3CCV3

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ccv300
1NJI4 2OTJ3 1K734 1KC84 3CCL3 1K8A4 1VQK3 3CCR3 3CCM3 1Q864 1N8R4 3G4S3 1Q7Y4 1YIJ3 3OW22 1VQ63 3I553 1KQS2 1YJW3 1JJ22 3CPW2 1KD14 3CCE3 2OTL3 3CCJ3 1M904 1QVF2 3G6E3 1S723 1Q814 2QEX3 1VQ43 1VQP3 3G713 2QA43 1VQO3 1YJN3 3CCQ3 1VQ73 3CCU3 3CC23 3CC73 1K9M4 3CMA3 3CD63 1M1K4 1VQN3 1W2B2 3I563 1VQL3 3CME3 3CCV3 1Q824 1VQ53 1YI23 3CXC2 3CCS3 1YIT3 1QVG2 1VQ83 1VQM3 1YJ93 1VQ93 3CC43 1YHQ3
chains in the Genus database with same CATH superfamily
2KXGA 1MOLA 4U13A 1AVLA 2LYXA 4TX4A 3DGNA 1GOVA 3VSYA 1Q7Y4 5FW5A 4O8SA 3EF8A 4OUQA 4XBXA 3UL5A 1I2FA 1RGCA 3G0KA 5IEPA 3K5TA 4X2HA 3HOHA 2BIRA 4BTXA 3BB9A 2F99A 3EBYA 1M904 1RGGA 3G713 3Q90A 5CF2A 7GSPA 7RNTA 3EE1A 3NBJA 3FSDA 2XGLA 4K1VA 1GMQA 2H0HA 1IU7A 3GRDA 1LQMB 3K0ZA 1FZUA 2CKFB 2K0MA 3FF2A 3O8YA 3MWZA 2IY2A 3IPTA 1GD3A 5M18A 4I4KA 3UL6A 3WA3A 1M9GA 3FCSB 5G1KA 1Z1SA 1JN5B 1GD4A 3KSED 3WA2X 3CCL3 3CCR3 4MMYB 1ULJB 2GBWB 3EN8A 5EVHA 3CU3A 4EBGA 2P0XA 5LC6A 3EBTA 4EXRA 3I553 1ASKA 3JUMA 4N6OB 4FCZA 3CPW2 4KZ1A 1LNHA 1IVUA 1RN1A 3LTDA 2Z6BA 3NV0A 1I0XA 3Q3FA 1AR0A 2BNGA 4HZBB 1DETA 1JBSA 2P0MA 3LYGA 1AY7A 4HM8B 1HZ1A 1TRPA 2BT3A 1GY6A 3EX9A 4HYZA 9RNTA 3DZLA 3CCS3 1YGWA 5IG4A 1VQ83 4EV2A 1FGQA 2OCTA 5AEUB 2Z76A 4BTYA 3NV0B 1UCKA 2GBXB 4N6UA 1DVCA 3X41A 3GZRA 5IG3A 1MWUA 2ZA4A 1IQYA 1DMMA 2QIYA 4L7KA 2KF5A 1NU3A 2V1LA 3KCHA 2MF7A 1BSAA 2SBLA 2W2CA 1JB2A 4EW5A 1RLSA 5DRVA 1BNGA 1BRSA 1RMSA 5AEWB 3X3YA 3Q1CA 5CK6A 2CG1A 1G0TA 1QMAA 2BMQB 4HAAA 4LZIA 1NB5I 4X2OA 2GEXA 1BAOA 3T0UA 1RJOA 1W7CA 2KRTA 1JV2B 3FG1A 3EHCA 4K1UA 4R4KA 1OACA 4AKYA 1K8A4 2FXTA 2CX1A 4CJNA 3BNBA 1B2XA 3DH2A 4R9KA 1SPUA 1NB3I 5M19A 6STDA 3SX1A 5JPPA 4FMAA 1UCLA 3S28A 3WOFB 2KF3A 1K41A 4FR9A 1RNTA 1GSPA 1I2GA 1EQKA 1UUVB 1OHPA 5CF1A 1TIJA 4N6V0 2CFKA 2KF6A 8CHOA 2XRXB 5JBSA 2K54A 4K61A 3ZFZA 1M1K4 4JRFA 1TU5A 2ZL8A 4XB5A 3UNLA 4DKIA 3I563 1QAFA 1Q824 2BMRB 1RN4A 1B21A 1I70A 4MMZB 3S67A 3D9RA 5AIGA 5D83A 2ZDJA 5G1LA 2Z77A 1OPYA 3OWYA 4KFEA 3SOYA 4J9AA 1MWRA 2WGQA 3NBRA 3GSPA 1BU4A 1RNBA 3MPHA 3KSPA 2Z7AA 3B4OA 5TGNA 2OQEC 1KQS2 1QJGA 4ZM8A 1JNQA 2ML5A 3EC9A 4WYKA 2XFTA 2KCDA 2BMOB 2YFIB 4RNYA 4HZ9B 2W0QA 2BHMA 1R4CA 8RNTA 1JZOA 2GU3A 1VQ43 4QWTA 1TJDA 5DREA 2H0GA 1VQN3 1IVXA 1CQSA 3AHWA 2D42A 1OH0A 1YI23 1EEJA 1OGZA 2CK3H 2XSOB 3OWUA 3PCRA 1T5YA 1STFI 1EG9B 2GSPA 1Q40B 3F7SA 4HM1B 4R1KA 5BXQA 4O2HA 3J7Yd 4WYKB 3PXMA 3CNMA 4FMDA 3LT8A 4NHFA 3LMLA 1BNSA 2HMOB 1BOXA 1GMRA 2BU4A 2CFGA 3PYJA 2JDIH 2XH9A 1VQ63 1N9JA 2UX0A 4EV5A 1BSEA 1IQXA 4RNZA 3URPA 3RGAA 1E3VA 2RNTA 2HMJB 4HM2B 1YJN3 1RCKA 2CFLA 2R4IA 1Q42A 1KSIA 3EB8A 2OOVC 1DE3A 3L0RA 3ZG5A 2IUJA 4RZMA 3QRDA 2H0IA 1TFOA 3N8BA 2KAAA 1I3FA 4KVHA 5D82A 1QVG2 3RGRA 3GZXB 4I5QA 1B2SA 4LSOA 2F5MA 3K7CA 1UUWB 1MGWA 1C54A 1JB4A 2IUKA 3D3LA 1BIRA 1V74A 3FG4A 1JRQA 1VQK3 2W56A 3JUOA 3CCM3 1OF5A 3LH4A 1MNLA 4IPBA 1R4YA 3BLZA 1BRJA 2C10A 2RGQA 1OGXA 1X1UA 3G8ZA 4J5KA 3F8XA 4AKZA 3BIRA 4N6LA 2W04A 2B24B 1UW1A 4N6NB 3BNDA 3IJEB 1V58A 5A0OB 1BRKA 3A76A 1BNJA 1SARA 2W56B 1ZS7A 3DXOA 1D6YA 5AYSC 1I3IA 1G02A 1OF5B 1LRAA 1W6CA 3LT9A 4FMBA 3AMOA 1MGRA 1ISKA 1WQLB 3H51A 2M7OA 4K90B 5AI1A 3WHOA 1VQ93 1A2KA 3MKIA 2B1XB 5I97A 1YHQ3 2E2UA 2XSHB 4LEHA 1A67A 3S5CA 1KC84 2F5WA 3JUPA 3PS8A 3VGNA 1Q864 3WDGB 4J5GA 1L5GB 4HVNA 3OV4A 1FGOA 2HOHA 3F40A 1WTHA 1OHSA 3F8HA 4MMXB 1CH0A 4G1MB 3LTBA 1GMPA 1IYYA 1TP6A 1WMOA 3CCJ3 4L8OA 4R9LA 3SOAA 3G6E3 1B2MA 3D79A 3HX8A 1OHOA 1UUGB 3ALAA 1W6GA 4HM6B 3CC23 3V92A 3QK9A 1HU9A 2XGNA 2CX0A 2R41A 1K28A 3MYTA 1LVNA 2YX9A 1V57A 3U1WA 1SIIA 3NBBA 1M1XB 1ROVA 2C4BA 1RGKA 1S5AA 2FNQA 2WOHA 5IEOA 3X3XA 3ZG0A 1YJ93 2Y73A 1W6YA 3GAXA 1DMNA 3AGOA 1RGFA 3OXAA 2WO0A 1Q7HA 1TUHA 5ELJA 1MWSA 1DMQA 1FGMA 4MJDA 1I0VA 1IT7A 3HI7A 5AIHA 1RSNA 1T3BA 1LOXA 3DGMA 3NM7A 4ORLA 1YJW3 1D6UA 1EA2A 1US1A 3I0YA 1OCVA 1KD14 3OX9A 1BSDA 3X42A 3KZTA 3BNCA 1EUIC 1O7MB 1LOYA 1FUSA 3FF0A 3GZBA 1B2ZA 3V99A 3PCSA 4O02B 4EYCA 1FA3A 2D1WA 1TTOA 3EQQB 3CCV3 1VQ53 3EN1B 2CWVA 2XR8B 2F98A 3UJMA 1BNIA 1RDSA 3HIGA 2O9UX 3PZWA 4HBRA 5D81A 5M1AA 4ILFA 3H3HA 3JVCA 3A5EA 4LMIA 1Q9EA 1LXEA 3FKAA 2XF3A 3OW22 3MG1A 3X3ZA 3PGBA 1YNVX 1JJ22 1NDOB 2W6JH 3KE7A 3NQYA 1W02A 3CCE3 4LGQA 4STDA 6RNTA 3FLJA 1WNHA 1S723 3KFQC 4NPBA 1FW7A 1GS3A 3CCQ3 3LTCA 3CCU3 3CNXA 3CC73 1BUQA 3B8LA 4CPKA 5LC7A 6GSPA 3GZYB 3S29A 2XEPA 1HKXA 1T2IA 1Y4KA 1PFPA 3B7CA 1WMPA 2QGUA 3MSOA 3UB1A 1YVBI 5KP3A 1BNFA 1FGRA 1U8CB 3D5GA 4HKVB 5BU4A 5AIFA 2CG0A 1JBRA 3JUQA 1W2ZA 1BANA 2FGTA 2P09A 1B20A 1B27A 1O7PB 5IERA 4BL2A 1PU4A 3JUNA 3K9MC 1TFKA 4H61A 1DYUA 2HMMB 4WHAA 4CCVA 1UI7A 3DGOA 3F14A 2XFSA 3B4PA 4BL3A 1HYFA 2JQ5A 1O7WB 4BIRA 1BSBA 1OUNA 2HMLB 3VF1A 1VQ73 3CMA3 1BNRA 3T8NA 5ELUA 1O7HB 4XBYA 2PZVA 3BNEA 3FH1A 1CEWI 3N9HA 4JF8A 4IT7A 3HIIA 1UI8A 3NXJA 4FCMA 3DM8A 3ER7A 1G96A 2LQVA 5HOHA 3N54B 2F4YA 1FGTA 4N6MA 3IMAB 4XBTA 3KKGA 3SLUA 2IMJA 1FUWA 2STDA 2UUGC 5KP1A 1YIJ3 2P38A 2RFRA 3DY5A 4FCJA 3FG3A 4HM3B 2IYJA 2CFWA 1ZX2A 2KF4A 2WOFA 4HM4B 1JN5A 3FZWA 1I2EA 1UCJA 2ZHXB 5EQLA 2OTL3 1N5PA 2IA7A 4GHOA 3STDA 4NREA 1BRGA 5STDA 5IENA 1JBTA 3LZAA 2HMNB 1TRQA 1UDII 1LNIA 2AADA 1GYBA 1RGAA 2CWTA 4XDWA 1W5ZA 1ROAA 4CDLA 2YFLB 1U5OA 4H3UA 1W00A 1MWTA 1B2UA 3ROBA 1FUTA 3BU4A 2MC8A 2I9WA 3CPOA 1VQM3 1IV9A 2OWPA 4O3VA 5AYRB 1IV7A 3OWSA 3WODG 2OQEA 1T2HA 3LXUX 1RRLA 4KFFA 1EKMA 3SEDA 4FMCA 3TDGA 3KIIA 4GSPA 2AAEA 3D4AA 1BUJA 2Y74A 3LTAA 4XDVA 3HZPA 3RDEA 3DUKA 5IG0A 1W4NA 1VQQA 3AMOB 4GB5A 4HJLB 2ML6A 1NNVA 3DGYA 1VQP3 3E99A 5HGRA 1GY5A 1RN7A 1SQWA 2PNCA 5AIIA 4IIAA 3DMCA 2W9PA 4WP5A 1RGHA 7STDA 1LOWA 1E97A 1YVSA 2YFJB 3MHEA 1VQL3 1N9EA 1KWIA 4HM7B 3MG3A 4LYLB 1D6ZA 2CC3A 4GL6A 5IF6A 1QALA 2L1SA 5CLKA 1I8VA 2CH9A 4MEIA 3CC43 4N3VA 4WFOA 1RRHA 1FYSA 3AGNA 5CXOA 3V98A 3WOEB 1RKYA 4WWUC 1UGHI 4KT3B 1STDA 3M8CA 1N8QA 1AVKA 1B3SA 1JB5A 4RNTA 1F8NA 1GOYA 2CIUA 1UGIA 3FGYA 1CYVA 1IQ8A 2E2VA 2K3DA 2GXFA 3G16A 4R80A 3SVAA 3K63A 1CYUA 1O7GB 2OOVA 1X1YA 1PY3A 4J8TA 4PEJA 4BU4A 2QA43 5EEOA 3AHSA 4XM4A 2O3OA 1GOUA 1W01A 1BRIA 2HMKB 3WMDA 5RNTA 3CD63 3X40A 1A90A 4OVMA 1VZZA 1RGLA 3KN4A 4AEQA 1ZO2A 1ZGXA 1YIT3 1QAKA 1JZDA 2GEYA 3EJVA 3NQZA 2GU1A 1J2BA 3ECFA 1IDPA 3NM2A 2Q07A 1K734 2INXA 3WR2A 3MG2A 3NHXA 1BRHA 1SJWA 5KP4A 3RNTA 3D5IA 1WMNA 1E3RA 2RBIA 1ULIB 2F56A 2RSXA 2RCDA 3GWRA 2W03A 1RGEA 2A15A 4OK0A 1QVF2 3U97A 1X1XA 2SARA 4RBNA 1Q814 1VQO3 5BIRA 1RHLA 1K9M4 2CHCA 1JKGA 1SIHA 1RCLA 1A2VA 1W2B2 5GSPA 4N6TA 4HOHA 1X1WA 2J8XB 3CXC2 1LOVA 2WGOA 2CFDA 1YGEA 1GY7A 1DVDA 3F7XA 2F86B 3F9SA 4KFDA 5G2GA 1BVIA 1NJI4 3DGLA 3S27A 3SXXA 1IT8A 2OTJ3 1O7NB 5IW9A 1AV4A 1BGSA 1N8R4 3G4S3 1N5HA 1IVVA 2C11A 5BVBA 4EC6A 1BSCA 1JKGB 2CWUA 1A2PA 1PYLA 4L8PA 1Q40A 1IK3A 4HM5B 3NX0A 1UCIA 5FGOA 3NUVA 2CW9A 2W9QA 2BO9B 2QEX3 1BNEA 1NWWA 1RTUA 1C7HA 2P05A 4HM0B 3LOYA 3SYUA 4Q53A 3HK4A 2E2TA 2L4VA 3CME3 5IG5A 1AQZA 1NO3A 1BRNL 1IVWA 2UGIA 5JPUA 4BTWA 3T8UA 1LQGC 3Q2PA
chains in the Genus database with same CATH topology
2KXGA 1MOLA 4U13A 1AVLA 2LYXA 4TX4A 3DGNA 3VSYA 1Q7Y4 5FW5A 4O8SA 3EF8A 4OUQA 4XBXA 3UL5A 5IEPA 3G0KA 3K5TA 4X2HA 4BTXA 3BB9A 2F99A 3EBYA 1M904 3G713 3Q90A 5CF2A 3EE1A 3NBJA 3FSDA 2XGLA 4K1VA 1IU7A 3GRDA 3K0ZA 2CKFB 2K0MA 3FF2A 3O8YA 3MWZA 3IPTA 1GD3A 4I4KA 3UL6A 3WA3A 1M9GA 3FCSB 1Z1SA 1JN5B 1GD4A 3KSED 3WA2X 3CCL3 3CCR3 4MMYB 1ULJB 2GBWB 3EN8A 5EVHA 3CU3A 4EBGA 2P0XA 5LC6A 3EBTA 4EXRA 3I553 1ASKA 3JUMA 4N6OB 4FCZA 3CPW2 4KZ1A 1LNHA 1IVUA 3LTDA 2Z6BA 3NV0A 1AR0A 2BNGA 4HZBB 2P0MA 3LYGA 4HM8B 2BT3A 1GY6A 3EX9A 4HYZA 3DZLA 3CCS3 5IG4A 1VQ83 4EV2A 1FGQA 2OCTA 5AEUB 2Z76A 4BTYA 3NV0B 2GBXB 4N6UA 1DVCA 3X41A 3GZRA 5IG3A 1IQYA 1DMMA 2QIYA 4L7KA 1NU3A 2V1LA 2MF7A 2SBLA 2W2CA 1JB2A 5DRVA 5AEWB 3X3YA 3Q1CA 5CK6A 2CG1A 1QMAA 2BMQB 1NB5I 4LZIA 4X2OA 2GEXA 3T0UA 1RJOA 1W7CA 2KRTA 1JV2B 3FG1A 3EHCA 4K1UA 4R4KA 1OACA 4AKYA 1K8A4 2FXTA 3BNBA 4R9KA 1SPUA 1NB3I 6STDA 3SX1A 5JPPA 4FMAA 3S28A 3WOFB 1K41A 4FR9A 1EQKA 1UUVB 1OHPA 5CF1A 1TIJA 4N6V0 2CFKA 5JBSA 8CHOA 2XRXB 2K54A 4K61A 1M1K4 4JRFA 1TU5A 2ZL8A 4XB5A 3UNLA 3I563 1QAFA 1Q824 2BMRB 4MMZB 3S67A 3D9RA 5AIGA 5D83A 2ZDJA 2Z77A 1OPYA 3OWYA 4KFEA 3SOYA 4J9AA 2WGQA 3NBRA 3MPHA 3KSPA 2Z7AA 3B4OA 5TGNA 2OQEC 1KQS2 1QJGA 4ZM8A 1JNQA 2ML5A 3EC9A 4WYKA 2XFTA 2KCDA 2BMOB 2YFIB 4RNYA 4HZ9B 2W0QA 2BHMA 1R4CA 2GU3A 4QWTA 5DREA 1VQN3 1IVXA 1CQSA 2D42A 1OH0A 1YI23 3OWUA 1OGZA 2CK3H 2XSOB 3PCRA 1T5YA 1STFI 1EG9B 1Q40B 3F7SA 4HM1B 4R1KA 5BXQA 4O2HA 3J7Yd 4WYKB 3PXMA 3CNMA 4FMDA 3LT8A 4NHFA 3LMLA 2HMOB 2CFGA 3PYJA 2JDIH 2XH9A 1VQ63 1N9JA 2UX0A 4EV5A 1IQXA 4RNZA 3RGAA 1E3VA 2HMJB 4HM2B 1YJN3 2CFLA 2R4IA 1Q42A 1KSIA 3EB8A 2OOVC 3L0RA 2IUJA 4RZMA 3QRDA 1TFOA 3N8BA 4KVHA 5D82A 1QVG2 3RGRA 3GZXB 4LSOA 3K7CA 1UUWB 1JB4A 2IUKA 3D3LA 1V74A 3FG4A 1JRQA 1VQK3 2W56A 3JUOA 3CCM3 1OF5A 3LH4A 1MNLA 4IPBA 3BLZA 2C10A 2RGQA 1OGXA 3G8ZA 3F8XA 4AKZA 4N6LA 2W04A 2B24B 1UW1A 4N6NB 3BNDA 3IJEB 5A0OB 3A76A 2W56B 3DXOA 1D6YA 5AYSC 1OF5B 3LT9A 1W6CA 4FMBA 3AMOA 1ISKA 1WQLB 3H51A 2M7OA 4K90B 5AI1A 1VQ93 1A2KA 3MKIA 2B1XB 5I97A 1YHQ3 2E2UA 2XSHB 4LEHA 1A67A 3S5CA 1KC84 3JUPA 3PS8A 3VGNA 1Q864 3WDGB 1L5GB 4HVNA 3OV4A 1FGOA 3F40A 3F8HA 1WTHA 1OHSA 4MMXB 4G1MB 3LTBA 1TP6A 1WMOA 3CCJ3 4L8OA 4R9LA 3SOAA 3G6E3 3HX8A 1OHOA 3ALAA 1W6GA 4HM6B 3CC23 3V92A 3QK9A 1HU9A 2XGNA 1K28A 3MYTA 1LVNA 2YX9A 3U1WA 1SIIA 3NBBA 1M1XB 1ROVA 2FNQA 5IEOA 1S5AA 2WOHA 3X3XA 1YJ93 2Y73A 1W6YA 3GAXA 1DMNA 3OXAA 2WO0A 1TUHA 5ELJA 1DMQA 1FGMA 4MJDA 1IT7A 3HI7A 5AIHA 3DGMA 3NM7A 1LOXA 1YJW3 4ORLA 1D6UA 1EA2A 1US1A 3I0YA 1OCVA 1KD14 3OX9A 3X42A 3KZTA 3BNCA 1O7MB 3FF0A 3GZBA 4EYCA 3V99A 3PCSA 4O02B 1FA3A 2D1WA 3EQQB 3CCV3 1VQ53 3EN1B 2CWVA 2XR8B 2F98A 3UJMA 3HIGA 2O9UX 3PZWA 4HBRA 5D81A 3H3HA 3JVCA 4LMIA 3OW22 1LXEA 3FKAA 2XF3A 3MG1A 3X3ZA 3PGBA 1JJ22 1NDOB 2W6JH 3KE7A 3NQYA 1W02A 3CCE3 4LGQA 4STDA 3FLJA 1WNHA 1S723 3KFQC 1GS3A 3CCQ3 3LTCA 3CCU3 3CNXA 3CC73 1BUQA 3B8LA 5LC7A 3GZYB 3S29A 2XEPA 1HKXA 1Y4KA 3B7CA 1PFPA 1WMPA 2QGUA 3MSOA 3UB1A 1YVBI 5KP3A 1FGRA 1U8CB 4HKVB 5AIFA 2CG0A 3JUQA 1W2ZA 2FGTA 2P09A 1O7PB 5IERA 1PU4A 3JUNA 3K9MC 1TFKA 4H61A 1DYUA 2HMMB 4WHAA 4CCVA 1UI7A 3DGOA 3F14A 2XFSA 3B4PA 2JQ5A 1O7WB 1VQ73 1OUNA 2HMLB 3VF1A 3CMA3 3T8NA 5ELUA 1O7HB 4XBYA 2PZVA 3BNEA 3FH1A 1CEWI 3N9HA 4JF8A 4IT7A 3HIIA 1UI8A 3NXJA 4FCMA 3DM8A 3ER7A 1G96A 2LQVA 3N54B 1FGTA 4N6MA 3IMAB 4XBTA 3KKGA 3SLUA 2IMJA 1FUWA 2STDA 5KP1A 1YIJ3 2RFRA 3DY5A 4FCJA 3FG3A 4HM3B 2CFWA 1ZX2A 2WOFA 4HM4B 1JN5A 3FZWA 2OTL3 5EQLA 1N5PA 2IA7A 3STDA 5IENA 4NREA 5STDA 3LZAA 2HMNB 1GYBA 4XDWA 2CWTA 1W5ZA 1ROAA 4CDLA 2YFLB 1U5OA 4H3UA 1W00A 3ROBA 2MC8A 2I9WA 3CPOA 1VQM3 1IV9A 2OWPA 4O3VA 5AYRB 1IV7A 3OWSA 3WODG 2OQEA 3LXUX 1RRLA 4KFFA 1EKMA 3SEDA 4FMCA 3TDGA 3KIIA 2Y74A 3LTAA 4XDVA 3HZPA 3RDEA 3DUKA 5IG0A 1W4NA 3AMOB 4GB5A 4HJLB 2ML6A 1VQP3 1VQ43 3E99A 5HGRA 1GY5A 1RN7A 1SQWA 2PNCA 5AIIA 4IIAA 3DMCA 2W9PA 4WP5A 7STDA 1E97A 3MHEA 2YFJB 1VQL3 1N9EA 1KWIA 4HM7B 3MG3A 1D6ZA 2CC3A 4GL6A 5IF6A 1QALA 5CLKA 2CH9A 4MEIA 3CC43 4N3VA 4WFOA 1RRHA 5CXOA 3V98A 3WOEB 1RKYA 4WWUC 1STDA 3M8CA 1N8QA 1AVKA 1JB5A 1F8NA 2CIUA 3FGYA 1CYVA 1IQ8A 2E2VA 2GXFA 3G16A 4R80A 3SVAA 3K63A 1CYUA 1O7GB 2OOVA 4J8TA 4PEJA 2QA43 5EEOA 4XM4A 2O3OA 1W01A 3WMDA 2HMKB 1A90A 3CD63 3X40A 4OVMA 1VZZA 3KN4A 4AEQA 1ZO2A 1YIT3 1QAKA 2GEYA 3EJVA 3NQZA 2GU1A 1J2BA 3ECFA 1IDPA 3NM2A 2Q07A 1K734 2INXA 3MG2A 3NHXA 1SJWA 5KP4A 1WMNA 1E3RA 1ULIB 2RSXA 2RCDA 3GWRA 2W03A 2A15A 4OK0A 1QVF2 3U97A 4RBNA 1Q814 1VQO3 1K9M4 2CHCA 1JKGA 1SIHA 1A2VA 1W2B2 4N6TA 3CXC2 2WGOA 2CFDA 1YGEA 1GY7A 1DVDA 3F7XA 2F86B 3F9SA 4KFDA 5G2GA 1NJI4 3DGLA 3S27A 3SXXA 1IT8A 2OTJ3 1O7NB 5IW9A 1AV4A 1N8R4 3G4S3 1N5HA 1IVVA 2C11A 5BVBA 4EC6A 1JKGB 2CWUA 4L8PA 1IK3A 1Q40A 4HM5B 3NX0A 5FGOA 3NUVA 2CW9A 2W9QA 2BO9B 2QEX3 1NWWA 1C7HA 2P05A 4HM0B 3LOYA 4Q53A 3HK4A 2E2TA 2L4VA 3CME3 5IG5A 1NO3A 1IVWA 5JPUA 4BTWA 3T8UA 2P38A 3Q2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJI 4;  2OTJ 3;  1K73 4;  1KC8 4;  3CCL 3;  1K8A 4;  1VQK 3;  3CCR 3;  3CCM 3;  1Q86 4;  1N8R 4;  3G4S 3;  1Q7Y 4;  1YIJ 3;  3OW2 2;  1VQ6 3;  3I55 3;  1KQS 2;  1YJW 3;  1JJ2 2;  3CPW 2;  1KD1 4;  3CCE 3;  2OTL 3;  3CCJ 3;  1M90 4;  1QVF 2;  3G6E 3;  1S72 3;  1Q81 4;  2QEX 3;  1VQ4 3;  1VQP 3;  3G71 3;  2QA4 3;  1VQO 3;  1YJN 3;  3CCQ 3;  1VQ7 3;  3CCU 3;  3CC2 3;  3CC7 3;  1K9M 4;  3CMA 3;  3CD6 3;  1M1K 4;  1VQN 3;  1W2B 2;  3I56 3;  1VQL 3;  3CME 3;  3CCV 3;  1Q82 4;  1VQ5 3;  1YI2 3;  3CXC 2;  3CCS 3;  1YIT 3;  1QVG 2;  1VQ8 3;  1VQM 3;  1YJ9 3;  1VQ9 3;  3CC4 3;  1YHQ 3; 
#chains in the Genus database with same CATH topology
 2KXG A;  1MOL A;  4U13 A;  1AVL A;  2LYX A;  4TX4 A;  3DGN A;  1GOV A;  3VSY A;  1Q7Y 4;  5FW5 A;  4O8S A;  3EF8 A;  4OUQ A;  4XBX A;  3UL5 A;  1I2F A;  1RGC A;  3G0K A;  5IEP A;  3K5T A;  4X2H A;  3HOH A;  2BIR A;  4BTX A;  3BB9 A;  2F99 A;  3EBY A;  1M90 4;  1RGG A;  3G71 3;  3Q90 A;  5CF2 A;  7GSP A;  7RNT A;  3EE1 A;  3NBJ A;  3FSD A;  2XGL A;  4K1V A;  1GMQ A;  2H0H A;  1IU7 A;  3GRD A;  1LQM B;  3K0Z A;  1FZU A;  2CKF B;  2K0M A;  3FF2 A;  3O8Y A;  3MWZ A;  2IY2 A;  3IPT A;  1GD3 A;  5M18 A;  4I4K A;  3UL6 A;  3WA3 A;  1M9G A;  3FCS B;  5G1K A;  1Z1S A;  1JN5 B;  1GD4 A;  3KSE D;  3WA2 X;  3CCL 3;  3CCR 3;  4MMY B;  1ULJ B;  2GBW B;  3EN8 A;  5EVH A;  3CU3 A;  4EBG A;  2P0X A;  5LC6 A;  3EBT A;  4EXR A;  3I55 3;  1ASK A;  3JUM A;  4N6O B;  4FCZ A;  3CPW 2;  4KZ1 A;  1LNH A;  1IVU A;  1RN1 A;  3LTD A;  2Z6B A;  3NV0 A;  1I0X A;  3Q3F A;  1AR0 A;  2BNG A;  4HZB B;  1DET A;  1JBS A;  2P0M A;  3LYG A;  1AY7 A;  4HM8 B;  1HZ1 A;  1TRP A;  2BT3 A;  1GY6 A;  3EX9 A;  4HYZ A;  9RNT A;  3DZL A;  3CCS 3;  1YGW A;  5IG4 A;  1VQ8 3;  4EV2 A;  1FGQ A;  2OCT A;  5AEU B;  2Z76 A;  4BTY A;  3NV0 B;  1UCK A;  2GBX B;  4N6U A;  1DVC A;  3X41 A;  3GZR A;  5IG3 A;  1MWU A;  2ZA4 A;  1IQY A;  1DMM A;  2QIY A;  4L7K A;  2KF5 A;  1NU3 A;  2V1L A;  3KCH A;  2MF7 A;  1BSA A;  2SBL A;  2W2C A;  1JB2 A;  4EW5 A;  1RLS A;  5DRV A;  1BNG A;  1BRS A;  1RMS A;  5AEW B;  3X3Y A;  3Q1C A;  5CK6 A;  2CG1 A;  1G0T A;  1QMA A;  2BMQ B;  4HAA A;  4LZI A;  1NB5 I;  4X2O A;  2GEX A;  1BAO A;  3T0U A;  1RJO A;  1W7C A;  2KRT A;  1JV2 B;  3FG1 A;  3EHC A;  4K1U A;  4R4K A;  1OAC A;  4AKY A;  1K8A 4;  2FXT A;  2CX1 A;  4CJN A;  3BNB A;  1B2X A;  3DH2 A;  4R9K A;  1SPU A;  1NB3 I;  5M19 A;  6STD A;  3SX1 A;  5JPP A;  4FMA A;  1UCL A;  3S28 A;  3WOF B;  2KF3 A;  1K41 A;  4FR9 A;  1RNT A;  1GSP A;  1I2G A;  1EQK A;  1UUV B;  1OHP A;  5CF1 A;  1TIJ A;  4N6V 0;  2CFK A;  2KF6 A;  8CHO A;  2XRX B;  5JBS A;  2K54 A;  4K61 A;  3ZFZ A;  1M1K 4;  4JRF A;  1TU5 A;  2ZL8 A;  4XB5 A;  3UNL A;  4DKI A;  3I56 3;  1QAF A;  1Q82 4;  2BMR B;  1RN4 A;  1B21 A;  1I70 A;  4MMZ B;  3S67 A;  3D9R A;  5AIG A;  5D83 A;  2ZDJ A;  5G1L A;  2Z77 A;  1OPY A;  3OWY A;  4KFE A;  3SOY A;  4J9A A;  1MWR A;  2WGQ A;  3NBR A;  3GSP A;  1BU4 A;  1RNB A;  3MPH A;  3KSP A;  2Z7A A;  3B4O A;  5TGN A;  2OQE C;  1KQS 2;  1QJG A;  4ZM8 A;  1JNQ A;  2ML5 A;  3EC9 A;  4WYK A;  2XFT A;  2KCD A;  2BMO B;  2YFI B;  4RNY A;  4HZ9 B;  2W0Q A;  2BHM A;  1R4C A;  8RNT A;  1JZO A;  2GU3 A;  1VQ4 3;  4QWT A;  1TJD A;  5DRE A;  2H0G A;  1VQN 3;  1IVX A;  1CQS A;  3AHW A;  2D42 A;  1OH0 A;  1YI2 3;  1EEJ A;  1OGZ A;  2CK3 H;  2XSO B;  3OWU A;  3PCR A;  1T5Y A;  1STF I;  1EG9 B;  2GSP A;  1Q40 B;  3F7S A;  4HM1 B;  4R1K A;  5BXQ A;  4O2H A;  3J7Y d;  4WYK B;  3PXM A;  3CNM A;  4FMD A;  3LT8 A;  4NHF A;  3LML A;  1BNS A;  2HMO B;  1BOX A;  1GMR A;  2BU4 A;  2CFG A;  3PYJ A;  2JDI H;  2XH9 A;  1VQ6 3;  1N9J A;  2UX0 A;  4EV5 A;  1BSE A;  1IQX A;  4RNZ A;  3URP A;  3RGA A;  1E3V A;  2RNT A;  2HMJ B;  4HM2 B;  1YJN 3;  1RCK A;  2CFL A;  2R4I A;  1Q42 A;  1KSI A;  3EB8 A;  2OOV C;  1DE3 A;  3L0R A;  3ZG5 A;  2IUJ A;  4RZM A;  3QRD A;  2H0I A;  1TFO A;  3N8B A;  2KAA A;  1I3F A;  4KVH A;  5D82 A;  1QVG 2;  3RGR A;  3GZX B;  4I5Q A;  1B2S A;  4LSO A;  2F5M A;  3K7C A;  1UUW B;  1MGW A;  1C54 A;  1JB4 A;  2IUK A;  3D3L A;  1BIR A;  1V74 A;  3FG4 A;  1JRQ A;  1VQK 3;  2W56 A;  3JUO A;  3CCM 3;  1OF5 A;  3LH4 A;  1MNL A;  4IPB A;  1R4Y A;  3BLZ A;  1BRJ A;  2C10 A;  2RGQ A;  1OGX A;  1X1U A;  3G8Z A;  4J5K A;  3F8X A;  4AKZ A;  3BIR A;  4N6L A;  2W04 A;  2B24 B;  1UW1 A;  4N6N B;  3BND A;  3IJE B;  1V58 A;  5A0O B;  1BRK A;  3A76 A;  1BNJ A;  1SAR A;  2W56 B;  1ZS7 A;  3DXO A;  1D6Y A;  5AYS C;  1I3I A;  1G02 A;  1OF5 B;  1LRA A;  1W6C A;  3LT9 A;  4FMB A;  3AMO A;  1MGR A;  1ISK A;  1WQL B;  3H51 A;  2M7O A;  4K90 B;  5AI1 A;  3WHO A;  1VQ9 3;  1A2K A;  3MKI A;  2B1X B;  5I97 A;  1YHQ 3;  2E2U A;  2XSH B;  4LEH A;  1A67 A;  3S5C A;  1KC8 4;  2F5W A;  3JUP A;  3PS8 A;  3VGN A;  1Q86 4;  3WDG B;  4J5G A;  1L5G B;  4HVN A;  3OV4 A;  1FGO A;  2HOH A;  3F40 A;  1WTH A;  1OHS A;  3F8H A;  4MMX B;  1CH0 A;  4G1M B;  3LTB A;  1GMP A;  1IYY A;  1TP6 A;  1WMO A;  3CCJ 3;  4L8O A;  4R9L A;  3SOA A;  3G6E 3;  1B2M A;  3D79 A;  3HX8 A;  1OHO A;  1UUG B;  3ALA A;  1W6G A;  4HM6 B;  3CC2 3;  3V92 A;  3QK9 A;  1HU9 A;  2XGN A;  2CX0 A;  2R41 A;  1K28 A;  3MYT A;  1LVN A;  2YX9 A;  1V57 A;  3U1W A;  1SII A;  3NBB A;  1M1X B;  1ROV A;  2C4B A;  1RGK A;  1S5A A;  2FNQ A;  2WOH A;  5IEO A;  3X3X A;  3ZG0 A;  1YJ9 3;  2Y73 A;  1W6Y A;  3GAX A;  1DMN A;  3AGO A;  1RGF A;  3OXA A;  2WO0 A;  1Q7H A;  1TUH A;  5ELJ A;  1MWS A;  1DMQ A;  1FGM A;  4MJD A;  1I0V A;  1IT7 A;  3HI7 A;  5AIH A;  1RSN A;  1T3B A;  1LOX A;  3DGM A;  3NM7 A;  4ORL A;  1YJW 3;  1D6U A;  1EA2 A;  1US1 A;  3I0Y A;  1OCV A;  1KD1 4;  3OX9 A;  1BSD A;  3X42 A;  3KZT A;  3BNC A;  1EUI C;  1O7M B;  1LOY A;  1FUS A;  3FF0 A;  3GZB A;  1B2Z A;  3V99 A;  3PCS A;  4O02 B;  4EYC A;  1FA3 A;  2D1W A;  1TTO A;  3EQQ B;  3CCV 3;  1VQ5 3;  3EN1 B;  2CWV A;  2XR8 B;  2F98 A;  3UJM A;  1BNI A;  1RDS A;  3HIG A;  2O9U X;  3PZW A;  4HBR A;  5D81 A;  5M1A A;  4ILF A;  3H3H A;  3JVC A;  3A5E A;  4LMI A;  1Q9E A;  1LXE A;  3FKA A;  2XF3 A;  3OW2 2;  3MG1 A;  3X3Z A;  3PGB A;  1YNV X;  1JJ2 2;  1NDO B;  2W6J H;  3KE7 A;  3NQY A;  1W02 A;  3CCE 3;  4LGQ A;  4STD A;  6RNT A;  3FLJ A;  1WNH A;  1S72 3;  3KFQ C;  4NPB A;  1FW7 A;  1GS3 A;  3CCQ 3;  3LTC A;  3CCU 3;  3CNX A;  3CC7 3;  1BUQ A;  3B8L A;  4CPK A;  5LC7 A;  6GSP A;  3GZY B;  3S29 A;  2XEP A;  1HKX A;  1T2I A;  1Y4K A;  1PFP A;  3B7C A;  1WMP A;  2QGU A;  3MSO A;  3UB1 A;  1YVB I;  5KP3 A;  1BNF A;  1FGR A;  1U8C B;  3D5G A;  4HKV B;  5BU4 A;  5AIF A;  2CG0 A;  1JBR A;  3JUQ A;  1W2Z A;  1BAN A;  2FGT A;  2P09 A;  1B20 A;  1B27 A;  1O7P B;  5IER A;  4BL2 A;  1PU4 A;  3JUN A;  3K9M C;  1TFK A;  4H61 A;  1DYU A;  2HMM B;  4WHA A;  4CCV A;  1UI7 A;  3DGO A;  3F14 A;  2XFS A;  3B4P A;  4BL3 A;  1HYF A;  2JQ5 A;  1O7W B;  4BIR A;  1BSB A;  1OUN A;  2HML B;  3VF1 A;  1VQ7 3;  3CMA 3;  1BNR A;  3T8N A;  5ELU A;  1O7H B;  4XBY A;  2PZV A;  3BNE A;  3FH1 A;  1CEW I;  3N9H A;  4JF8 A;  4IT7 A;  3HII A;  1UI8 A;  3NXJ A;  4FCM A;  3DM8 A;  3ER7 A;  1G96 A;  2LQV A;  5HOH A;  3N54 B;  2F4Y A;  1FGT A;  4N6M A;  3IMA B;  4XBT A;  3KKG A;  3SLU A;  2IMJ A;  1FUW A;  2STD A;  2UUG C;  5KP1 A;  1YIJ 3;  2P38 A;  2RFR A;  3DY5 A;  4FCJ A;  3FG3 A;  4HM3 B;  2IYJ A;  2CFW A;  1ZX2 A;  2KF4 A;  2WOF A;  4HM4 B;  1JN5 A;  3FZW A;  1I2E A;  1UCJ A;  2ZHX B;  5EQL A;  2OTL 3;  1N5P A;  2IA7 A;  4GHO A;  3STD A;  4NRE A;  1BRG A;  5STD A;  5IEN A;  1JBT A;  3LZA A;  2HMN B;  1TRQ A;  1UDI I;  1LNI A;  2AAD A;  1GYB A;  1RGA A;  2CWT A;  4XDW A;  1W5Z A;  1ROA A;  4CDL A;  2YFL B;  1U5O A;  4H3U A;  1W00 A;  1MWT A;  1B2U A;  3ROB A;  1FUT A;  3BU4 A;  2MC8 A;  2I9W A;  3CPO A;  1VQM 3;  1IV9 A;  2OWP A;  4O3V A;  5AYR B;  1IV7 A;  3OWS A;  3WOD G;  2OQE A;  1T2H A;  3LXU X;  1RRL A;  4KFF A;  1EKM A;  3SED A;  4FMC A;  3TDG A;  3KII A;  4GSP A;  2AAE A;  3D4A A;  1BUJ A;  2Y74 A;  3LTA A;  4XDV A;  3HZP A;  3RDE A;  3DUK A;  5IG0 A;  1W4N A;  1VQQ A;  3AMO B;  4GB5 A;  4HJL B;  2ML6 A;  1NNV A;  3DGY A;  1VQP 3;  3E99 A;  5HGR A;  1GY5 A;  1RN7 A;  1SQW A;  2PNC A;  5AII A;  4IIA A;  3DMC A;  2W9P A;  4WP5 A;  1RGH A;  7STD A;  1LOW A;  1E97 A;  1YVS A;  2YFJ B;  3MHE A;  1VQL 3;  1N9E A;  1KWI A;  4HM7 B;  3MG3 A;  4LYL B;  1D6Z A;  2CC3 A;  4GL6 A;  5IF6 A;  1QAL A;  2L1S A;  5CLK A;  1I8V A;  2CH9 A;  4MEI A;  3CC4 3;  4N3V A;  4WFO A;  1RRH A;  1FYS A;  3AGN A;  5CXO A;  3V98 A;  3WOE B;  1RKY A;  4WWU C;  1UGH I;  4KT3 B;  1STD A;  3M8C A;  1N8Q A;  1AVK A;  1B3S A;  1JB5 A;  4RNT A;  1F8N A;  1GOY A;  2CIU A;  1UGI A;  3FGY A;  1CYV A;  1IQ8 A;  2E2V A;  2K3D A;  2GXF A;  3G16 A;  4R80 A;  3SVA A;  3K63 A;  1CYU A;  1O7G B;  2OOV A;  1X1Y A;  1PY3 A;  4J8T A;  4PEJ A;  4BU4 A;  2QA4 3;  5EEO A;  3AHS A;  4XM4 A;  2O3O A;  1GOU A;  1W01 A;  1BRI A;  2HMK B;  3WMD A;  5RNT A;  3CD6 3;  3X40 A;  1A90 A;  4OVM A;  1VZZ A;  1RGL A;  3KN4 A;  4AEQ A;  1ZO2 A;  1ZGX A;  1YIT 3;  1QAK A;  1JZD A;  2GEY A;  3EJV A;  3NQZ A;  2GU1 A;  1J2B A;  3ECF A;  1IDP A;  3NM2 A;  2Q07 A;  1K73 4;  2INX A;  3WR2 A;  3MG2 A;  3NHX A;  1BRH A;  1SJW A;  5KP4 A;  3RNT A;  3D5I A;  1WMN A;  1E3R A;  2RBI A;  1ULI B;  2F56 A;  2RSX A;  2RCD A;  3GWR A;  2W03 A;  1RGE A;  2A15 A;  4OK0 A;  1QVF 2;  3U97 A;  1X1X A;  2SAR A;  4RBN A;  1Q81 4;  1VQO 3;  5BIR A;  1RHL A;  1K9M 4;  2CHC A;  1JKG A;  1SIH A;  1RCL A;  1A2V A;  1W2B 2;  5GSP A;  4N6T A;  4HOH A;  1X1W A;  2J8X B;  3CXC 2;  1LOV A;  2WGO A;  2CFD A;  1YGE A;  1GY7 A;  1DVD A;  3F7X A;  2F86 B;  3F9S A;  4KFD A;  5G2G A;  1BVI A;  1NJI 4;  3DGL A;  3S27 A;  3SXX A;  1IT8 A;  2OTJ 3;  1O7N B;  5IW9 A;  1AV4 A;  1BGS A;  1N8R 4;  3G4S 3;  1N5H A;  1IVV A;  2C11 A;  5BVB A;  4EC6 A;  1BSC A;  1JKG B;  2CWU A;  1A2P A;  1PYL A;  4L8P A;  1Q40 A;  1IK3 A;  4HM5 B;  3NX0 A;  1UCI A;  5FGO A;  3NUV A;  2CW9 A;  2W9Q A;  2BO9 B;  2QEX 3;  1BNE A;  1NWW A;  1RTU A;  1C7H A;  2P05 A;  4HM0 B;  3LOY A;  3SYU A;  4Q53 A;  3HK4 A;  2E2T A;  2L4V A;  3CME 3;  5IG5 A;  1AQZ A;  1NO3 A;  1BRN L;  1IVW A;  2UGI A;  5JPU A;  4BTW A;  3T8U A;  1LQG C;  3Q2P A; 
#chains in the Genus database with same CATH homology
 2KXG A;  1MOL A;  4U13 A;  1AVL A;  2LYX A;  4TX4 A;  3DGN A;  3VSY A;  1Q7Y 4;  5FW5 A;  4O8S A;  3EF8 A;  4OUQ A;  4XBX A;  3UL5 A;  5IEP A;  3G0K A;  3K5T A;  4X2H A;  4BTX A;  3BB9 A;  2F99 A;  3EBY A;  1M90 4;  3G71 3;  3Q90 A;  5CF2 A;  3EE1 A;  3NBJ A;  3FSD A;  2XGL A;  4K1V A;  1IU7 A;  3GRD A;  3K0Z A;  2CKF B;  2K0M A;  3FF2 A;  3O8Y A;  3MWZ A;  3IPT A;  1GD3 A;  4I4K A;  3UL6 A;  3WA3 A;  1M9G A;  3FCS B;  1Z1S A;  1JN5 B;  1GD4 A;  3KSE D;  3WA2 X;  3CCL 3;  3CCR 3;  4MMY B;  1ULJ B;  2GBW B;  3EN8 A;  5EVH A;  3CU3 A;  4EBG A;  2P0X A;  5LC6 A;  3EBT A;  4EXR A;  3I55 3;  1ASK A;  3JUM A;  4N6O B;  4FCZ A;  3CPW 2;  4KZ1 A;  1LNH A;  1IVU A;  3LTD A;  2Z6B A;  3NV0 A;  1AR0 A;  2BNG A;  4HZB B;  2P0M A;  3LYG A;  4HM8 B;  2BT3 A;  1GY6 A;  3EX9 A;  4HYZ A;  3DZL A;  3CCS 3;  5IG4 A;  1VQ8 3;  4EV2 A;  1FGQ A;  2OCT A;  5AEU B;  2Z76 A;  4BTY A;  3NV0 B;  2GBX B;  4N6U A;  1DVC A;  3X41 A;  3GZR A;  5IG3 A;  1IQY A;  1DMM A;  2QIY A;  4L7K A;  1NU3 A;  2V1L A;  2MF7 A;  2SBL A;  2W2C A;  1JB2 A;  5DRV A;  5AEW B;  3X3Y A;  3Q1C A;  5CK6 A;  2CG1 A;  1QMA A;  2BMQ B;  1NB5 I;  4LZI A;  4X2O A;  2GEX A;  3T0U A;  1RJO A;  1W7C A;  2KRT A;  1JV2 B;  3FG1 A;  3EHC A;  4K1U A;  4R4K A;  1OAC A;  4AKY A;  1K8A 4;  2FXT A;  3BNB A;  4R9K A;  1SPU A;  1NB3 I;  6STD A;  3SX1 A;  5JPP A;  4FMA A;  3S28 A;  3WOF B;  1K41 A;  4FR9 A;  1EQK A;  1UUV B;  1OHP A;  5CF1 A;  1TIJ A;  4N6V 0;  2CFK A;  5JBS A;  8CHO A;  2XRX B;  2K54 A;  4K61 A;  1M1K 4;  4JRF A;  1TU5 A;  2ZL8 A;  4XB5 A;  3UNL A;  3I56 3;  1QAF A;  1Q82 4;  2BMR B;  4MMZ B;  3S67 A;  3D9R A;  5AIG A;  5D83 A;  2ZDJ A;  2Z77 A;  1OPY A;  3OWY A;  4KFE A;  3SOY A;  4J9A A;  2WGQ A;  3NBR A;  3MPH A;  3KSP A;  2Z7A A;  3B4O A;  5TGN A;  2OQE C;  1KQS 2;  1QJG A;  4ZM8 A;  1JNQ A;  2ML5 A;  3EC9 A;  4WYK A;  2XFT A;  2KCD A;  2BMO B;  2YFI B;  4RNY A;  4HZ9 B;  2W0Q A;  2BHM A;  1R4C A;  2GU3 A;  4QWT A;  5DRE A;  1VQN 3;  1IVX A;  1CQS A;  2D42 A;  1OH0 A;  1YI2 3;  3OWU A;  1OGZ A;  2CK3 H;  2XSO B;  3PCR A;  1T5Y A;  1STF I;  1EG9 B;  1Q40 B;  3F7S A;  4HM1 B;  4R1K A;  5BXQ A;  4O2H A;  3J7Y d;  4WYK B;  3PXM A;  3CNM A;  4FMD A;  3LT8 A;  4NHF A;  3LML A;  2HMO B;  2CFG A;  3PYJ A;  2JDI H;  2XH9 A;  1VQ6 3;  1N9J A;  2UX0 A;  4EV5 A;  1IQX A;  4RNZ A;  3RGA A;  1E3V A;  2HMJ B;  4HM2 B;  1YJN 3;  2CFL A;  2R4I A;  1Q42 A;  1KSI A;  3EB8 A;  2OOV C;  3L0R A;  2IUJ A;  4RZM A;  3QRD A;  1TFO A;  3N8B A;  4KVH A;  5D82 A;  1QVG 2;  3RGR A;  3GZX B;  4LSO A;  3K7C A;  1UUW B;  1JB4 A;  2IUK A;  3D3L A;  1V74 A;  3FG4 A;  1JRQ A;  1VQK 3;  2W56 A;  3JUO A;  3CCM 3;  1OF5 A;  3LH4 A;  1MNL A;  4IPB A;  3BLZ A;  2C10 A;  2RGQ A;  1OGX A;  3G8Z A;  3F8X A;  4AKZ A;  4N6L A;  2W04 A;  2B24 B;  1UW1 A;  4N6N B;  3BND A;  3IJE B;  5A0O B;  3A76 A;  2W56 B;  3DXO A;  1D6Y A;  5AYS C;  1OF5 B;  3LT9 A;  1W6C A;  4FMB A;  3AMO A;  1ISK A;  1WQL B;  3H51 A;  2M7O A;  4K90 B;  5AI1 A;  1VQ9 3;  1A2K A;  3MKI A;  2B1X B;  5I97 A;  1YHQ 3;  2E2U A;  2XSH B;  4LEH A;  1A67 A;  3S5C A;  1KC8 4;  3JUP A;  3PS8 A;  3VGN A;  1Q86 4;  3WDG B;  1L5G B;  4HVN A;  3OV4 A;  1FGO A;  3F40 A;  3F8H A;  1WTH A;  1OHS A;  4MMX B;  4G1M B;  3LTB A;  1TP6 A;  1WMO A;  3CCJ 3;  4L8O A;  4R9L A;  3SOA A;  3G6E 3;  3HX8 A;  1OHO A;  3ALA A;  1W6G A;  4HM6 B;  3CC2 3;  3V92 A;  3QK9 A;  1HU9 A;  2XGN A;  1K28 A;  3MYT A;  1LVN A;  2YX9 A;  3U1W A;  1SII A;  3NBB A;  1M1X B;  1ROV A;  2FNQ A;  5IEO A;  1S5A A;  2WOH A;  3X3X A;  1YJ9 3;  2Y73 A;  1W6Y A;  3GAX A;  1DMN A;  3OXA A;  2WO0 A;  1TUH A;  5ELJ A;  1DMQ A;  1FGM A;  4MJD A;  1IT7 A;  3HI7 A;  5AIH A;  3DGM A;  3NM7 A;  1LOX A;  1YJW 3;  4ORL A;  1D6U A;  1EA2 A;  1US1 A;  3I0Y A;  1OCV A;  1KD1 4;  3OX9 A;  3X42 A;  3KZT A;  3BNC A;  1O7M B;  3FF0 A;  3GZB A;  4EYC A;  3V99 A;  3PCS A;  4O02 B;  1FA3 A;  2D1W A;  3EQQ B;  3CCV 3;  1VQ5 3;  3EN1 B;  2CWV A;  2XR8 B;  2F98 A;  3UJM A;  3HIG A;  2O9U X;  3PZW A;  4HBR A;  5D81 A;  3H3H A;  3JVC A;  4LMI A;  3OW2 2;  1LXE A;  3FKA A;  2XF3 A;  3MG1 A;  3X3Z A;  3PGB A;  1JJ2 2;  1NDO B;  2W6J H;  3KE7 A;  3NQY A;  1W02 A;  3CCE 3;  4LGQ A;  4STD A;  3FLJ A;  1WNH A;  1S72 3;  3KFQ C;  1GS3 A;  3CCQ 3;  3LTC A;  3CCU 3;  3CNX A;  3CC7 3;  1BUQ A;  3B8L A;  5LC7 A;  3GZY B;  3S29 A;  2XEP A;  1HKX A;  1Y4K A;  3B7C A;  1PFP A;  1WMP A;  2QGU A;  3MSO A;  3UB1 A;  1YVB I;  5KP3 A;  1FGR A;  1U8C B;  4HKV B;  5AIF A;  2CG0 A;  3JUQ A;  1W2Z A;  2FGT A;  2P09 A;  1O7P B;  5IER A;  1PU4 A;  3JUN A;  3K9M C;  1TFK A;  4H61 A;  1DYU A;  2HMM B;  4WHA A;  4CCV A;  1UI7 A;  3DGO A;  3F14 A;  2XFS A;  3B4P A;  2JQ5 A;  1O7W B;  1VQ7 3;  1OUN A;  2HML B;  3VF1 A;  3CMA 3;  3T8N A;  5ELU A;  1O7H B;  4XBY A;  2PZV A;  3BNE A;  3FH1 A;  1CEW I;  3N9H A;  4JF8 A;  4IT7 A;  3HII A;  1UI8 A;  3NXJ A;  4FCM A;  3DM8 A;  3ER7 A;  1G96 A;  2LQV A;  3N54 B;  1FGT A;  4N6M A;  3IMA B;  4XBT A;  3KKG A;  3SLU A;  2IMJ A;  1FUW A;  2STD A;  5KP1 A;  1YIJ 3;  2RFR A;  3DY5 A;  4FCJ A;  3FG3 A;  4HM3 B;  2CFW A;  1ZX2 A;  2WOF A;  4HM4 B;  1JN5 A;  3FZW A;  2OTL 3;  5EQL A;  1N5P A;  2IA7 A;  3STD A;  5IEN A;  4NRE A;  5STD A;  3LZA A;  2HMN B;  1GYB A;  4XDW A;  2CWT A;  1W5Z A;  1ROA A;  4CDL A;  2YFL B;  1U5O A;  4H3U A;  1W00 A;  3ROB A;  2MC8 A;  2I9W A;  3CPO A;  1VQM 3;  1IV9 A;  2OWP A;  4O3V A;  5AYR B;  1IV7 A;  3OWS A;  3WOD G;  2OQE A;  3LXU X;  1RRL A;  4KFF A;  1EKM A;  3SED A;  4FMC A;  3TDG A;  3KII A;  2Y74 A;  3LTA A;  4XDV A;  3HZP A;  3RDE A;  3DUK A;  5IG0 A;  1W4N A;  3AMO B;  4GB5 A;  4HJL B;  2ML6 A;  1VQP 3;  1VQ4 3;  3E99 A;  5HGR A;  1GY5 A;  1RN7 A;  1SQW A;  2PNC A;  5AII A;  4IIA A;  3DMC A;  2W9P A;  4WP5 A;  7STD A;  1E97 A;  3MHE A;  2YFJ B;  1VQL 3;  1N9E A;  1KWI A;  4HM7 B;  3MG3 A;  1D6Z A;  2CC3 A;  4GL6 A;  5IF6 A;  1QAL A;  5CLK A;  2CH9 A;  4MEI A;  3CC4 3;  4N3V A;  4WFO A;  1RRH A;  5CXO A;  3V98 A;  3WOE B;  1RKY A;  4WWU C;  1STD A;  3M8C A;  1N8Q A;  1AVK A;  1JB5 A;  1F8N A;  2CIU A;  3FGY A;  1CYV A;  1IQ8 A;  2E2V A;  2GXF A;  3G16 A;  4R80 A;  3SVA A;  3K63 A;  1CYU A;  1O7G B;  2OOV A;  4J8T A;  4PEJ A;  2QA4 3;  5EEO A;  4XM4 A;  2O3O A;  1W01 A;  3WMD A;  2HMK B;  1A90 A;  3CD6 3;  3X40 A;  4OVM A;  1VZZ A;  3KN4 A;  4AEQ A;  1ZO2 A;  1YIT 3;  1QAK A;  2GEY A;  3EJV A;  3NQZ A;  2GU1 A;  1J2B A;  3ECF A;  1IDP A;  3NM2 A;  2Q07 A;  1K73 4;  2INX A;  3MG2 A;  3NHX A;  1SJW A;  5KP4 A;  1WMN A;  1E3R A;  1ULI B;  2RSX A;  2RCD A;  3GWR A;  2W03 A;  2A15 A;  4OK0 A;  1QVF 2;  3U97 A;  4RBN A;  1Q81 4;  1VQO 3;  1K9M 4;  2CHC A;  1JKG A;  1SIH A;  1A2V A;  1W2B 2;  4N6T A;  3CXC 2;  2WGO A;  2CFD A;  1YGE A;  1GY7 A;  1DVD A;  3F7X A;  2F86 B;  3F9S A;  4KFD A;  5G2G A;  1NJI 4;  3DGL A;  3S27 A;  3SXX A;  1IT8 A;  2OTJ 3;  1O7N B;  5IW9 A;  1AV4 A;  1N8R 4;  3G4S 3;  1N5H A;  1IVV A;  2C11 A;  5BVB A;  4EC6 A;  1JKG B;  2CWU A;  4L8P A;  1IK3 A;  1Q40 A;  4HM5 B;  3NX0 A;  5FGO A;  3NUV A;  2CW9 A;  2W9Q A;  2BO9 B;  2QEX 3;  1NWW A;  1C7H A;  2P05 A;  4HM0 B;  3LOY A;  4Q53 A;  3HK4 A;  2E2T A;  2L4V A;  3CME 3;  5IG5 A;  1NO3 A;  1IVW A;  5JPU A;  4BTW A;  3T8U A;  2P38 A;  3Q2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...