3EC9 A;  3G8Z A;  5JBS A;  2XRX B;  4WP5 A;  3OXA A;  5AIF A;  4FCZ A;  1UI7 A;  4J9A A;  1RRL A;  1VQL 3;  1SQW A;  1R4C A;  3G71 3;  2IA7 A;  3KSP A;  3JUQ A;  1FGQ A;  1E3R A;  2WGO A;  3G6E 3;  3GZB A;  4XBY A;  3X42 A;  3EJV A;  1QJG A;  3WOD G;  3DGM A;  3OWU A;  1OGX A;  4O02 B;  1WMN A;  2A15 A;  4QWT A;  3CPO A;  1IVV A;  4H3U A;  1VQ5 3;  1O7W B;  3DGN A;  2HMN B;  3CNM A;  5IEP A;  1FGM A;  3CCQ 3;  4AKZ A;  1KQS 2;  1PFP A;  4FMA A;  3F14 A;  4R4K A;  2QGU A;  3S27 A;  2IMJ A;  2WGQ A;  2YFL B;  1NB5 I;  4MMX B;  3WDG B;  4EC6 A;  2W2C A;  1O7N B;  4OK0 A;  2RSX A;  3BB9 A;  3M8C A;  2CG1 A;  3JUN A;  4IPB A;  3EF8 A;  3CMA 3;  2WO0 A;  3BND A;  1OCV A;  4BTX A;  1U8C B;  4L8P A;  1JB4 A;  5AEW B;  2BT3 A;  1ROV A;  3NQY A;  1N9J A;  1Y4K A;  5LC6 A;  1GS3 A;  1TFK A;  2LQV A;  2O3O A;  3EHC A;  3EX9 A;  2K54 A;  1WQL B;  4XBX A;  3GZR A;  5AIG A;  4ZM8 A;  3UB1 A;  3F9S A;  1K28 A;  4HKV B;  5IF6 A;  2F86 B;  3U97 A;  3MSO A;  1M1X B;  2GEX A;  3IMA B;  1HU9 A;  2F99 A;  2XGN A;  2IUJ A;  4N6T A;  5EVH A;  2Y73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...