3CCV3

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
b'MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
molecule tags Ribosome
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ccv300
1YI23 1Q814 2OTL3 3CME3 3I563 3CCM3 3CCL3 1YHQ3 1VQK3 1N8R4 3G6E3 2QEX3 3CCE3 3CCQ3 1KQS2 3CC43 1YIJ3 1JJ22 2OTJ3 3G713 1M1K4 1VQO3 1QVF2 1S723 1VQ63 1YJW3 3I553 1K9M4 1YJN3 3CCR3 3CMA3 3CCS3 1KC84 1VQP3 3CC23 1YIT3 1M904 1VQL3 1NJI4 1VQM3 3CD63 1VQ83 3CPW2 2QA43 1VQN3 3CC73 3CCJ3 1QVG2 1K8A4 1Q864 1Q7Y4 1Q824 1KD14 1VQ43 1W2B2 1VQ53 3CCV3 1VQ93 1YJ93 3OW22 3CXC2 1VQ73 3G4S3 3CCU3 1K734
chains in the Genus database with same CATH superfamily
4MMXB 1LXEA 3AHSA 2OCTA 3RGRA 1Q814 3NBRA 7GSPA 1GY7A 4KFFA 4R1KA 5DREA 3X3YA 2CHCA 3ZFZA 2RFRA 1IK3A 1FA3A 4NPBA 1UGIA 1X1WA 1QVF2 1OUNA 2YFIB 5IEOA 3WDGB 4JF8A 1FW7A 5JPPA 3EF8A 4X2OA 1M904 2KF3A 2E2VA 3EB8A 4K61A 2ZHXB 3HK4A 1UCKA 1JKGB 5IG5A 1FYSA 1IVUA 1V57A 1U5OA 2H0GA 4N6V0 4EV2A 2PZVA 1EUIC 1UW1A 1IVVA 2UUGC 1W01A 4HVNA 1JKGA 2ML6A 2PNCA 1G02A 3MKIA 1J2BA 1F8NA 1MWUA 1RN7A 1AY7A 3F40A 1LNIA 5M18A 2BU4A 2HMMB 3EC9A 3N8BA 3I563 3X42A 2CC3A 4ZM8A 2CG0A 1YGEA 1NU3A 3L0RA 4ILFA 3NUVA 5G1KA 2HOHA 3SVAA 4HM1B 1MWSA 1PYLA 1TU5A 2ZDJA 1GD4A 1NDOB 1OHPA 3DY5A 3LXUX 2C4BA 1IT7A 4HM2B 3S28A 4FCMA 3J7Yd 1QMAA 3UL6A 3OWUA 3F8HA 2P05A 1D6ZA 4HYZA 3ROBA 2FGTA 4O8SA 1DYUA 3IMAB 1DMNA 3NBJA 3NV0B 2XSOB 1BANA 2GEYA 2IMJA 2RSXA 4HM6B 1IYYA 3FF0A 4H61A 1MWTA 3BNEA 5AYRB 3WOFB 1K734 1O7MB 1W6GA 2XGLA 3DGNA 3F9SA 3T8NA 1AQZA 2OTL3 1EEJA 1RKYA 4WHAA 1BNFA 4K1VA 1OACA 4AKYA 2O3OA 3LZAA 1BSEA 2P0XA 1N5PA 4XBTA 1ZGXA 1UCIA 2E2UA 2RBIA 5CLKA 3G16A 3S5CA 3CC23 5IG3A 4IPBA 5JBSA 1DE3A 1TUHA 2M7OA 1Q9EA 1FZUA 3H51A 3CD63 2W56A 5LC7A 3EBYA 3PXMA 1LRAA 2GSPA 5IG4A 3N54B 4O02B 1IQ8A 2RCDA 4HM0B 3FGYA 2GXFA 3BLZA 1N9JA 4LGQA 1U8CB 2CFWA 3EN1B 1MGWA 2BMRB 3NQYA 5D81A 1NWWA 2L1SA 2CX1A 1O7WB 2OOVA 1OCVA 2P38A 4HM7B 3T8UA 2XH9A 1BRJA 3LTCA 3BNDA 3HI7A 3N9HA 1R4CA 2CWVA 1QAFA 3FZWA 3WA2X 4N6UA 2MF7A 1ULIB 1C54A 1VQP3 3BIRA 1NNVA 2ZA4A 2STDA 3Q3FA 5EQLA 4EBGA 1BNSA 1I2GA 1Q42A 3KCHA 3U1WA 3A5EA 1DVDA 1IV9A 2L4VA 3A76A 1RN1A 1VQ93 2XR8B 3LTDA 3AMOB 3QK9A 1JBRA 1RHLA 3B4OA 3MWZA 4AEQA 2WGQA 1EA2A 2IUKA 3CXC2 4WWUC 5IEPA 1BAOA 1RMSA 1BU4A 1V58A 4N6MA 3HIIA 1YI23 1EQKA 1MNLA 1PU4A 1RGGA 3CCE3 1VQQA 2OTJ3 4FMDA 3DMCA 2B24B 4O2HA 1UCLA 2R41A 4EW5A 5D83A 3CPOA 1FGOA 2CFLA 4Q53A 1VQM3 1B2UA 1SARA 3FSDA 3G0KA 5FGOA 1BSDA 2GBXB 3GZRA 5G2GA 5JPUA 2BMOB 1ROVA 4FCJA 3ALAA 3MG1A 3SLUA 5FW5A 1GMPA 4EC6A 1BRGA 1K8A4 1KD14 1TP6A 1BVIA 3AGOA 3AGNA 2HMLB 3D9RA 3JUOA 4WYKA 3VF1A 3ER7A 4FCZA 2F4YA 3BNBA 3PCSA 2IUJA 3SOAA 1RCLA 2HMNB 3NBBA 3STDA 2KAAA 3IJEB 3BNCA 3UB1A 3ZG0A 2QEX3 1ASKA 3WA3A 1N9EA 3SX1A 5AIHA 1RNBA 1MGRA 1S723 1RGAA 2WOHA 1FGTA 4J9AA 6RNTA 1B2MA 1UI8A 1JNQA 1Q7HA 2CFDA 3LYGA 3S67A 1UCJA 2KF6A 1BNGA 1DMQA 3MHEA 4R9KA 2I9WA 1CH0A 4LYLB 4FMBA 3CNXA 3M8CA 2GBWB 3HOHA 3JUNA 1IV7A 1FUWA 3F8XA 1CYUA 1WNHA 1RCKA 1Q7Y4 1Q824 2H0IA 1GOYA 4XBYA 1PY3A 4BL3A 3O8YA 3GZBA 3NXJA 1RDSA 2OQEC 4TX4A 4N6LA 1JB5A 3HIGA 4L7KA 1JZDA 4OK0A 8CHOA 3CCM3 1BOXA 1D6YA 4HKVB 1YHQ3 1N8R4 1ZX2A 4WFOA 1OPYA 2W0QA 2P09A 1W4NA 3EE1A 4BL2A 3NHXA 1FGQA 2XEPA 1M9GA 1ZO2A 3K9MC 1ROAA 3FG3A 1I8VA 3WMDA 3FKAA 2CWTA 5AIFA 2XGNA 4QWTA 3FF2A 4I5QA 4LEHA 4GB5A 4L8PA 2YFLB 1OHSA 3RDEA 1GY6A 2BO9B 2HMKB 1RGKA 2H0HA 2SBLA 2W9PA 5IW9A 4CCVA 2W56B 5CF2A 1SJWA 2BMQB 1QALA 3UNLA 4KT3B 1RRHA 1RNTA 4RNYA 3BU4A 3CCU3 4GHOA 1NJI4 2K0MA 1I3FA 3GAXA 9RNTA 1RTUA 4XM4A 1LOWA 1S5AA 3Q2PA 3FCSB 2UGIA 1KQS2 2XSHB 4LZIA 1E3VA 3DGOA 1BSAA 3NQZA 4LSOA 3CNMA 4EYCA 1SIHA 4GSPA 3NM2A 5IENA 1LOYA 3EX9A 3CCS3 3X3XA 1BRIA 1IQXA 2W6JH 1GD3A 4HJLB 2RGQA 6GSPA 1LNHA 1GY5A 1BSBA 1MOLA 3S29A 1SQWA 1JZOA 3MSOA 2KRTA 5ELUA 1JBSA 1B27A 4L8OA 8RNTA 5AYSC 1BSCA 4EV5A 3PGBA 1VQ43 1W6CA 3K7CA 2D1WA 3LTBA 1WTHA 1HYFA 1A2KA 1E3RA 3PCRA 4BU4A 1PFPA 6STDA 3NX0A 3EHCA 1RGFA 1W5ZA 3CCL3 4XB5A 1HU9A 1V74A 1CQSA 1X1YA 2W9QA 3GWRA 3MG3A 1RGLA 1JJ22 4CJNA 4STDA 4RBNA 2KF4A 3FG1A 2R4IA 1T3BA 2CH9A 1IVWA 2IYJA 1LVNA 1YJN3 4R80A 3WODG 1FGMA 3OX9A 3CU3A 4R4KA 1MWRA 3D79A 2GU3A 3KE7A 2CIUA 3QRDA 1JV2B 1LQGC 1JRQA 4RNTA 2A15A 2HMJB 4HBRA 2Z7AA 2AADA 3D5GA 3MPHA 1I0XA 3DUKA 3SOYA 1W6YA 1STFI 4MEIA 1B20A 4NHFA 3G8ZA 1K41A 3ZG5A 1KWIA 3Q1CA 1Y4KA 4CPKA 4JRFA 1DETA 3RNTA 3VSYA 5AI1A 3B4PA 3TDGA 5I97A 1BUJA 4HM5B 1LQMB 1M1K4 1KSIA 3GZYB 3X40A 4KFEA 1RGEA 3DZLA 4HM4B 1HZ1A 1E97A 3OXAA 3DXOA 1LOVA 1Q40B 1W00A 1I2FA 3KIIA 2RNTA 1K28A 2V1LA 2CK3H 2XFSA 4MMYB 5M19A 2QA43 1FUSA 5CF1A 3DM8A 3F7SA 5HOHA 1Q864 4DKIA 1RLSA 2ML5A 5KP4A 4RNZA 2D42A 1RN4A 4KZ1A 1M1XB 3WHOA 3AHWA 3EQQB 3UJMA 5EVHA 4N6NB 2F99A 2YX9A 5G1LA 1AVKA 3FG4A 3G6E3 3CCQ3 3JUQA 5EEOA 3X3ZA 3GRDA 1RJOA 4OUQA 4EXRA 1TRQA 2BIRA 4HM8B 1VQO3 1BUQA 1K9M4 3I553 3SXXA 1W2ZA 3DGLA 2IY2A 4BIRA 3EJVA 1O7NB 1A2VA 1I0VA 2CFGA 2BT3A 4H3UA 2WOFA 3DGMA 3K63A 7STDA 1GMQA 2J8XB 2OWPA 3WR2A 1RRLA 3WOEB 1B2XA 5TGNA 1X1UA 2UX0A 1WMNA 1IVXA 1GMRA 1X1XA 1VQ73 1ZS7A 1IT8A 3KSPA 3CME3 1WMOA 2F98A 4FR9A 1BRSA 4BTYA 1Q40A 2FNQA 2GEXA 2KXGA 7RNTA 1JBTA 3T0UA 3B7CA 3MYTA 1VQ63 1GYBA 1IQYA 2JDIH 2SARA 3MG2A 3KSED 2Y73A 1HKXA 1AV4A 3DGYA 4IIAA 3CMA3 4HZ9B 4LMIA 3F7XA 2C10A 1A2PA 5D82A 5IF6A 5GSPA 1VQL3 2Z76A 3KFQC 3V92A 1IDPA 3JUPA 4HM3B 3UL5A 1T5YA 2W03A 1B3SA 4GL6A 1B2SA 3F14A 3NM7A 1SIIA 1US1A 3Q90A 2F56A 2GU1A 3JVCA 4G1MB 4HOHA 3OWSA 3K5TA 4WYKB 2INXA 5CXOA 5AEUB 3G4S3 2LYXA 1EG9B 5STDA 1DMMA 4XDVA 3SEDA 1BRHA 2B1XB 1VQK3 1A67A 5A0OB 5M1AA 3G713 1G96A 1T2IA 1Z1SA 1IU7A 1OF5A 5ELJA 5BU4A 1JB4A 2W2CA 2XFTA 5AEWB 1TFOA 3K0ZA 5KP3A 1WMPA 3D3LA 4BTWA 1UUVB 1GS3A 1CYVA 1OGZA 2OQEA 2AAEA 2FXTA 3S27A 2Q07A 1B2ZA 2IA7A 3PYJA 1YNVX 1UUWB 1VQN3 1ULJB 1GOVA 3E99A 1FGRA 4R9LA 4RZMA 5LC6A 1OH0A 5RNTA 1SPUA 5AIIA 1O7HB 4WP5A 2OOVC 4J5GA 1OGXA 4U13A 1UUGB 3B8LA 2ZL8A 2F5MA 1W7CA 3LT8A 3AMOA 3HX8A 3LOYA 3EBTA 4MJDA 1BRKA 1W02A 1BRNL 3H3HA 4NREA 1FUTA 1JN5A 3FH1A 3X41A 2CFKA 1TRPA 1UI7A 2MC8A 3V98A 1QJGA 2KF5A 1AR0A 1VZZA 1R4YA 4PEJA 3CCR3 1GOUA 1YVBI 1T2HA 1BGSA 3JUMA 2XRXB 1YVSA 2CW9A 2Z77A 3OV4A 1RSNA 2F5WA 1NB5I 4AKZA 4O3VA 2CX0A 4FMAA 3CPW2 1O7PB 4KFDA 1CEWI 1EKMA 1I70A 3GSPA 3U97A 1BNJA 1QVG2 4CDLA 1B21A 1WQLB 5AIGA 1YJ93 3IPTA 3ECFA 3V99A 1UGHI 4MMZB 2K3DA 3OW22 4K1UA 1STDA 2W04A 4J5KA 1BNEA 3OWYA 5HGRA 3EN8A 2F86B 2CKFB 2E2TA 4HAAA 3CC43 4BTXA 1YIJ3 1RGCA 3DH2A 1LOXA 3KZTA 2Z6BA 1YJW3 1JB2A 2LQVA 4N6TA 1AVLA 3D4AA 3RGAA 2Y74A 1A90A 1KC84 1BIRA 2K54A 1YIT3 1RGHA 1O7GB 5IG0A 3PZWA 4I4KA 1TIJA 1C7HA 2WGOA 3I0YA 1YGWA 3KN4A 3LMLA 3LTAA 1N5HA 5BVBA 3VGNA 1JN5B 2HMOB 2JQ5A 1ISKA 3CCV3 5IERA 1BNRA 5KP1A 2XF3A 4OVMA 3GZXB 1G0TA 2BNGA 2KCDA 3NV0A 4N3VA 3KKGA 4HZBB 3PS8A 1NO3A 5DRVA 1TTOA 2WO0A 4XDWA 1QAKA 3HZPA 4IT7A 1OHOA 3D5IA 1DVCA 4FMCA 1L5GB 2QGUA 4K90B 2BHMA 4ORLA 5CK6A 1UDII 3SYUA 1NB3I 3LH4A 4XBXA 5BIRA 4KVHA 3BB9A 3LT9A 1OF5B 1N8QA 2C11A 2CWUA 4J8TA 1D6UA 1I2EA 1TJDA 4X2HA 5BXQA 2P0MA 3CC73 4N6OB 3CCJ3 1VQ53 1BNIA 2YFJB 2CG1A 1TFKA 3FLJA 1W2B2 1I3IA 2O9UX 2QIYA 1VQ83 3URPA 1GSPA
chains in the Genus database with same CATH topology
4MMXB 1LXEA 2OCTA 3RGRA 1Q814 3NBRA 1GY7A 4KFFA 4R1KA 5DREA 3X3YA 2CHCA 2RFRA 1IK3A 1FA3A 1QVF2 1OUNA 2YFIB 5IEOA 3WDGB 4JF8A 5JPPA 3EF8A 4X2OA 1M904 2E2VA 3EB8A 4K61A 3HK4A 1JKGB 5IG5A 1IVUA 1U5OA 4N6V0 2PZVA 1UW1A 1IVVA 1W01A 4HVNA 1JKGA 2ML6A 2PNCA 3MKIA 1F8NA 1RN7A 3F40A 3EC9A 2HMMB 3N8BA 3I563 3X42A 2CC3A 4ZM8A 2CG0A 1YGEA 1NU3A 3L0RA 3NUVA 3SVAA 4HM1B 1TU5A 2ZDJA 1GD4A 1NDOB 1OHPA 3DY5A 3LXUX 4HM2B 1IT7A 3S28A 4FCMA 3J7Yd 1QMAA 3UL6A 3OWUA 3F8HA 2P05A 1D6ZA 4HYZA 3ROBA 2FGTA 4O8SA 1DYUA 3IMAB 1DMNA 3NBJA 3NV0B 2XSOB 2GEYA 4HM6B 2IMJA 2RSXA 3FF0A 4H61A 3BNEA 5AYRB 3WOFB 1K734 1O7MB 1W6GA 2XGLA 3DGNA 3F9SA 3T8NA 2OTL3 1RKYA 4WHAA 4K1VA 1OACA 4AKYA 2O3OA 3LZAA 2P0XA 1N5PA 4XBTA 2E2UA 5CLKA 3CC23 1J2BA 3G16A 3S5CA 5IG3A 4IPBA 5JBSA 1TUHA 2M7OA 3H51A 3CD63 2W56A 5LC7A 3EBYA 3PXMA 5IG4A 3N54B 4O02B 1IQ8A 2RCDA 4HM0B 3FGYA 2GXFA 3BLZA 1N9JA 4LGQA 1U8CB 2CFWA 3EN1B 2BMRB 3NQYA 5D81A 1NWWA 1O7WB 2OOVA 1OCVA 2P38A 4HM7B 3T8UA 2XH9A 3LTCA 3BNDA 3HI7A 3N9HA 1R4CA 2CWVA 1QAFA 3FZWA 3WA2X 4N6UA 2MF7A 1ULIB 1VQP3 2STDA 5EQLA 4EBGA 1Q42A 1DVDA 3U1WA 1IV9A 2L4VA 3A76A 1VQ93 2XR8B 3LTDA 3AMOB 3QK9A 3B4OA 3MWZA 4AEQA 2WGQA 1EA2A 2IUKA 3CXC2 4WWUC 5IEPA 4N6MA 3HIIA 1YI23 1EQKA 1MNLA 1PU4A 3CCE3 2OTJ3 4FMDA 3DMCA 2B24B 4O2HA 5D83A 3CPOA 1FGOA 2CFLA 4Q53A 1VQM3 3FSDA 5FGOA 3G0KA 2GBXB 3GZRA 5G2GA 5JPUA 2BMOB 1ROVA 4FCJA 3ALAA 3MG1A 3SLUA 5FW5A 4EC6A 1K8A4 1KD14 1TP6A 2HMLB 3D9RA 3JUOA 4WYKA 3VF1A 3ER7A 4FCZA 3BNBA 3PCSA 2IUJA 3SOAA 3NBBA 2HMNB 3STDA 3UB1A 3IJEB 2QEX3 3BNCA 1ASKA 3WA3A 1N9EA 3SX1A 5AIHA 1S723 2WOHA 1FGTA 4J9AA 1UI8A 1JNQA 2CFDA 3LYGA 3S67A 1DMQA 3MHEA 4R9KA 2I9WA 4FMBA 3CNXA 3M8CA 2GBWB 3JUNA 1IV7A 1FUWA 3F8XA 1CYUA 1WNHA 1Q7Y4 1Q824 4XBYA 3O8YA 3GZBA 3NXJA 2OQEC 4TX4A 4N6LA 1JB5A 3HIGA 4L7KA 4OK0A 8CHOA 3CCM3 1D6YA 1YHQ3 4HKVB 1N8R4 1ZX2A 4WFOA 1OPYA 2W0QA 2P09A 1W4NA 3EE1A 3NHXA 1FGQA 2XEPA 1M9GA 1ZO2A 3K9MC 1ROAA 3FG3A 3WMDA 3FKAA 2CWTA 5AIFA 2XGNA 4QWTA 3FF2A 4LEHA 4GB5A 4L8PA 2YFLB 1OHSA 3RDEA 1GY6A 2BO9B 2HMKB 5IW9A 2SBLA 2W9PA 4CCVA 2W56B 5CF2A 1SJWA 2BMQB 1QALA 3UNLA 1RRHA 4RNYA 1NJI4 3CCU3 2K0MA 3GAXA 4XM4A 1S5AA 3Q2PA 3FCSB 1KQS2 2XSHB 4LZIA 1E3VA 3DGOA 4LSOA 3NQZA 3CNMA 4EYCA 1SIHA 3NM2A 5IENA 3EX9A 3CCS3 3X3XA 1IQXA 2W6JH 1GD3A 4HJLB 2RGQA 1LNHA 1GY5A 1MOLA 3S29A 1SQWA 3MSOA 2KRTA 5ELUA 4L8OA 5AYSC 4EV5A 3PGBA 1VQ43 1W6CA 3K7CA 2D1WA 3LTBA 1WTHA 1A2KA 1E3RA 3PCRA 1PFPA 6STDA 3NX0A 3EHCA 1W5ZA 3CCL3 4XB5A 1HU9A 1V74A 1CQSA 2W9QA 3GWRA 3MG3A 1JJ22 4STDA 4RBNA 3FG1A 2R4IA 2CH9A 1IVWA 1YJN3 1LVNA 4R80A 3WODG 1FGMA 3OX9A 3CU3A 4R4KA 2GU3A 3KE7A 2CIUA 3QRDA 1JV2B 1JRQA 2A15A 2HMJB 4HBRA 2Z7AA 3MPHA 3SOYA 3DUKA 1W6YA 1STFI 4MEIA 4NHFA 3G8ZA 1K41A 1KWIA 3Q1CA 1Y4KA 4JRFA 3VSYA 5AI1A 3B4PA 3TDGA 5I97A 4HM5B 1M1K4 1KSIA 3GZYB 3X40A 4KFEA 3DZLA 4HM4B 1E97A 3OXAA 3DXOA 1Q40B 1W00A 3KIIA 1K28A 2V1LA 2CK3H 2XFSA 4MMYB 2QA43 5CF1A 3DM8A 3F7SA 1Q864 2ML5A 5KP4A 4RNZA 2D42A 4KZ1A 1M1XB 3EQQB 3UJMA 5EVHA 4N6NB 2F99A 2YX9A 3G6E3 1AVKA 3FG4A 3CCQ3 3JUQA 5EEOA 3X3ZA 3GRDA 1RJOA 4OUQA 4EXRA 4HM8B 1VQO3 1BUQA 1K9M4 3I553 3SXXA 1W2ZA 3DGLA 3EJVA 1O7NB 1A2VA 2CFGA 2BT3A 4H3UA 2WOFA 3DGMA 3K63A 7STDA 2OWPA 1RRLA 3WOEB 5TGNA 2UX0A 1WMNA 1IVXA 1VQ73 1IT8A 3KSPA 3CME3 1WMOA 2F98A 4FR9A 4BTYA 1Q40A 2FNQA 2GEXA 2KXGA 3T0UA 3B7CA 3MYTA 1VQ63 1GYBA 1IQYA 2JDIH 3MG2A 3KSED 2Y73A 1HKXA 1AV4A 4IIAA 3CMA3 4HZ9B 4LMIA 3F7XA 2C10A 5D82A 5IF6A 1VQL3 2Z76A 3KFQC 3V92A 1IDPA 3JUPA 4HM3B 3UL5A 1T5YA 2W03A 4GL6A 3F14A 3NM7A 1SIIA 1US1A 3Q90A 2GU1A 3JVCA 4G1MB 3OWSA 3K5TA 4WYKB 2INXA 5CXOA 5AEUB 3G4S3 2LYXA 1EG9B 5STDA 1DMMA 4XDVA 3SEDA 2B1XB 1VQK3 1A67A 5A0OB 3G713 1G96A 1Z1SA 1IU7A 1OF5A 5ELJA 1JB4A 2W2CA 2XFTA 5AEWB 1TFOA 3K0ZA 5KP3A 1WMPA 3D3LA 4BTWA 1UUVB 1GS3A 1CYVA 1OGZA 2OQEA 2FXTA 3S27A 2Q07A 2IA7A 3PYJA 1UUWB 1VQN3 1ULJB 3E99A 1FGRA 4R9LA 4RZMA 5LC6A 1OH0A 1SPUA 5AIIA 1O7HB 4WP5A 2OOVC 1OGXA 4U13A 3B8LA 2ZL8A 1W7CA 3LT8A 3AMOA 3HX8A 3LOYA 3EBTA 4MJDA 1W02A 3H3HA 4NREA 1JN5A 3FH1A 3X41A 2CFKA 1UI7A 2MC8A 3V98A 1QJGA 1AR0A 1VZZA 4PEJA 3CCR3 1YVBI 3JUMA 2XRXB 2CW9A 2Z77A 3OV4A 1NB5I 4AKZA 4O3VA 4FMAA 3CPW2 1O7PB 4KFDA 1CEWI 1EKMA 3U97A 1QVG2 4CDLA 1WQLB 5AIGA 1YJ93 3IPTA 3ECFA 3V99A 3OW22 4MMZB 4K1UA 1STDA 2W04A 3OWYA 5HGRA 3EN8A 2F86B 2CKFB 2E2TA 3CC43 4BTXA 1YIJ3 1LOXA 3KZTA 2Z6BA 1YJW3 1JB2A 2LQVA 4N6TA 1AVLA 3RGAA 2Y74A 1A90A 1KC84 2K54A 1YIT3 1O7GB 5IG0A 3PZWA 4I4KA 1TIJA 1C7HA 2WGOA 3I0YA 3KN4A 3LMLA 3LTAA 1N5HA 5BVBA 3VGNA 1JN5B 2HMOB 2JQ5A 1ISKA 3CCV3 5IERA 5KP1A 2XF3A 4OVMA 3GZXB 2BNGA 2KCDA 4N3VA 3NV0A 3KKGA 4HZBB 3PS8A 1NO3A 5DRVA 2WO0A 4XDWA 1QAKA 3HZPA 4IT7A 1OHOA 1DVCA 4FMCA 1L5GB 2QGUA 4K90B 2BHMA 4ORLA 5CK6A 1NB3I 3LH4A 4XBXA 4KVHA 3BB9A 3LT9A 1OF5B 1N8QA 2C11A 2CWUA 4J8TA 1D6UA 4X2HA 5BXQA 2P0MA 3CC73 4N6OB 3CCJ3 1VQ53 2CG1A 2YFJB 1W2B2 1TFKA 3FLJA 2O9UX 2QIYA 1VQ83 4EV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YI2 3;  1Q81 4;  2OTL 3;  3CME 3;  3I56 3;  3CCM 3;  3CCL 3;  1YHQ 3;  1VQK 3;  1N8R 4;  3G6E 3;  2QEX 3;  3CCE 3;  3CCQ 3;  1KQS 2;  3CC4 3;  1YIJ 3;  1JJ2 2;  2OTJ 3;  3G71 3;  1M1K 4;  1VQO 3;  1QVF 2;  1S72 3;  1VQ6 3;  1YJW 3;  3I55 3;  1K9M 4;  1YJN 3;  3CCR 3;  3CMA 3;  3CCS 3;  1KC8 4;  1VQP 3;  3CC2 3;  1YIT 3;  1M90 4;  1VQL 3;  1NJI 4;  1VQM 3;  3CD6 3;  1VQ8 3;  3CPW 2;  2QA4 3;  1VQN 3;  3CC7 3;  3CCJ 3;  1QVG 2;  1K8A 4;  1Q86 4;  1Q7Y 4;  1Q82 4;  1KD1 4;  1VQ4 3;  1W2B 2;  1VQ5 3;  3CCV 3;  1VQ9 3;  1YJ9 3;  3OW2 2;  3CXC 2;  1VQ7 3;  3G4S 3;  3CCU 3;  1K73 4; 
#chains in the Genus database with same CATH topology
 4MMX B;  1LXE A;  3AHS A;  2OCT A;  3RGR A;  1Q81 4;  3NBR A;  7GSP A;  1GY7 A;  4KFF A;  4R1K A;  5DRE A;  3X3Y A;  2CHC A;  3ZFZ A;  2RFR A;  1IK3 A;  1FA3 A;  4NPB A;  1UGI A;  1X1W A;  1QVF 2;  1OUN A;  2YFI B;  5IEO A;  3WDG B;  4JF8 A;  1FW7 A;  5JPP A;  3EF8 A;  4X2O A;  1M90 4;  2KF3 A;  2E2V A;  3EB8 A;  4K61 A;  2ZHX B;  3HK4 A;  1UCK A;  1JKG B;  5IG5 A;  1FYS A;  1IVU A;  1V57 A;  1U5O A;  2H0G A;  4N6V 0;  4EV2 A;  2PZV A;  1EUI C;  1UW1 A;  1IVV A;  2UUG C;  1W01 A;  4HVN A;  1JKG A;  2ML6 A;  2PNC A;  1G02 A;  3MKI A;  1J2B A;  1F8N A;  1MWU A;  1RN7 A;  1AY7 A;  3F40 A;  1LNI A;  5M18 A;  2BU4 A;  2HMM B;  3EC9 A;  3N8B A;  3I56 3;  3X42 A;  2CC3 A;  4ZM8 A;  2CG0 A;  1YGE A;  1NU3 A;  3L0R A;  4ILF A;  3NUV A;  5G1K A;  2HOH A;  3SVA A;  4HM1 B;  1MWS A;  1PYL A;  1TU5 A;  2ZDJ A;  1GD4 A;  1NDO B;  1OHP A;  3DY5 A;  3LXU X;  2C4B A;  1IT7 A;  4HM2 B;  3S28 A;  4FCM A;  3J7Y d;  1QMA A;  3UL6 A;  3OWU A;  3F8H A;  2P05 A;  1D6Z A;  4HYZ A;  3ROB A;  2FGT A;  4O8S A;  1DYU A;  3IMA B;  1DMN A;  3NBJ A;  3NV0 B;  2XSO B;  1BAN A;  2GEY A;  2IMJ A;  2RSX A;  4HM6 B;  1IYY A;  3FF0 A;  4H61 A;  1MWT A;  3BNE A;  5AYR B;  3WOF B;  1K73 4;  1O7M B;  1W6G A;  2XGL A;  3DGN A;  3F9S A;  3T8N A;  1AQZ A;  2OTL 3;  1EEJ A;  1RKY A;  4WHA A;  1BNF A;  4K1V A;  1OAC A;  4AKY A;  2O3O A;  3LZA A;  1BSE A;  2P0X A;  1N5P A;  4XBT A;  1ZGX A;  1UCI A;  2E2U A;  2RBI A;  5CLK A;  3G16 A;  3S5C A;  3CC2 3;  5IG3 A;  4IPB A;  5JBS A;  1DE3 A;  1TUH A;  2M7O A;  1Q9E A;  1FZU A;  3H51 A;  3CD6 3;  2W56 A;  5LC7 A;  3EBY A;  3PXM A;  1LRA A;  2GSP A;  5IG4 A;  3N54 B;  4O02 B;  1IQ8 A;  2RCD A;  4HM0 B;  3FGY A;  2GXF A;  3BLZ A;  1N9J A;  4LGQ A;  1U8C B;  2CFW A;  3EN1 B;  1MGW A;  2BMR B;  3NQY A;  5D81 A;  1NWW A;  2L1S A;  2CX1 A;  1O7W B;  2OOV A;  1OCV A;  2P38 A;  4HM7 B;  3T8U A;  2XH9 A;  1BRJ A;  3LTC A;  3BND A;  3HI7 A;  3N9H A;  1R4C A;  2CWV A;  1QAF A;  3FZW A;  3WA2 X;  4N6U A;  2MF7 A;  1ULI B;  1C54 A;  1VQP 3;  3BIR A;  1NNV A;  2ZA4 A;  2STD A;  3Q3F A;  5EQL A;  4EBG A;  1BNS A;  1I2G A;  1Q42 A;  3KCH A;  3U1W A;  3A5E A;  1DVD A;  1IV9 A;  2L4V A;  3A76 A;  1RN1 A;  1VQ9 3;  2XR8 B;  3LTD A;  3AMO B;  3QK9 A;  1JBR A;  1RHL A;  3B4O A;  3MWZ A;  4AEQ A;  2WGQ A;  1EA2 A;  2IUK A;  3CXC 2;  4WWU C;  5IEP A;  1BAO A;  1RMS A;  1BU4 A;  1V58 A;  4N6M A;  3HII A;  1YI2 3;  1EQK A;  1MNL A;  1PU4 A;  1RGG A;  3CCE 3;  1VQQ A;  2OTJ 3;  4FMD A;  3DMC A;  2B24 B;  4O2H A;  1UCL A;  2R41 A;  4EW5 A;  5D83 A;  3CPO A;  1FGO A;  2CFL A;  4Q53 A;  1VQM 3;  1B2U A;  1SAR A;  3FSD A;  3G0K A;  5FGO A;  1BSD A;  2GBX B;  3GZR A;  5G2G A;  5JPU A;  2BMO B;  1ROV A;  4FCJ A;  3ALA A;  3MG1 A;  3SLU A;  5FW5 A;  1GMP A;  4EC6 A;  1BRG A;  1K8A 4;  1KD1 4;  1TP6 A;  1BVI A;  3AGO A;  3AGN A;  2HML B;  3D9R A;  3JUO A;  4WYK A;  3VF1 A;  3ER7 A;  4FCZ A;  2F4Y A;  3BNB A;  3PCS A;  2IUJ A;  3SOA A;  1RCL A;  2HMN B;  3NBB A;  3STD A;  2KAA A;  3IJE B;  3BNC A;  3UB1 A;  3ZG0 A;  2QEX 3;  1ASK A;  3WA3 A;  1N9E A;  3SX1 A;  5AIH A;  1RNB A;  1MGR A;  1S72 3;  1RGA A;  2WOH A;  1FGT A;  4J9A A;  6RNT A;  1B2M A;  1UI8 A;  1JNQ A;  1Q7H A;  2CFD A;  3LYG A;  3S67 A;  1UCJ A;  2KF6 A;  1BNG A;  1DMQ A;  3MHE A;  4R9K A;  2I9W A;  1CH0 A;  4LYL B;  4FMB A;  3CNX A;  3M8C A;  2GBW B;  3HOH A;  3JUN A;  1IV7 A;  1FUW A;  3F8X A;  1CYU A;  1WNH A;  1RCK A;  1Q7Y 4;  1Q82 4;  2H0I A;  1GOY A;  4XBY A;  1PY3 A;  4BL3 A;  3O8Y A;  3GZB A;  3NXJ A;  1RDS A;  2OQE C;  4TX4 A;  4N6L A;  1JB5 A;  3HIG A;  4L7K A;  1JZD A;  4OK0 A;  8CHO A;  3CCM 3;  1BOX A;  1D6Y A;  4HKV B;  1YHQ 3;  1N8R 4;  1ZX2 A;  4WFO A;  1OPY A;  2W0Q A;  2P09 A;  1W4N A;  3EE1 A;  4BL2 A;  3NHX A;  1FGQ A;  2XEP A;  1M9G A;  1ZO2 A;  3K9M C;  1ROA A;  3FG3 A;  1I8V A;  3WMD A;  3FKA A;  2CWT A;  5AIF A;  2XGN A;  4QWT A;  3FF2 A;  4I5Q A;  4LEH A;  4GB5 A;  4L8P A;  2YFL B;  1OHS A;  3RDE A;  1GY6 A;  2BO9 B;  2HMK B;  1RGK A;  2H0H A;  2SBL A;  2W9P A;  5IW9 A;  4CCV A;  2W56 B;  5CF2 A;  1SJW A;  2BMQ B;  1QAL A;  3UNL A;  4KT3 B;  1RRH A;  1RNT A;  4RNY A;  3BU4 A;  3CCU 3;  4GHO A;  1NJI 4;  2K0M A;  1I3F A;  3GAX A;  9RNT A;  1RTU A;  4XM4 A;  1LOW A;  1S5A A;  3Q2P A;  3FCS B;  2UGI A;  1KQS 2;  2XSH B;  4LZI A;  1E3V A;  3DGO A;  1BSA A;  3NQZ A;  4LSO A;  3CNM A;  4EYC A;  1SIH A;  4GSP A;  3NM2 A;  5IEN A;  1LOY A;  3EX9 A;  3CCS 3;  3X3X A;  1BRI A;  1IQX A;  2W6J H;  1GD3 A;  4HJL B;  2RGQ A;  6GSP A;  1LNH A;  1GY5 A;  1BSB A;  1MOL A;  3S29 A;  1SQW A;  1JZO A;  3MSO A;  2KRT A;  5ELU A;  1JBS A;  1B27 A;  4L8O A;  8RNT A;  5AYS C;  1BSC A;  4EV5 A;  3PGB A;  1VQ4 3;  1W6C A;  3K7C A;  2D1W A;  3LTB A;  1WTH A;  1HYF A;  1A2K A;  1E3R A;  3PCR A;  4BU4 A;  1PFP A;  6STD A;  3NX0 A;  3EHC A;  1RGF A;  1W5Z A;  3CCL 3;  4XB5 A;  1HU9 A;  1V74 A;  1CQS A;  1X1Y A;  2W9Q A;  3GWR A;  3MG3 A;  1RGL A;  1JJ2 2;  4CJN A;  4STD A;  4RBN A;  2KF4 A;  3FG1 A;  2R4I A;  1T3B A;  2CH9 A;  1IVW A;  2IYJ A;  1LVN A;  1YJN 3;  4R80 A;  3WOD G;  1FGM A;  3OX9 A;  3CU3 A;  4R4K A;  1MWR A;  3D79 A;  2GU3 A;  3KE7 A;  2CIU A;  3QRD A;  1JV2 B;  1LQG C;  1JRQ A;  4RNT A;  2A15 A;  2HMJ B;  4HBR A;  2Z7A A;  2AAD A;  3D5G A;  3MPH A;  1I0X A;  3DUK A;  3SOY A;  1W6Y A;  1STF I;  4MEI A;  1B20 A;  4NHF A;  3G8Z A;  1K41 A;  3ZG5 A;  1KWI A;  3Q1C A;  1Y4K A;  4CPK A;  4JRF A;  1DET A;  3RNT A;  3VSY A;  5AI1 A;  3B4P A;  3TDG A;  5I97 A;  1BUJ A;  4HM5 B;  1LQM B;  1M1K 4;  1KSI A;  3GZY B;  3X40 A;  4KFE A;  1RGE A;  3DZL A;  4HM4 B;  1HZ1 A;  1E97 A;  3OXA A;  3DXO A;  1LOV A;  1Q40 B;  1W00 A;  1I2F A;  3KII A;  2RNT A;  1K28 A;  2V1L A;  2CK3 H;  2XFS A;  4MMY B;  5M19 A;  2QA4 3;  1FUS A;  5CF1 A;  3DM8 A;  3F7S A;  5HOH A;  1Q86 4;  4DKI A;  1RLS A;  2ML5 A;  5KP4 A;  4RNZ A;  2D42 A;  1RN4 A;  4KZ1 A;  1M1X B;  3WHO A;  3AHW A;  3EQQ B;  3UJM A;  5EVH A;  4N6N B;  2F99 A;  2YX9 A;  5G1L A;  1AVK A;  3FG4 A;  3G6E 3;  3CCQ 3;  3JUQ A;  5EEO A;  3X3Z A;  3GRD A;  1RJO A;  4OUQ A;  4EXR A;  1TRQ A;  2BIR A;  4HM8 B;  1VQO 3;  1BUQ A;  1K9M 4;  3I55 3;  3SXX A;  1W2Z A;  3DGL A;  2IY2 A;  4BIR A;  3EJV A;  1O7N B;  1A2V A;  1I0V A;  2CFG A;  2BT3 A;  4H3U A;  2WOF A;  3DGM A;  3K63 A;  7STD A;  1GMQ A;  2J8X B;  2OWP A;  3WR2 A;  1RRL A;  3WOE B;  1B2X A;  5TGN A;  1X1U A;  2UX0 A;  1WMN A;  1IVX A;  1GMR A;  1X1X A;  1VQ7 3;  1ZS7 A;  1IT8 A;  3KSP A;  3CME 3;  1WMO A;  2F98 A;  4FR9 A;  1BRS A;  4BTY A;  1Q40 A;  2FNQ A;  2GEX A;  2KXG A;  7RNT A;  1JBT A;  3T0U A;  3B7C A;  3MYT A;  1VQ6 3;  1GYB A;  1IQY A;  2JDI H;  2SAR A;  3MG2 A;  3KSE D;  2Y73 A;  1HKX A;  1AV4 A;  3DGY A;  4IIA A;  3CMA 3;  4HZ9 B;  4LMI A;  3F7X A;  2C10 A;  1A2P A;  5D82 A;  5IF6 A;  5GSP A;  1VQL 3;  2Z76 A;  3KFQ C;  3V92 A;  1IDP A;  3JUP A;  4HM3 B;  3UL5 A;  1T5Y A;  2W03 A;  1B3S A;  4GL6 A;  1B2S A;  3F14 A;  3NM7 A;  1SII A;  1US1 A;  3Q90 A;  2F56 A;  2GU1 A;  3JVC A;  4G1M B;  4HOH A;  3OWS A;  3K5T A;  4WYK B;  2INX A;  5CXO A;  5AEU B;  3G4S 3;  2LYX A;  1EG9 B;  5STD A;  1DMM A;  4XDV A;  3SED A;  1BRH A;  2B1X B;  1VQK 3;  1A67 A;  5A0O B;  5M1A A;  3G71 3;  1G96 A;  1T2I A;  1Z1S A;  1IU7 A;  1OF5 A;  5ELJ A;  5BU4 A;  1JB4 A;  2W2C A;  2XFT A;  5AEW B;  1TFO A;  3K0Z A;  5KP3 A;  1WMP A;  3D3L A;  4BTW A;  1UUV B;  1GS3 A;  1CYV A;  1OGZ A;  2OQE A;  2AAE A;  2FXT A;  3S27 A;  2Q07 A;  1B2Z A;  2IA7 A;  3PYJ A;  1YNV X;  1UUW B;  1VQN 3;  1ULJ B;  1GOV A;  3E99 A;  1FGR A;  4R9L A;  4RZM A;  5LC6 A;  1OH0 A;  5RNT A;  1SPU A;  5AII A;  1O7H B;  4WP5 A;  2OOV C;  4J5G A;  1OGX A;  4U13 A;  1UUG B;  3B8L A;  2ZL8 A;  2F5M A;  1W7C A;  3LT8 A;  3AMO A;  3HX8 A;  3LOY A;  3EBT A;  4MJD A;  1BRK A;  1W02 A;  1BRN L;  3H3H A;  4NRE A;  1FUT A;  1JN5 A;  3FH1 A;  3X41 A;  2CFK A;  1TRP A;  1UI7 A;  2MC8 A;  3V98 A;  1QJG A;  2KF5 A;  1AR0 A;  1VZZ A;  1R4Y A;  4PEJ A;  3CCR 3;  1GOU A;  1YVB I;  1T2H A;  1BGS A;  3JUM A;  2XRX B;  1YVS A;  2CW9 A;  2Z77 A;  3OV4 A;  1RSN A;  2F5W A;  1NB5 I;  4AKZ A;  4O3V A;  2CX0 A;  4FMA A;  3CPW 2;  1O7P B;  4KFD A;  1CEW I;  1EKM A;  1I70 A;  3GSP A;  3U97 A;  1BNJ A;  1QVG 2;  4CDL A;  1B21 A;  1WQL B;  5AIG A;  1YJ9 3;  3IPT A;  3ECF A;  3V99 A;  1UGH I;  4MMZ B;  2K3D A;  3OW2 2;  4K1U A;  1STD A;  2W04 A;  4J5K A;  1BNE A;  3OWY A;  5HGR A;  3EN8 A;  2F86 B;  2CKF B;  2E2T A;  4HAA A;  3CC4 3;  4BTX A;  1YIJ 3;  1RGC A;  3DH2 A;  1LOX A;  3KZT A;  2Z6B A;  1YJW 3;  1JB2 A;  2LQV A;  4N6T A;  1AVL A;  3D4A A;  3RGA A;  2Y74 A;  1A90 A;  1KC8 4;  1BIR A;  2K54 A;  1YIT 3;  1RGH A;  1O7G B;  5IG0 A;  3PZW A;  4I4K A;  1TIJ A;  1C7H A;  2WGO A;  3I0Y A;  1YGW A;  3KN4 A;  3LML A;  3LTA A;  1N5H A;  5BVB A;  3VGN A;  1JN5 B;  2HMO B;  2JQ5 A;  1ISK A;  3CCV 3;  5IER A;  1BNR A;  5KP1 A;  2XF3 A;  4OVM A;  3GZX B;  1G0T A;  2BNG A;  2KCD A;  3NV0 A;  4N3V A;  3KKG A;  4HZB B;  3PS8 A;  1NO3 A;  5DRV A;  1TTO A;  2WO0 A;  4XDW A;  1QAK A;  3HZP A;  4IT7 A;  1OHO A;  3D5I A;  1DVC A;  4FMC A;  1L5G B;  2QGU A;  4K90 B;  2BHM A;  4ORL A;  5CK6 A;  1UDI I;  3SYU A;  1NB3 I;  3LH4 A;  4XBX A;  5BIR A;  4KVH A;  3BB9 A;  3LT9 A;  1OF5 B;  1N8Q A;  2C11 A;  2CWU A;  4J8T A;  1D6U A;  1I2E A;  1TJD A;  4X2H A;  5BXQ A;  2P0M A;  3CC7 3;  4N6O B;  3CCJ 3;  1VQ5 3;  1BNI A;  2YFJ B;  2CG1 A;  1TFK A;  3FLJ A;  1W2B 2;  1I3I A;  2O9U X;  2QIY A;  1VQ8 3;  3URP A;  1GSP A; 
#chains in the Genus database with same CATH homology
 4MMX B;  1LXE A;  2OCT A;  3RGR A;  1Q81 4;  3NBR A;  1GY7 A;  4KFF A;  4R1K A;  5DRE A;  3X3Y A;  2CHC A;  2RFR A;  1IK3 A;  1FA3 A;  1QVF 2;  1OUN A;  2YFI B;  5IEO A;  3WDG B;  4JF8 A;  5JPP A;  3EF8 A;  4X2O A;  1M90 4;  2E2V A;  3EB8 A;  4K61 A;  3HK4 A;  1JKG B;  5IG5 A;  1IVU A;  1U5O A;  4N6V 0;  2PZV A;  1UW1 A;  1IVV A;  1W01 A;  4HVN A;  1JKG A;  2ML6 A;  2PNC A;  3MKI A;  1F8N A;  1RN7 A;  3F40 A;  3EC9 A;  2HMM B;  3N8B A;  3I56 3;  3X42 A;  2CC3 A;  4ZM8 A;  2CG0 A;  1YGE A;  1NU3 A;  3L0R A;  3NUV A;  3SVA A;  4HM1 B;  1TU5 A;  2ZDJ A;  1GD4 A;  1NDO B;  1OHP A;  3DY5 A;  3LXU X;  4HM2 B;  1IT7 A;  3S28 A;  4FCM A;  3J7Y d;  1QMA A;  3UL6 A;  3OWU A;  3F8H A;  2P05 A;  1D6Z A;  4HYZ A;  3ROB A;  2FGT A;  4O8S A;  1DYU A;  3IMA B;  1DMN A;  3NBJ A;  3NV0 B;  2XSO B;  2GEY A;  4HM6 B;  2IMJ A;  2RSX A;  3FF0 A;  4H61 A;  3BNE A;  5AYR B;  3WOF B;  1K73 4;  1O7M B;  1W6G A;  2XGL A;  3DGN A;  3F9S A;  3T8N A;  2OTL 3;  1RKY A;  4WHA A;  4K1V A;  1OAC A;  4AKY A;  2O3O A;  3LZA A;  2P0X A;  1N5P A;  4XBT A;  2E2U A;  5CLK A;  3CC2 3;  1J2B A;  3G16 A;  3S5C A;  5IG3 A;  4IPB A;  5JBS A;  1TUH A;  2M7O A;  3H51 A;  3CD6 3;  2W56 A;  5LC7 A;  3EBY A;  3PXM A;  5IG4 A;  3N54 B;  4O02 B;  1IQ8 A;  2RCD A;  4HM0 B;  3FGY A;  2GXF A;  3BLZ A;  1N9J A;  4LGQ A;  1U8C B;  2CFW A;  3EN1 B;  2BMR B;  3NQY A;  5D81 A;  1NWW A;  1O7W B;  2OOV A;  1OCV A;  2P38 A;  4HM7 B;  3T8U A;  2XH9 A;  3LTC A;  3BND A;  3HI7 A;  3N9H A;  1R4C A;  2CWV A;  1QAF A;  3FZW A;  3WA2 X;  4N6U A;  2MF7 A;  1ULI B;  1VQP 3;  2STD A;  5EQL A;  4EBG A;  1Q42 A;  1DVD A;  3U1W A;  1IV9 A;  2L4V A;  3A76 A;  1VQ9 3;  2XR8 B;  3LTD A;  3AMO B;  3QK9 A;  3B4O A;  3MWZ A;  4AEQ A;  2WGQ A;  1EA2 A;  2IUK A;  3CXC 2;  4WWU C;  5IEP A;  4N6M A;  3HII A;  1YI2 3;  1EQK A;  1MNL A;  1PU4 A;  3CCE 3;  2OTJ 3;  4FMD A;  3DMC A;  2B24 B;  4O2H A;  5D83 A;  3CPO A;  1FGO A;  2CFL A;  4Q53 A;  1VQM 3;  3FSD A;  5FGO A;  3G0K A;  2GBX B;  3GZR A;  5G2G A;  5JPU A;  2BMO B;  1ROV A;  4FCJ A;  3ALA A;  3MG1 A;  3SLU A;  5FW5 A;  4EC6 A;  1K8A 4;  1KD1 4;  1TP6 A;  2HML B;  3D9R A;  3JUO A;  4WYK A;  3VF1 A;  3ER7 A;  4FCZ A;  3BNB A;  3PCS A;  2IUJ A;  3SOA A;  3NBB A;  2HMN B;  3STD A;  3UB1 A;  3IJE B;  2QEX 3;  3BNC A;  1ASK A;  3WA3 A;  1N9E A;  3SX1 A;  5AIH A;  1S72 3;  2WOH A;  1FGT A;  4J9A A;  1UI8 A;  1JNQ A;  2CFD A;  3LYG A;  3S67 A;  1DMQ A;  3MHE A;  4R9K A;  2I9W A;  4FMB A;  3CNX A;  3M8C A;  2GBW B;  3JUN A;  1IV7 A;  1FUW A;  3F8X A;  1CYU A;  1WNH A;  1Q7Y 4;  1Q82 4;  4XBY A;  3O8Y A;  3GZB A;  3NXJ A;  2OQE C;  4TX4 A;  4N6L A;  1JB5 A;  3HIG A;  4L7K A;  4OK0 A;  8CHO A;  3CCM 3;  1D6Y A;  1YHQ 3;  4HKV B;  1N8R 4;  1ZX2 A;  4WFO A;  1OPY A;  2W0Q A;  2P09 A;  1W4N A;  3EE1 A;  3NHX A;  1FGQ A;  2XEP A;  1M9G A;  1ZO2 A;  3K9M C;  1ROA A;  3FG3 A;  3WMD A;  3FKA A;  2CWT A;  5AIF A;  2XGN A;  4QWT A;  3FF2 A;  4LEH A;  4GB5 A;  4L8P A;  2YFL B;  1OHS A;  3RDE A;  1GY6 A;  2BO9 B;  2HMK B;  5IW9 A;  2SBL A;  2W9P A;  4CCV A;  2W56 B;  5CF2 A;  1SJW A;  2BMQ B;  1QAL A;  3UNL A;  1RRH A;  4RNY A;  1NJI 4;  3CCU 3;  2K0M A;  3GAX A;  4XM4 A;  1S5A A;  3Q2P A;  3FCS B;  1KQS 2;  2XSH B;  4LZI A;  1E3V A;  3DGO A;  4LSO A;  3NQZ A;  3CNM A;  4EYC A;  1SIH A;  3NM2 A;  5IEN A;  3EX9 A;  3CCS 3;  3X3X A;  1IQX A;  2W6J H;  1GD3 A;  4HJL B;  2RGQ A;  1LNH A;  1GY5 A;  1MOL A;  3S29 A;  1SQW A;  3MSO A;  2KRT A;  5ELU A;  4L8O A;  5AYS C;  4EV5 A;  3PGB A;  1VQ4 3;  1W6C A;  3K7C A;  2D1W A;  3LTB A;  1WTH A;  1A2K A;  1E3R A;  3PCR A;  1PFP A;  6STD A;  3NX0 A;  3EHC A;  1W5Z A;  3CCL 3;  4XB5 A;  1HU9 A;  1V74 A;  1CQS A;  2W9Q A;  3GWR A;  3MG3 A;  1JJ2 2;  4STD A;  4RBN A;  3FG1 A;  2R4I A;  2CH9 A;  1IVW A;  1YJN 3;  1LVN A;  4R80 A;  3WOD G;  1FGM A;  3OX9 A;  3CU3 A;  4R4K A;  2GU3 A;  3KE7 A;  2CIU A;  3QRD A;  1JV2 B;  1JRQ A;  2A15 A;  2HMJ B;  4HBR A;  2Z7A A;  3MPH A;  3SOY A;  3DUK A;  1W6Y A;  1STF I;  4MEI A;  4NHF A;  3G8Z A;  1K41 A;  1KWI A;  3Q1C A;  1Y4K A;  4JRF A;  3VSY A;  5AI1 A;  3B4P A;  3TDG A;  5I97 A;  4HM5 B;  1M1K 4;  1KSI A;  3GZY B;  3X40 A;  4KFE A;  3DZL A;  4HM4 B;  1E97 A;  3OXA A;  3DXO A;  1Q40 B;  1W00 A;  3KII A;  1K28 A;  2V1L A;  2CK3 H;  2XFS A;  4MMY B;  2QA4 3;  5CF1 A;  3DM8 A;  3F7S A;  1Q86 4;  2ML5 A;  5KP4 A;  4RNZ A;  2D42 A;  4KZ1 A;  1M1X B;  3EQQ B;  3UJM A;  5EVH A;  4N6N B;  2F99 A;  2YX9 A;  3G6E 3;  1AVK A;  3FG4 A;  3CCQ 3;  3JUQ A;  5EEO A;  3X3Z A;  3GRD A;  1RJO A;  4OUQ A;  4EXR A;  4HM8 B;  1VQO 3;  1BUQ A;  1K9M 4;  3I55 3;  3SXX A;  1W2Z A;  3DGL A;  3EJV A;  1O7N B;  1A2V A;  2CFG A;  2BT3 A;  4H3U A;  2WOF A;  3DGM A;  3K63 A;  7STD A;  2OWP A;  1RRL A;  3WOE B;  5TGN A;  2UX0 A;  1WMN A;  1IVX A;  1VQ7 3;  1IT8 A;  3KSP A;  3CME 3;  1WMO A;  2F98 A;  4FR9 A;  4BTY A;  1Q40 A;  2FNQ A;  2GEX A;  2KXG A;  3T0U A;  3B7C A;  3MYT A;  1VQ6 3;  1GYB A;  1IQY A;  2JDI H;  3MG2 A;  3KSE D;  2Y73 A;  1HKX A;  1AV4 A;  4IIA A;  3CMA 3;  4HZ9 B;  4LMI A;  3F7X A;  2C10 A;  5D82 A;  5IF6 A;  1VQL 3;  2Z76 A;  3KFQ C;  3V92 A;  1IDP A;  3JUP A;  4HM3 B;  3UL5 A;  1T5Y A;  2W03 A;  4GL6 A;  3F14 A;  3NM7 A;  1SII A;  1US1 A;  3Q90 A;  2GU1 A;  3JVC A;  4G1M B;  3OWS A;  3K5T A;  4WYK B;  2INX A;  5CXO A;  5AEU B;  3G4S 3;  2LYX A;  1EG9 B;  5STD A;  1DMM A;  4XDV A;  3SED A;  2B1X B;  1VQK 3;  1A67 A;  5A0O B;  3G71 3;  1G96 A;  1Z1S A;  1IU7 A;  1OF5 A;  5ELJ A;  1JB4 A;  2W2C A;  2XFT A;  5AEW B;  1TFO A;  3K0Z A;  5KP3 A;  1WMP A;  3D3L A;  4BTW A;  1UUV B;  1GS3 A;  1CYV A;  1OGZ A;  2OQE A;  2FXT A;  3S27 A;  2Q07 A;  2IA7 A;  3PYJ A;  1UUW B;  1VQN 3;  1ULJ B;  3E99 A;  1FGR A;  4R9L A;  4RZM A;  5LC6 A;  1OH0 A;  1SPU A;  5AII A;  1O7H B;  4WP5 A;  2OOV C;  1OGX A;  4U13 A;  3B8L A;  2ZL8 A;  1W7C A;  3LT8 A;  3AMO A;  3HX8 A;  3LOY A;  3EBT A;  4MJD A;  1W02 A;  3H3H A;  4NRE A;  1JN5 A;  3FH1 A;  3X41 A;  2CFK A;  1UI7 A;  2MC8 A;  3V98 A;  1QJG A;  1AR0 A;  1VZZ A;  4PEJ A;  3CCR 3;  1YVB I;  3JUM A;  2XRX B;  2CW9 A;  2Z77 A;  3OV4 A;  1NB5 I;  4AKZ A;  4O3V A;  4FMA A;  3CPW 2;  1O7P B;  4KFD A;  1CEW I;  1EKM A;  3U97 A;  1QVG 2;  4CDL A;  1WQL B;  5AIG A;  1YJ9 3;  3IPT A;  3ECF A;  3V99 A;  3OW2 2;  4MMZ B;  4K1U A;  1STD A;  2W04 A;  3OWY A;  5HGR A;  3EN8 A;  2F86 B;  2CKF B;  2E2T A;  3CC4 3;  4BTX A;  1YIJ 3;  1LOX A;  3KZT A;  2Z6B A;  1YJW 3;  1JB2 A;  2LQV A;  4N6T A;  1AVL A;  3RGA A;  2Y74 A;  1A90 A;  1KC8 4;  2K54 A;  1YIT 3;  1O7G B;  5IG0 A;  3PZW A;  4I4K A;  1TIJ A;  1C7H A;  2WGO A;  3I0Y A;  3KN4 A;  3LML A;  3LTA A;  1N5H A;  5BVB A;  3VGN A;  1JN5 B;  2HMO B;  2JQ5 A;  1ISK A;  3CCV 3;  5IER A;  5KP1 A;  2XF3 A;  4OVM A;  3GZX B;  2BNG A;  2KCD A;  4N3V A;  3NV0 A;  3KKG A;  4HZB B;  3PS8 A;  1NO3 A;  5DRV A;  2WO0 A;  4XDW A;  1QAK A;  3HZP A;  4IT7 A;  1OHO A;  1DVC A;  4FMC A;  1L5G B;  2QGU A;  4K90 B;  2BHM A;  4ORL A;  5CK6 A;  1NB3 I;  3LH4 A;  4XBX A;  4KVH A;  3BB9 A;  3LT9 A;  1OF5 B;  1N8Q A;  2C11 A;  2CWU A;  4J8T A;  1D6U A;  4X2H A;  5BXQ A;  2P0M A;  3CC7 3;  4N6O B;  3CCJ 3;  1VQ5 3;  2CG1 A;  2YFJ B;  1W2B 2;  1TFK A;  3FLJ A;  2O9U X;  2QIY A;  1VQ8 3;  4EV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...