3CCV3

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ccv300
2QEX3 3CCV3 3OW22 1NJI4 3CXC2 3CCS3 1YJ93 1YHQ3 1K734 1M904 3CMA3 1M1K4 3I563 1N8R4 3CCU3 1VQ73 3CCJ3 1YIT3 1QVG2 3CCM3 3G6E3 1K8A4 1VQ53 1Q814 3CPW2 1VQM3 1VQP3 3CCQ3 3CME3 1VQK3 1W2B2 1Q7Y4 1VQ83 3CC43 1K9M4 3CC23 3CCR3 1JJ22 1YJW3 1YI23 3I553 3G713 1VQO3 1VQ93 3CD63 1YJN3 1Q864 1QVF2 2OTL3 2OTJ3 1KD14 1VQL3 1Q824 1S723 1VQ63 3CC73 3CCL3 1VQN3 3G4S3 1VQ43 1KC84 3CCE3 2QA43 1KQS2 1YIJ3
chains in the Genus database with same CATH superfamily
2B1XB 4HJLB 3V99A 2XEPA 3PZWA 1OH0A 4J9AA 1O7WB 1OACA 3FZWA 1ULIB 1BVIA 4LEHA 2CFDA 1N9EA 3KSPA 1E97A 3BNDA 3DM8A 3UB1A 3A76A 1ISKA 1B27A 1ROVA 2IUKA 3J7Yd 1IYYA 1VQK3 3CME3 1GMPA 1LOYA 4WWUC 5G1KA 1BSEA 3WA2X 3G16A 2BNGA 2Z6BA 3CNMA 2I9WA 1Q864 7STDA 1ASKA 1VQ63 1BNRA 1UDII 1AR0A 2OQEC 1WTHA 2H0GA 1I3IA 3B8LA 3FH1A 5IW9A 1G02A 4HM8B 2Z7AA 1LOVA 4CJNA 5EQLA 2RCDA 3X41A 2F4YA 4KZ1A 1BNIA 3OW22 3HIGA 3AMOB 2XFTA 1VQ53 1GY5A 2YFLB 1MGRA 2IY2A 4N6NB 2O9UX 1TU5A 3GZRA 3T8NA 1ZGXA 2RSXA 4BIRA 4IPBA 2E2VA 4ZM8A 1LOWA 3B7CA 2XFSA 3DGLA 1K9M4 1EA2A 4IIAA 3NXJA 4BTWA 3I553 1BNSA 1LNHA 1STFI 4L7KA 1JN5B 3NV0A 1QALA 4XBXA 5LC6A 2XSHB 4EYCA 1KD14 2OTL3 1FUWA 1Q40A 2CWTA 1FA3A 2Y73A 5G1LA 3RGAA 3NBJA 3CNXA 3G0KA 1B2UA 2QA43 3JUQA 3D5GA 3EBYA 3CPOA 4N6MA 3FGYA 4R80A 3UL6A 1M904 2P38A 1MWRA 2CWVA 4I4KA 4EC6A 2UX0A 5AEUB 3H51A 4N6TA 2KF3A 1W6CA 2P0XA 3DGYA 1RGGA 4HKVB 2BMRB 1I3FA 1I8VA 4L8OA 1W01A 3FF2A 3BLZA 1V74A 2F98A 1NO3A 4HM0B 4MMYB 1RGEA 2E2UA 4XDWA 1CQSA 1G0TA 4X2HA 1B2SA 4J8TA 4DKIA 1X1XA 2BU4A 3DGNA 4HM6B 5AIFA 4AKZA 2R41A 2YFJB 1GMRA 1JV2B 2CFWA 3DXOA 1JBRA 1TFKA 1FYSA 1TTOA 1G96A 1NNVA 3F7SA 3X3ZA 1WNHA 4H3UA 1IT8A 4MMXB 1YVSA 1MGWA 2FXTA 2STDA 1VQ73 3EB8A 1JBSA 5IG3A 3CU3A 1RRHA 1JB4A 2K0MA 2RBIA 3JUMA 4HZ9B 2CHCA 1PU4A 4WFOA 1VQ83 1DYUA 1RN1A 1L5GB 3KCHA 2WGQA 4XBYA 5CXOA 2OCTA 1BRGA 3K9MC 3WOEB 1FZUA 2XR8B 4R9KA 3JUOA 1JZOA 2W9QA 1Q9EA 3FCSB 3HZPA 3CCL3 6GSPA 3GZBA 3CCE3 4GSPA 4NREA 1YNVX 1AVLA 1UGHI 1B2MA 4GL6A 4H61A 3CCV3 3PXMA 3SVAA 1GD3A 3Q2PA 3HIIA 2HOHA 4FMBA 1A2PA 4O2HA 3QK9A 3VF1A 3ROBA 1OGXA 7GSPA 4R1KA 3ER7A 3AHWA 1BU4A 1ZS7A 5G2GA 1Q7Y4 3MSOA 2L1SA 2W9PA 2F86B 3SOAA 2KAAA 6STDA 4N6LA 1JJ22 1LXEA 1VQO3 2CW9A 5IG4A 2GSPA 5EVHA 2OTJ3 3F40A 4HM1B 5STDA 1RNBA 3BNBA 1BNGA 1WMOA 1U8CB 3EX9A 4LYLB 1UW1A 2QGUA 1JRQA 2XSOB 1BSBA 2CK3H 3PYJA 2F5WA 4MMZB 3S28A 3HX8A 3S5CA 4EW5A 1GSPA 1FGQA 1W02A 3LMLA 4MEIA 4RNZA 4BU4A 1K734 1BANA 3D5IA 5AI1A 4KT3B 3O8YA 1M1K4 2KF5A 5AIIA 4R9LA 1M1XB 3CD63 1I0XA 3N8BA 5HOHA 1E3RA 4CDLA 1VQM3 1NWWA 1ZX2A 2CX0A 1BRNL 1W2B2 2XRXB 4Q53A 4FMCA 1OUNA 3HOHA 1IQXA 2BHMA 4HM7B 1DMQA 3KIIA 1HZ1A 4XB5A 1F8NA 2UUGC 1TFOA 1W2ZA 3HK4A 1S723 3D9RA 1NDOB 5AYRB 2XF3A 2H0IA 1QMAA 2JQ5A 3DH2A 4FR9A 1WQLB 5M19A 2CG1A 3BIRA 3WHOA 5AEWB 3B4OA 1K28A 1ZO2A 1WMPA 1N5PA 2PNCA 3STDA 1SQWA 1M9GA 4N6OB 1Q7HA 1UUWB 2CX1A 1LVNA 2K3DA 1B21A 3MYTA 5JBSA 3LZAA 4RNYA 1DMNA 4JRFA 1IVXA 2RFRA 5IEOA 4EV2A 1V58A 1O7GB 1JKGB 2CIUA 2GEXA 1EQKA 3LXUX 1OF5B 1GOYA 1W4NA 5DREA 3G4S3 4EV5A 1US1A 5M18A 1LRAA 1UUGB 1IQ8A 3LTBA 2PZVA 1KQS2 1UCKA 1RKYA 8CHOA 3EJVA 1ROAA 4FCJA 4ORLA 2IYJA 3K5TA 2KCDA 3DGOA 2W6JH 4I5QA 1I2EA 4N6UA 1B2ZA 1MNLA 3LTDA 1PYLA 3LH4A 1N8R4 2WGOA 1IT7A 2XH9A 1YIT3 1X1YA 2ZA4A 1JZDA 2D1WA 3U1WA 4NPBA 3A5EA 3NBBA 1IVWA 3NQYA 3OWYA 6RNTA 2E2TA 1X1UA 3LTAA 4GB5A 2W04A 5AIHA 3CC43 1BRJA 3VGNA 1MOLA 5CK6A 1W00A 3AGNA 4FCZA 1BRHA 3MPHA 5M1AA 2HMMB 2GBWB 5TGNA 1GMQA 3DY5A 3NX0A 2LQVA 2ZHXB 4HBRA 5D81A 4K61A 3NM2A 2RGQA 4LSOA 1A90A 1OGZA 3X3YA 3UNLA 4QWTA 1EKMA 5RNTA 2QEX3 2KF4A 1FUTA 2KF6A 3V92A 4WP5A 1RNTA 2BT3A 3EBTA 1VQQA 3I563 1AV4A 4OVMA 4OK0A 3K7CA 4FCMA 3BNCA 3UJMA 4CPKA 2C4BA 1DE3A 1TUHA 3AMOA 1RN7A 1BSCA 3NUVA 1I0VA 2LYXA 3BNEA 3LT8A 3UL5A 1S5AA 1A67A 1N9JA 5HGRA 1PFPA 2ML6A 3SOYA 1VQL3 1B20A 2WOFA 1Z1SA 4KFEA 3EF8A 2AAEA 1JN5A 1JKGA 1QJGA 1J2BA 1BRIA 5IG0A 2XGNA 1KSIA 1GYBA 1C7HA 1RGCA 1CYVA 2HMJB 2BMOB 2FGTA 1RCKA 2KXGA 3GZXB 1AQZA 3MWZA 1QVG2 1FGTA 1FW7A 1Q814 3LYGA 4J5GA 3F9SA 4XBTA 2BMQB 2R4IA 1I70A 3S27A 2D42A 2W03A 1AY7A 3OX9A 4HZBB 5D83A 1T3BA 1MWTA 1O7PB 4HM5B 4OUQA 1YJN3 1Y4KA 1TJDA 1O7MB 3MG1A 2JDIH 3MHEA 1BUQA 1RLSA 4U13A 3H3HA 1RGLA 3RDEA 3S67A 3CC73 1B3SA 1RHLA 2AADA 1VQ43 1IVVA 3NHXA 2CC3A 1KC84 1HKXA 1STDA 1BAOA 5BVBA 7RNTA 1UCLA 1IK3A 3SEDA 1NU3A 3KFQC 1RTUA 1NJI4 1YJ93 3ZG5A 1T2IA 1CH0A 2HMLB 3D4AA 3URPA 1BGSA 3CCU3 1SARA 3JUPA 1UGIA 4WYKB 3IMAB 3WOFB 1ULJB 3OV4A 1PY3A 1VQP3 3B4PA 1UI7A 2UGIA 4KFFA 5IF6A 4HM2B 5CF1A 3ALAA 2Y74A 4BTYA 5BU4A 1LOXA 1RGAA 1Q40B 1UCJA 2K54A 4WHAA 4CCVA 2P09A 5IERA 4TX4A 3AHSA 3D79A 3SLUA 1UCIA 1IU7A 3F8XA 5AIGA 5AYSC 3QRDA 3E99A 4K1UA 3M8CA 3K0ZA 1GOVA 1RMSA 3GSPA 2W56B 5JPUA 4RZMA 1BNJA 1RN4A 5IENA 5FW5A 1D6ZA 3FG3A 1SPUA 3EE1A 3CXC2 1IQYA 4FMAA 3NQZA 3DGMA 1W6GA 1FGMA 4RBNA 1IV9A 2IUJA 1GY7A 1I2FA 2Q07A 1RCLA 3PCSA 3NBRA 1QAKA 1QAFA 3TDGA 1W7CA 1W6YA 3BU4A 3KSED 2ZDJA 4STDA 3FSDA 1N5HA 2YX9A 1O7NB 2OQEA 3VSYA 1YJW3 1TRPA 4XDVA 2KRTA 1WMNA 2B24B 3DUKA 1E3VA 4O3VA 1D6YA 2INXA 1CEWI 3OWSA 2C10A 1BSAA 3EN1B 2QIYA 3KN4A 4BTXA 3FG1A 5FGOA 3SXXA 1I2GA 2Z77A 4BL2A 5KP4A 1RGFA 1BRKA 2O3OA 2W2CA 3FF0A 1FGOA 1UUVB 4HVNA 1OPYA 2W0QA 3FG4A 2CFKA 3IJEB 3OWUA 3G6E3 2OWPA 1JB5A 3CCM3 4FMDA 5BXQA 1BNFA 1BSDA 4WYKA 5CLKA 1LNIA 1A2KA 2J8XB 4KVHA 3F14A 1HYFA 1TRQA 3L0RA 3NM7A 2F56A 2H0HA 5GSPA 3WDGB 3X42A 4KFDA 2CFGA 3CCR3 1DVDA 1MWUA 1GD4A 2HMNB 3JVCA 1VQN3 2P0MA 1TP6A 1CYUA 4HM3B 5DRVA 1GY6A 2CFLA 2F99A 5CF2A 4HOHA 5I97A 1LQMB 3MG2A 3PGBA 3X40A 2L4VA 1JNQA 3GWRA 4MJDA 1YIJ3 1JBTA 2W56A 2RNTA 1D6UA 5IEPA 4RNTA 3CCS3 3N54B 1BRSA 2CWUA 4J5KA 4JF8A 1YGWA 1DVCA 3EHCA 1BNEA 3CCJ3 3JUNA 4LZIA 1FUSA 3DMCA 1A2VA 3D3LA 3I0YA 3F8HA 3IPTA 5ELJA 2CG0A 1W5ZA 1BIRA 4L8PA 3CCQ3 3DZLA 1NB5I 1N8QA 1RDSA 3MKIA 3EQQB 3CC23 1IDPA 5KP1A 2GXFA 2GU3A 1U5OA 4G1MB 3LOYA 4N3VA 2IA7A 4EBGA 1RSNA 3K63A 1R4YA 4X2OA 4K90B 4EXRA 2XGLA 2IMJA 2CH9A 3SX1A 1SIHA 2C11A 3Q1CA 3EN8A 3Q3FA 3SYUA 3Q90A 3WODG 1VZZA 2GU1A 1C54A 1KWIA 8RNTA 1OF5A 3AGOA 4HAAA 3PS8A 4O8SA 3BB9A 4ILFA 1OHPA 1OCVA 3ECFA 2ZL8A 3KE7A 3ZFZA 3CMA3 1BOXA 2GBXB 4IT7A 3F7XA 3N9HA 1GOUA 4LMIA 1V57A 2M7OA 3GAXA 3S29A 1BUJA 3WA3A 5KP3A 5A0OB 1YVBI 3CPW2 1EEJA 3LT9A 4HYZA 1RGHA 1NB3I 4K1VA 2MC8A 3X3XA 2WO0A 3PCRA 1B2XA 4GHOA 2A15A 2FNQA 2CKFB 3HI7A 2BO9B 1OHSA 2OOVA 2V1LA 1DETA 3WR2A 3U97A 9RNTA 1VQ93 1QVF2 1HU9A 1UI8A 1LQGC 1O7HB 2OOVC 2F5MA 4AEQA 1FGRA 1Q42A 5BIRA 3GRDA 1R4CA 4AKYA 3EC9A 2HMOB 2ML5A 1RRLA 3MG3A 1GS3A 4LGQA 4HM4B 3T8UA 5JPPA 2Z76A 1YHQ3 3ZG0A 5IG5A 1TIJA 2P05A 3WMDA 1IV7A 1RJOA 4XM4A 3RGRA 4O02B 1T5YA 3V98A 3T0UA 1K8A4 2HMKB 3G8ZA 3RNTA 1K41A 1SIIA 4BL3A 4NHFA 1RGKA 1YGEA 3FLJA 1OHOA 3GZYB 3LTCA 5EEOA 1IVUA 1MWSA 2GEYA 5D82A 5LC7A 3NV0B 1YI23 1EG9B 2YFIB 3KZTA 3G713 2SBLA 4PEJA 3OXAA 5ELUA 1DMMA 4N6V0 2SARA 1X1WA 1SJWA 1Q824 3KKGA 4R4KA 1JB2A 1EUIC 2MF7A 2WOHA 2BIRA 1T2HA 3FKAA 1AVKA
chains in the Genus database with same CATH topology
2B1XB 4HJLB 3V99A 2XEPA 3PZWA 1OH0A 4J9AA 1O7WB 1OACA 3FZWA 1ULIB 4LEHA 2CFDA 1N9EA 3KSPA 1E97A 3BNDA 3DM8A 3UB1A 3A76A 1ISKA 1ROVA 2IUKA 3J7Yd 1VQK3 3CME3 4WWUC 3WA2X 3G16A 2BNGA 2Z6BA 3CNMA 2I9WA 1Q864 7STDA 1ASKA 1VQ63 1AR0A 2OQEC 1WTHA 3B8LA 3FH1A 5IW9A 4HM8B 2Z7AA 5EQLA 2RCDA 3X41A 4KZ1A 3OW22 3HIGA 3AMOB 2XFTA 1VQ53 1GY5A 2YFLB 4N6NB 2O9UX 1TU5A 3GZRA 3T8NA 2RSXA 4IPBA 2E2VA 4ZM8A 3B7CA 2XFSA 3DGLA 1K9M4 1EA2A 4IIAA 3NXJA 4BTWA 3I553 4L7KA 1LNHA 1STFI 4XBXA 1JN5B 3NV0A 1QALA 5LC6A 4EYCA 2XSHB 2OTL3 1KD14 1FUWA 1Q40A 2CWTA 1FA3A 2Y73A 3RGAA 3NBJA 3CNXA 3G0KA 2QA43 3JUQA 3EBYA 3CPOA 4N6MA 3FGYA 4R80A 3UL6A 1M904 2P38A 2CWVA 4I4KA 4EC6A 2UX0A 5AEUB 3H51A 4N6TA 2P0XA 1W6CA 4HKVB 2BMRB 4L8OA 1W01A 3FF2A 3BLZA 1V74A 2F98A 1NO3A 4HM0B 4MMYB 2E2UA 4XDWA 1CQSA 4X2HA 4J8TA 3DGNA 4HM6B 5AIFA 4AKZA 2YFJB 1JV2B 2CFWA 3DXOA 1TFKA 1G96A 3F7SA 3X3ZA 1WNHA 4H3UA 1IT8A 4MMXB 2FXTA 2STDA 1VQ73 3EB8A 5IG3A 3CU3A 1RRHA 1JB4A 2K0MA 3JUMA 4HZ9B 2CHCA 1PU4A 4WFOA 1VQ83 1DYUA 1L5GB 2WGQA 4XBYA 5CXOA 2OCTA 3K9MC 3WOEB 2XR8B 4R9KA 3JUOA 3CCL3 2W9QA 3FCSB 3HZPA 3GZBA 3CCE3 4NREA 1AVLA 4GL6A 4H61A 3CCV3 3PXMA 3SVAA 1GD3A 3Q2PA 3HIIA 4FMBA 4O2HA 3QK9A 3VF1A 3ROBA 1OGXA 4R1KA 3ER7A 1Q7Y4 5G2GA 3MSOA 2W9PA 2F86B 3SOAA 6STDA 4N6LA 1JJ22 1LXEA 1VQO3 2CW9A 5IG4A 5EVHA 2OTJ3 3F40A 4HM1B 5STDA 3BNBA 3EX9A 1WMOA 1U8CB 1UW1A 2QGUA 1JRQA 2XSOB 4MMZB 2CK3H 3PYJA 3S28A 3HX8A 3S5CA 4RNZA 1FGQA 1W02A 3LMLA 4MEIA 1K734 5AI1A 1M1K4 3O8YA 5AIIA 4R9LA 1M1XB 3CD63 3N8BA 1E3RA 4CDLA 1VQM3 1NWWA 1ZX2A 1W2B2 2XRXB 4Q53A 4FMCA 1OUNA 1IQXA 2BHMA 4HM7B 1DMQA 3KIIA 4XB5A 1F8NA 1TFOA 1W2ZA 3HK4A 1S723 3D9RA 1NDOB 5AYRB 2XF3A 1QMAA 2JQ5A 4FR9A 1WQLB 2CG1A 5AEWB 3B4OA 1K28A 1ZO2A 1WMPA 1N5PA 2PNCA 3STDA 1SQWA 1M9GA 4N6OB 1UUWB 1LVNA 5JBSA 3MYTA 3LZAA 4RNYA 1DMNA 4JRFA 1IVXA 2RFRA 5IEOA 4EV2A 2GEXA 1O7GB 1JKGB 2CIUA 1EQKA 3LXUX 1OF5B 1W4NA 5DREA 3G4S3 4EV5A 1US1A 1IQ8A 3LTBA 1KQS2 2PZVA 1RKYA 8CHOA 3EJVA 1ROAA 4FCJA 4ORLA 3K5TA 2KCDA 3DGOA 2W6JH 4N6UA 1MNLA 3LTDA 3LH4A 1N8R4 2WGOA 1IT7A 2XH9A 1YIT3 2D1WA 3U1WA 3NBBA 1IVWA 3NQYA 3OWYA 2E2TA 3LTAA 4GB5A 2W04A 5AIHA 3CC43 3VGNA 1MOLA 5CK6A 1W00A 4FCZA 3MPHA 2HMMB 2GBWB 5TGNA 3DY5A 3NX0A 2LQVA 4HBRA 5D81A 4K61A 3NM2A 2RGQA 4LSOA 1A90A 1OGZA 3X3YA 3UNLA 4QWTA 1EKMA 2QEX3 3V92A 4WP5A 2BT3A 3EBTA 3I563 1AV4A 4OVMA 4OK0A 3K7CA 4FCMA 3BNCA 3UJMA 1TUHA 3AMOA 1RN7A 3NUVA 2LYXA 3BNEA 3LT8A 3UL5A 1S5AA 1A67A 1N9JA 5HGRA 1PFPA 2ML6A 3SOYA 1VQL3 2WOFA 4KFEA 1Z1SA 3EF8A 1JN5A 1JKGA 1QJGA 1J2BA 5IG0A 2XGNA 1KSIA 1GYBA 1C7HA 1CYVA 2HMJB 2BMOB 2FGTA 2KXGA 3GZXB 3MWZA 1QVG2 1FGTA 1Q814 3LYGA 3F9SA 4XBTA 2BMQB 2R4IA 3S27A 2D42A 2W03A 3OX9A 4HZBB 5D83A 1O7PB 4HM5B 4OUQA 1YJN3 1Y4KA 1O7MB 3MG1A 2JDIH 3MHEA 1BUQA 4U13A 3H3HA 3CC73 3RDEA 3S67A 1VQ43 1IVVA 3NHXA 2CC3A 1KC84 1HKXA 1STDA 5BVBA 1IK3A 3SEDA 1NU3A 3KFQC 1NJI4 1YJ93 2HMLB 3CCU3 3JUPA 4WYKB 3IMAB 3WOFB 1ULJB 3OV4A 1VQP3 3B4PA 1UI7A 4KFFA 5IF6A 4HM2B 5CF1A 3ALAA 2Y74A 4BTYA 1LOXA 1Q40B 2K54A 4WHAA 4CCVA 2P09A 5IERA 4TX4A 3SLUA 1IU7A 3F8XA 5AIGA 5AYSC 3QRDA 3E99A 4K1UA 3M8CA 3K0ZA 2W56B 5JPUA 4RZMA 5IENA 5FW5A 1D6ZA 3FG3A 1SPUA 3EE1A 3CXC2 1IQYA 4FMAA 3NQZA 3DGMA 1W6GA 1FGMA 4RBNA 1IV9A 2IUJA 1GY7A 2Q07A 3PCSA 3NBRA 1QAKA 1QAFA 1AVKA 1W7CA 1W6YA 3KSED 3TDGA 2ZDJA 4STDA 3FSDA 1N5HA 2YX9A 1O7NB 2OQEA 3VSYA 1YJW3 4XDVA 2KRTA 1WMNA 2B24B 3DUKA 1E3VA 4O3VA 1D6YA 2INXA 1CEWI 3OWSA 2C10A 3EN1B 2QIYA 3KN4A 4BTXA 3FG1A 5FGOA 3SXXA 2Z77A 5KP4A 2W2CA 2O3OA 3FF0A 1FGOA 1UUVB 4HVNA 1OPYA 2W0QA 3FG4A 2CFKA 3IJEB 3OWUA 3G6E3 2OWPA 1JB5A 3CCM3 4FMDA 5BXQA 4WYKA 5CLKA 1A2KA 4KVHA 3F14A 3L0RA 3NM7A 3WDGB 3X42A 4KFDA 2CFGA 3CCR3 1DVDA 1GD4A 2HMNB 3JVCA 1VQN3 2P0MA 1TP6A 1CYUA 4HM3B 5DRVA 1GY6A 2CFLA 2F99A 5CF2A 5I97A 3MG2A 3PGBA 3X40A 1JNQA 3GWRA 4MJDA 1YIJ3 2W56A 1D6UA 5IEPA 3CCS3 3N54B 2CWUA 4JF8A 3EHCA 1DVCA 3CCJ3 3JUNA 4LZIA 3DMCA 1A2VA 3D3LA 3I0YA 3F8HA 3IPTA 5ELJA 2CG0A 1W5ZA 4L8PA 3CCQ3 3DZLA 1NB5I 1N8QA 3MKIA 3EQQB 3CC23 1IDPA 5KP1A 2GXFA 2GU3A 1U5OA 4G1MB 3LOYA 4N3VA 2IA7A 4EBGA 3K63A 4X2OA 4K90B 4EXRA 2XGLA 2IMJA 2CH9A 3SX1A 1SIHA 2C11A 3Q1CA 3EN8A 3WODG 3Q90A 1VZZA 2GU1A 1KWIA 1OF5A 3PS8A 4O8SA 3BB9A 1OHPA 1OCVA 3ECFA 2ZL8A 3KE7A 3CMA3 2GBXB 4IT7A 3F7XA 3N9HA 4LMIA 2M7OA 3GAXA 3S29A 3WA3A 5KP3A 5A0OB 1YVBI 3CPW2 3LT9A 4HYZA 4K1VA 1NB3I 2MC8A 3X3XA 2WO0A 3PCRA 2A15A 2FNQA 2CKFB 3HI7A 2BO9B 1OHSA 2OOVA 2V1LA 1VQ93 3U97A 1QVF2 1HU9A 1UI8A 1O7HB 2OOVC 4AEQA 1FGRA 1Q42A 3GRDA 1R4CA 4AKYA 3EC9A 2HMOB 2ML5A 1RRLA 3MG3A 1GS3A 4LGQA 4HM4B 3T8UA 5JPPA 2Z76A 1YHQ3 5IG5A 1TIJA 2P05A 3WMDA 1IV7A 1RJOA 4XM4A 3RGRA 4O02B 1T5YA 3V98A 3T0UA 1K8A4 2HMKB 3G8ZA 1K41A 1SIIA 4NHFA 1YGEA 3FLJA 1OHOA 3GZYB 3LTCA 5EEOA 1IVUA 2GEYA 5D82A 5LC7A 3NV0B 1YI23 1EG9B 2YFIB 3KZTA 3G713 2SBLA 4PEJA 3OXAA 5ELUA 1DMMA 4N6V0 1SJWA 1Q824 3KKGA 4R4KA 1JB2A 2MF7A 2WOHA 3FKAA 2L4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX 3;  3CCV 3;  3OW2 2;  1NJI 4;  3CXC 2;  3CCS 3;  1YJ9 3;  1YHQ 3;  1K73 4;  1M90 4;  3CMA 3;  1M1K 4;  3I56 3;  1N8R 4;  3CCU 3;  1VQ7 3;  3CCJ 3;  1YIT 3;  1QVG 2;  3CCM 3;  3G6E 3;  1K8A 4;  1VQ5 3;  1Q81 4;  3CPW 2;  1VQM 3;  1VQP 3;  3CCQ 3;  3CME 3;  1VQK 3;  1W2B 2;  1Q7Y 4;  1VQ8 3;  3CC4 3;  1K9M 4;  3CC2 3;  3CCR 3;  1JJ2 2;  1YJW 3;  1YI2 3;  3I55 3;  3G71 3;  1VQO 3;  1VQ9 3;  3CD6 3;  1YJN 3;  1Q86 4;  1QVF 2;  2OTL 3;  2OTJ 3;  1KD1 4;  1VQL 3;  1Q82 4;  1S72 3;  1VQ6 3;  3CC7 3;  3CCL 3;  1VQN 3;  3G4S 3;  1VQ4 3;  1KC8 4;  3CCE 3;  2QA4 3;  1KQS 2;  1YIJ 3; 
#chains in the Genus database with same CATH topology
 2B1X B;  4HJL B;  3V99 A;  2XEP A;  3PZW A;  1OH0 A;  4J9A A;  1O7W B;  1OAC A;  3FZW A;  1ULI B;  1BVI A;  4LEH A;  2CFD A;  1N9E A;  3KSP A;  1E97 A;  3BND A;  3DM8 A;  3UB1 A;  3A76 A;  1ISK A;  1B27 A;  1ROV A;  2IUK A;  3J7Y d;  1IYY A;  1VQK 3;  3CME 3;  1GMP A;  1LOY A;  4WWU C;  5G1K A;  1BSE A;  3WA2 X;  3G16 A;  2BNG A;  2Z6B A;  3CNM A;  2I9W A;  1Q86 4;  7STD A;  1ASK A;  1VQ6 3;  1BNR A;  1UDI I;  1AR0 A;  2OQE C;  1WTH A;  2H0G A;  1I3I A;  3B8L A;  3FH1 A;  5IW9 A;  1G02 A;  4HM8 B;  2Z7A A;  1LOV A;  4CJN A;  5EQL A;  2RCD A;  3X41 A;  2F4Y A;  4KZ1 A;  1BNI A;  3OW2 2;  3HIG A;  3AMO B;  2XFT A;  1VQ5 3;  1GY5 A;  2YFL B;  1MGR A;  2IY2 A;  4N6N B;  2O9U X;  1TU5 A;  3GZR A;  3T8N A;  1ZGX A;  2RSX A;  4BIR A;  4IPB A;  2E2V A;  4ZM8 A;  1LOW A;  3B7C A;  2XFS A;  3DGL A;  1K9M 4;  1EA2 A;  4IIA A;  3NXJ A;  4BTW A;  3I55 3;  1BNS A;  1LNH A;  1STF I;  4L7K A;  1JN5 B;  3NV0 A;  1QAL A;  4XBX A;  5LC6 A;  2XSH B;  4EYC A;  1KD1 4;  2OTL 3;  1FUW A;  1Q40 A;  2CWT A;  1FA3 A;  2Y73 A;  5G1L A;  3RGA A;  3NBJ A;  3CNX A;  3G0K A;  1B2U A;  2QA4 3;  3JUQ A;  3D5G A;  3EBY A;  3CPO A;  4N6M A;  3FGY A;  4R80 A;  3UL6 A;  1M90 4;  2P38 A;  1MWR A;  2CWV A;  4I4K A;  4EC6 A;  2UX0 A;  5AEU B;  3H51 A;  4N6T A;  2KF3 A;  1W6C A;  2P0X A;  3DGY A;  1RGG A;  4HKV B;  2BMR B;  1I3F A;  1I8V A;  4L8O A;  1W01 A;  3FF2 A;  3BLZ A;  1V74 A;  2F98 A;  1NO3 A;  4HM0 B;  4MMY B;  1RGE A;  2E2U A;  4XDW A;  1CQS A;  1G0T A;  4X2H A;  1B2S A;  4J8T A;  4DKI A;  1X1X A;  2BU4 A;  3DGN A;  4HM6 B;  5AIF A;  4AKZ A;  2R41 A;  2YFJ B;  1GMR A;  1JV2 B;  2CFW A;  3DXO A;  1JBR A;  1TFK A;  1FYS A;  1TTO A;  1G96 A;  1NNV A;  3F7S A;  3X3Z A;  1WNH A;  4H3U A;  1IT8 A;  4MMX B;  1YVS A;  1MGW A;  2FXT A;  2STD A;  1VQ7 3;  3EB8 A;  1JBS A;  5IG3 A;  3CU3 A;  1RRH A;  1JB4 A;  2K0M A;  2RBI A;  3JUM A;  4HZ9 B;  2CHC A;  1PU4 A;  4WFO A;  1VQ8 3;  1DYU A;  1RN1 A;  1L5G B;  3KCH A;  2WGQ A;  4XBY A;  5CXO A;  2OCT A;  1BRG A;  3K9M C;  3WOE B;  1FZU A;  2XR8 B;  4R9K A;  3JUO A;  1JZO A;  2W9Q A;  1Q9E A;  3FCS B;  3HZP A;  3CCL 3;  6GSP A;  3GZB A;  3CCE 3;  4GSP A;  4NRE A;  1YNV X;  1AVL A;  1UGH I;  1B2M A;  4GL6 A;  4H61 A;  3CCV 3;  3PXM A;  3SVA A;  1GD3 A;  3Q2P A;  3HII A;  2HOH A;  4FMB A;  1A2P A;  4O2H A;  3QK9 A;  3VF1 A;  3ROB A;  1OGX A;  7GSP A;  4R1K A;  3ER7 A;  3AHW A;  1BU4 A;  1ZS7 A;  5G2G A;  1Q7Y 4;  3MSO A;  2L1S A;  2W9P A;  2F86 B;  3SOA A;  2KAA A;  6STD A;  4N6L A;  1JJ2 2;  1LXE A;  1VQO 3;  2CW9 A;  5IG4 A;  2GSP A;  5EVH A;  2OTJ 3;  3F40 A;  4HM1 B;  5STD A;  1RNB A;  3BNB A;  1BNG A;  1WMO A;  1U8C B;  3EX9 A;  4LYL B;  1UW1 A;  2QGU A;  1JRQ A;  2XSO B;  1BSB A;  2CK3 H;  3PYJ A;  2F5W A;  4MMZ B;  3S28 A;  3HX8 A;  3S5C A;  4EW5 A;  1GSP A;  1FGQ A;  1W02 A;  3LML A;  4MEI A;  4RNZ A;  4BU4 A;  1K73 4;  1BAN A;  3D5I A;  5AI1 A;  4KT3 B;  3O8Y A;  1M1K 4;  2KF5 A;  5AII A;  4R9L A;  1M1X B;  3CD6 3;  1I0X A;  3N8B A;  5HOH A;  1E3R A;  4CDL A;  1VQM 3;  1NWW A;  1ZX2 A;  2CX0 A;  1BRN L;  1W2B 2;  2XRX B;  4Q53 A;  4FMC A;  1OUN A;  3HOH A;  1IQX A;  2BHM A;  4HM7 B;  1DMQ A;  3KII A;  1HZ1 A;  4XB5 A;  1F8N A;  2UUG C;  1TFO A;  1W2Z A;  3HK4 A;  1S72 3;  3D9R A;  1NDO B;  5AYR B;  2XF3 A;  2H0I A;  1QMA A;  2JQ5 A;  3DH2 A;  4FR9 A;  1WQL B;  5M19 A;  2CG1 A;  3BIR A;  3WHO A;  5AEW B;  3B4O A;  1K28 A;  1ZO2 A;  1WMP A;  1N5P A;  2PNC A;  3STD A;  1SQW A;  1M9G A;  4N6O B;  1Q7H A;  1UUW B;  2CX1 A;  1LVN A;  2K3D A;  1B21 A;  3MYT A;  5JBS A;  3LZA A;  4RNY A;  1DMN A;  4JRF A;  1IVX A;  2RFR A;  5IEO A;  4EV2 A;  1V58 A;  1O7G B;  1JKG B;  2CIU A;  2GEX A;  1EQK A;  3LXU X;  1OF5 B;  1GOY A;  1W4N A;  5DRE A;  3G4S 3;  4EV5 A;  1US1 A;  5M18 A;  1LRA A;  1UUG B;  1IQ8 A;  3LTB A;  2PZV A;  1KQS 2;  1UCK A;  1RKY A;  8CHO A;  3EJV A;  1ROA A;  4FCJ A;  4ORL A;  2IYJ A;  3K5T A;  2KCD A;  3DGO A;  2W6J H;  4I5Q A;  1I2E A;  4N6U A;  1B2Z A;  1MNL A;  3LTD A;  1PYL A;  3LH4 A;  1N8R 4;  2WGO A;  1IT7 A;  2XH9 A;  1YIT 3;  1X1Y A;  2ZA4 A;  1JZD A;  2D1W A;  3U1W A;  4NPB A;  3A5E A;  3NBB A;  1IVW A;  3NQY A;  3OWY A;  6RNT A;  2E2T A;  1X1U A;  3LTA A;  4GB5 A;  2W04 A;  5AIH A;  3CC4 3;  1BRJ A;  3VGN A;  1MOL A;  5CK6 A;  1W00 A;  3AGN A;  4FCZ A;  1BRH A;  3MPH A;  5M1A A;  2HMM B;  2GBW B;  5TGN A;  1GMQ A;  3DY5 A;  3NX0 A;  2LQV A;  2ZHX B;  4HBR A;  5D81 A;  4K61 A;  3NM2 A;  2RGQ A;  4LSO A;  1A90 A;  1OGZ A;  3X3Y A;  3UNL A;  4QWT A;  1EKM A;  5RNT A;  2QEX 3;  2KF4 A;  1FUT A;  2KF6 A;  3V92 A;  4WP5 A;  1RNT A;  2BT3 A;  3EBT A;  1VQQ A;  3I56 3;  1AV4 A;  4OVM A;  4OK0 A;  3K7C A;  4FCM A;  3BNC A;  3UJM A;  4CPK A;  2C4B A;  1DE3 A;  1TUH A;  3AMO A;  1RN7 A;  1BSC A;  3NUV A;  1I0V A;  2LYX A;  3BNE A;  3LT8 A;  3UL5 A;  1S5A A;  1A67 A;  1N9J A;  5HGR A;  1PFP A;  2ML6 A;  3SOY A;  1VQL 3;  1B20 A;  2WOF A;  1Z1S A;  4KFE A;  3EF8 A;  2AAE A;  1JN5 A;  1JKG A;  1QJG A;  1J2B A;  1BRI A;  5IG0 A;  2XGN A;  1KSI A;  1GYB A;  1C7H A;  1RGC A;  1CYV A;  2HMJ B;  2BMO B;  2FGT A;  1RCK A;  2KXG A;  3GZX B;  1AQZ A;  3MWZ A;  1QVG 2;  1FGT A;  1FW7 A;  1Q81 4;  3LYG A;  4J5G A;  3F9S A;  4XBT A;  2BMQ B;  2R4I A;  1I70 A;  3S27 A;  2D42 A;  2W03 A;  1AY7 A;  3OX9 A;  4HZB B;  5D83 A;  1T3B A;  1MWT A;  1O7P B;  4HM5 B;  4OUQ A;  1YJN 3;  1Y4K A;  1TJD A;  1O7M B;  3MG1 A;  2JDI H;  3MHE A;  1BUQ A;  1RLS A;  4U13 A;  3H3H A;  1RGL A;  3RDE A;  3S67 A;  3CC7 3;  1B3S A;  1RHL A;  2AAD A;  1VQ4 3;  1IVV A;  3NHX A;  2CC3 A;  1KC8 4;  1HKX A;  1STD A;  1BAO A;  5BVB A;  7RNT A;  1UCL A;  1IK3 A;  3SED A;  1NU3 A;  3KFQ C;  1RTU A;  1NJI 4;  1YJ9 3;  3ZG5 A;  1T2I A;  1CH0 A;  2HML B;  3D4A A;  3URP A;  1BGS A;  3CCU 3;  1SAR A;  3JUP A;  1UGI A;  4WYK B;  3IMA B;  3WOF B;  1ULJ B;  3OV4 A;  1PY3 A;  1VQP 3;  3B4P A;  1UI7 A;  2UGI A;  4KFF A;  5IF6 A;  4HM2 B;  5CF1 A;  3ALA A;  2Y74 A;  4BTY A;  5BU4 A;  1LOX A;  1RGA A;  1Q40 B;  1UCJ A;  2K54 A;  4WHA A;  4CCV A;  2P09 A;  5IER A;  4TX4 A;  3AHS A;  3D79 A;  3SLU A;  1UCI A;  1IU7 A;  3F8X A;  5AIG A;  5AYS C;  3QRD A;  3E99 A;  4K1U A;  3M8C A;  3K0Z A;  1GOV A;  1RMS A;  3GSP A;  2W56 B;  5JPU A;  4RZM A;  1BNJ A;  1RN4 A;  5IEN A;  5FW5 A;  1D6Z A;  3FG3 A;  1SPU A;  3EE1 A;  3CXC 2;  1IQY A;  4FMA A;  3NQZ A;  3DGM A;  1W6G A;  1FGM A;  4RBN A;  1IV9 A;  2IUJ A;  1GY7 A;  1I2F A;  2Q07 A;  1RCL A;  3PCS A;  3NBR A;  1QAK A;  1QAF A;  3TDG A;  1W7C A;  1W6Y A;  3BU4 A;  3KSE D;  2ZDJ A;  4STD A;  3FSD A;  1N5H A;  2YX9 A;  1O7N B;  2OQE A;  3VSY A;  1YJW 3;  1TRP A;  4XDV A;  2KRT A;  1WMN A;  2B24 B;  3DUK A;  1E3V A;  4O3V A;  1D6Y A;  2INX A;  1CEW I;  3OWS A;  2C10 A;  1BSA A;  3EN1 B;  2QIY A;  3KN4 A;  4BTX A;  3FG1 A;  5FGO A;  3SXX A;  1I2G A;  2Z77 A;  4BL2 A;  5KP4 A;  1RGF A;  1BRK A;  2O3O A;  2W2C A;  3FF0 A;  1FGO A;  1UUV B;  4HVN A;  1OPY A;  2W0Q A;  3FG4 A;  2CFK A;  3IJE B;  3OWU A;  3G6E 3;  2OWP A;  1JB5 A;  3CCM 3;  4FMD A;  5BXQ A;  1BNF A;  1BSD A;  4WYK A;  5CLK A;  1LNI A;  1A2K A;  2J8X B;  4KVH A;  3F14 A;  1HYF A;  1TRQ A;  3L0R A;  3NM7 A;  2F56 A;  2H0H A;  5GSP A;  3WDG B;  3X42 A;  4KFD A;  2CFG A;  3CCR 3;  1DVD A;  1MWU A;  1GD4 A;  2HMN B;  3JVC A;  1VQN 3;  2P0M A;  1TP6 A;  1CYU A;  4HM3 B;  5DRV A;  1GY6 A;  2CFL A;  2F99 A;  5CF2 A;  4HOH A;  5I97 A;  1LQM B;  3MG2 A;  3PGB A;  3X40 A;  2L4V A;  1JNQ A;  3GWR A;  4MJD A;  1YIJ 3;  1JBT A;  2W56 A;  2RNT A;  1D6U A;  5IEP A;  4RNT A;  3CCS 3;  3N54 B;  1BRS A;  2CWU A;  4J5K A;  4JF8 A;  1YGW A;  1DVC A;  3EHC A;  1BNE A;  3CCJ 3;  3JUN A;  4LZI A;  1FUS A;  3DMC A;  1A2V A;  3D3L A;  3I0Y A;  3F8H A;  3IPT A;  5ELJ A;  2CG0 A;  1W5Z A;  1BIR A;  4L8P A;  3CCQ 3;  3DZL A;  1NB5 I;  1N8Q A;  1RDS A;  3MKI A;  3EQQ B;  3CC2 3;  1IDP A;  5KP1 A;  2GXF A;  2GU3 A;  1U5O A;  4G1M B;  3LOY A;  4N3V A;  2IA7 A;  4EBG A;  1RSN A;  3K63 A;  1R4Y A;  4X2O A;  4K90 B;  4EXR A;  2XGL A;  2IMJ A;  2CH9 A;  3SX1 A;  1SIH A;  2C11 A;  3Q1C A;  3EN8 A;  3Q3F A;  3SYU A;  3Q90 A;  3WOD G;  1VZZ A;  2GU1 A;  1C54 A;  1KWI A;  8RNT A;  1OF5 A;  3AGO A;  4HAA A;  3PS8 A;  4O8S A;  3BB9 A;  4ILF A;  1OHP A;  1OCV A;  3ECF A;  2ZL8 A;  3KE7 A;  3ZFZ A;  3CMA 3;  1BOX A;  2GBX B;  4IT7 A;  3F7X A;  3N9H A;  1GOU A;  4LMI A;  1V57 A;  2M7O A;  3GAX A;  3S29 A;  1BUJ A;  3WA3 A;  5KP3 A;  5A0O B;  1YVB I;  3CPW 2;  1EEJ A;  3LT9 A;  4HYZ A;  1RGH A;  1NB3 I;  4K1V A;  2MC8 A;  3X3X A;  2WO0 A;  3PCR A;  1B2X A;  4GHO A;  2A15 A;  2FNQ A;  2CKF B;  3HI7 A;  2BO9 B;  1OHS A;  2OOV A;  2V1L A;  1DET A;  3WR2 A;  3U97 A;  9RNT A;  1VQ9 3;  1QVF 2;  1HU9 A;  1UI8 A;  1LQG C;  1O7H B;  2OOV C;  2F5M A;  4AEQ A;  1FGR A;  1Q42 A;  5BIR A;  3GRD A;  1R4C A;  4AKY A;  3EC9 A;  2HMO B;  2ML5 A;  1RRL A;  3MG3 A;  1GS3 A;  4LGQ A;  4HM4 B;  3T8U A;  5JPP A;  2Z76 A;  1YHQ 3;  3ZG0 A;  5IG5 A;  1TIJ A;  2P05 A;  3WMD A;  1IV7 A;  1RJO A;  4XM4 A;  3RGR A;  4O02 B;  1T5Y A;  3V98 A;  3T0U A;  1K8A 4;  2HMK B;  3G8Z A;  3RNT A;  1K41 A;  1SII A;  4BL3 A;  4NHF A;  1RGK A;  1YGE A;  3FLJ A;  1OHO A;  3GZY B;  3LTC A;  5EEO A;  1IVU A;  1MWS A;  2GEY A;  5D82 A;  5LC7 A;  3NV0 B;  1YI2 3;  1EG9 B;  2YFI B;  3KZT A;  3G71 3;  2SBL A;  4PEJ A;  3OXA A;  5ELU A;  1DMM A;  4N6V 0;  2SAR A;  1X1W A;  1SJW A;  1Q82 4;  3KKG A;  4R4K A;  1JB2 A;  1EUI C;  2MF7 A;  2WOH A;  2BIR A;  1T2H A;  3FKA A;  1AVK A; 
#chains in the Genus database with same CATH homology
 2B1X B;  4HJL B;  3V99 A;  2XEP A;  3PZW A;  1OH0 A;  4J9A A;  1O7W B;  1OAC A;  3FZW A;  1ULI B;  4LEH A;  2CFD A;  1N9E A;  3KSP A;  1E97 A;  3BND A;  3DM8 A;  3UB1 A;  3A76 A;  1ISK A;  1ROV A;  2IUK A;  3J7Y d;  1VQK 3;  3CME 3;  4WWU C;  3WA2 X;  3G16 A;  2BNG A;  2Z6B A;  3CNM A;  2I9W A;  1Q86 4;  7STD A;  1ASK A;  1VQ6 3;  1AR0 A;  2OQE C;  1WTH A;  3B8L A;  3FH1 A;  5IW9 A;  4HM8 B;  2Z7A A;  5EQL A;  2RCD A;  3X41 A;  4KZ1 A;  3OW2 2;  3HIG A;  3AMO B;  2XFT A;  1VQ5 3;  1GY5 A;  2YFL B;  4N6N B;  2O9U X;  1TU5 A;  3GZR A;  3T8N A;  2RSX A;  4IPB A;  2E2V A;  4ZM8 A;  3B7C A;  2XFS A;  3DGL A;  1K9M 4;  1EA2 A;  4IIA A;  3NXJ A;  4BTW A;  3I55 3;  4L7K A;  1LNH A;  1STF I;  4XBX A;  1JN5 B;  3NV0 A;  1QAL A;  5LC6 A;  4EYC A;  2XSH B;  2OTL 3;  1KD1 4;  1FUW A;  1Q40 A;  2CWT A;  1FA3 A;  2Y73 A;  3RGA A;  3NBJ A;  3CNX A;  3G0K A;  2QA4 3;  3JUQ A;  3EBY A;  3CPO A;  4N6M A;  3FGY A;  4R80 A;  3UL6 A;  1M90 4;  2P38 A;  2CWV A;  4I4K A;  4EC6 A;  2UX0 A;  5AEU B;  3H51 A;  4N6T A;  2P0X A;  1W6C A;  4HKV B;  2BMR B;  4L8O A;  1W01 A;  3FF2 A;  3BLZ A;  1V74 A;  2F98 A;  1NO3 A;  4HM0 B;  4MMY B;  2E2U A;  4XDW A;  1CQS A;  4X2H A;  4J8T A;  3DGN A;  4HM6 B;  5AIF A;  4AKZ A;  2YFJ B;  1JV2 B;  2CFW A;  3DXO A;  1TFK A;  1G96 A;  3F7S A;  3X3Z A;  1WNH A;  4H3U A;  1IT8 A;  4MMX B;  2FXT A;  2STD A;  1VQ7 3;  3EB8 A;  5IG3 A;  3CU3 A;  1RRH A;  1JB4 A;  2K0M A;  3JUM A;  4HZ9 B;  2CHC A;  1PU4 A;  4WFO A;  1VQ8 3;  1DYU A;  1L5G B;  2WGQ A;  4XBY A;  5CXO A;  2OCT A;  3K9M C;  3WOE B;  2XR8 B;  4R9K A;  3JUO A;  3CCL 3;  2W9Q A;  3FCS B;  3HZP A;  3GZB A;  3CCE 3;  4NRE A;  1AVL A;  4GL6 A;  4H61 A;  3CCV 3;  3PXM A;  3SVA A;  1GD3 A;  3Q2P A;  3HII A;  4FMB A;  4O2H A;  3QK9 A;  3VF1 A;  3ROB A;  1OGX A;  4R1K A;  3ER7 A;  1Q7Y 4;  5G2G A;  3MSO A;  2W9P A;  2F86 B;  3SOA A;  6STD A;  4N6L A;  1JJ2 2;  1LXE A;  1VQO 3;  2CW9 A;  5IG4 A;  5EVH A;  2OTJ 3;  3F40 A;  4HM1 B;  5STD A;  3BNB A;  3EX9 A;  1WMO A;  1U8C B;  1UW1 A;  2QGU A;  1JRQ A;  2XSO B;  4MMZ B;  2CK3 H;  3PYJ A;  3S28 A;  3HX8 A;  3S5C A;  4RNZ A;  1FGQ A;  1W02 A;  3LML A;  4MEI A;  1K73 4;  5AI1 A;  1M1K 4;  3O8Y A;  5AII A;  4R9L A;  1M1X B;  3CD6 3;  3N8B A;  1E3R A;  4CDL A;  1VQM 3;  1NWW A;  1ZX2 A;  1W2B 2;  2XRX B;  4Q53 A;  4FMC A;  1OUN A;  1IQX A;  2BHM A;  4HM7 B;  1DMQ A;  3KII A;  4XB5 A;  1F8N A;  1TFO A;  1W2Z A;  3HK4 A;  1S72 3;  3D9R A;  1NDO B;  5AYR B;  2XF3 A;  1QMA A;  2JQ5 A;  4FR9 A;  1WQL B;  2CG1 A;  5AEW B;  3B4O A;  1K28 A;  1ZO2 A;  1WMP A;  1N5P A;  2PNC A;  3STD A;  1SQW A;  1M9G A;  4N6O B;  1UUW B;  1LVN A;  5JBS A;  3MYT A;  3LZA A;  4RNY A;  1DMN A;  4JRF A;  1IVX A;  2RFR A;  5IEO A;  4EV2 A;  2GEX A;  1O7G B;  1JKG B;  2CIU A;  1EQK A;  3LXU X;  1OF5 B;  1W4N A;  5DRE A;  3G4S 3;  4EV5 A;  1US1 A;  1IQ8 A;  3LTB A;  1KQS 2;  2PZV A;  1RKY A;  8CHO A;  3EJV A;  1ROA A;  4FCJ A;  4ORL A;  3K5T A;  2KCD A;  3DGO A;  2W6J H;  4N6U A;  1MNL A;  3LTD A;  3LH4 A;  1N8R 4;  2WGO A;  1IT7 A;  2XH9 A;  1YIT 3;  2D1W A;  3U1W A;  3NBB A;  1IVW A;  3NQY A;  3OWY A;  2E2T A;  3LTA A;  4GB5 A;  2W04 A;  5AIH A;  3CC4 3;  3VGN A;  1MOL A;  5CK6 A;  1W00 A;  4FCZ A;  3MPH A;  2HMM B;  2GBW B;  5TGN A;  3DY5 A;  3NX0 A;  2LQV A;  4HBR A;  5D81 A;  4K61 A;  3NM2 A;  2RGQ A;  4LSO A;  1A90 A;  1OGZ A;  3X3Y A;  3UNL A;  4QWT A;  1EKM A;  2QEX 3;  3V92 A;  4WP5 A;  2BT3 A;  3EBT A;  3I56 3;  1AV4 A;  4OVM A;  4OK0 A;  3K7C A;  4FCM A;  3BNC A;  3UJM A;  1TUH A;  3AMO A;  1RN7 A;  3NUV A;  2LYX A;  3BNE A;  3LT8 A;  3UL5 A;  1S5A A;  1A67 A;  1N9J A;  5HGR A;  1PFP A;  2ML6 A;  3SOY A;  1VQL 3;  2WOF A;  4KFE A;  1Z1S A;  3EF8 A;  1JN5 A;  1JKG A;  1QJG A;  1J2B A;  5IG0 A;  2XGN A;  1KSI A;  1GYB A;  1C7H A;  1CYV A;  2HMJ B;  2BMO B;  2FGT A;  2KXG A;  3GZX B;  3MWZ A;  1QVG 2;  1FGT A;  1Q81 4;  3LYG A;  3F9S A;  4XBT A;  2BMQ B;  2R4I A;  3S27 A;  2D42 A;  2W03 A;  3OX9 A;  4HZB B;  5D83 A;  1O7P B;  4HM5 B;  4OUQ A;  1YJN 3;  1Y4K A;  1O7M B;  3MG1 A;  2JDI H;  3MHE A;  1BUQ A;  4U13 A;  3H3H A;  3CC7 3;  3RDE A;  3S67 A;  1VQ4 3;  1IVV A;  3NHX A;  2CC3 A;  1KC8 4;  1HKX A;  1STD A;  5BVB A;  1IK3 A;  3SED A;  1NU3 A;  3KFQ C;  1NJI 4;  1YJ9 3;  2HML B;  3CCU 3;  3JUP A;  4WYK B;  3IMA B;  3WOF B;  1ULJ B;  3OV4 A;  1VQP 3;  3B4P A;  1UI7 A;  4KFF A;  5IF6 A;  4HM2 B;  5CF1 A;  3ALA A;  2Y74 A;  4BTY A;  1LOX A;  1Q40 B;  2K54 A;  4WHA A;  4CCV A;  2P09 A;  5IER A;  4TX4 A;  3SLU A;  1IU7 A;  3F8X A;  5AIG A;  5AYS C;  3QRD A;  3E99 A;  4K1U A;  3M8C A;  3K0Z A;  2W56 B;  5JPU A;  4RZM A;  5IEN A;  5FW5 A;  1D6Z A;  3FG3 A;  1SPU A;  3EE1 A;  3CXC 2;  1IQY A;  4FMA A;  3NQZ A;  3DGM A;  1W6G A;  1FGM A;  4RBN A;  1IV9 A;  2IUJ A;  1GY7 A;  2Q07 A;  3PCS A;  3NBR A;  1QAK A;  1QAF A;  1AVK A;  1W7C A;  1W6Y A;  3KSE D;  3TDG A;  2ZDJ A;  4STD A;  3FSD A;  1N5H A;  2YX9 A;  1O7N B;  2OQE A;  3VSY A;  1YJW 3;  4XDV A;  2KRT A;  1WMN A;  2B24 B;  3DUK A;  1E3V A;  4O3V A;  1D6Y A;  2INX A;  1CEW I;  3OWS A;  2C10 A;  3EN1 B;  2QIY A;  3KN4 A;  4BTX A;  3FG1 A;  5FGO A;  3SXX A;  2Z77 A;  5KP4 A;  2W2C A;  2O3O A;  3FF0 A;  1FGO A;  1UUV B;  4HVN A;  1OPY A;  2W0Q A;  3FG4 A;  2CFK A;  3IJE B;  3OWU A;  3G6E 3;  2OWP A;  1JB5 A;  3CCM 3;  4FMD A;  5BXQ A;  4WYK A;  5CLK A;  1A2K A;  4KVH A;  3F14 A;  3L0R A;  3NM7 A;  3WDG B;  3X42 A;  4KFD A;  2CFG A;  3CCR 3;  1DVD A;  1GD4 A;  2HMN B;  3JVC A;  1VQN 3;  2P0M A;  1TP6 A;  1CYU A;  4HM3 B;  5DRV A;  1GY6 A;  2CFL A;  2F99 A;  5CF2 A;  5I97 A;  3MG2 A;  3PGB A;  3X40 A;  1JNQ A;  3GWR A;  4MJD A;  1YIJ 3;  2W56 A;  1D6U A;  5IEP A;  3CCS 3;  3N54 B;  2CWU A;  4JF8 A;  3EHC A;  1DVC A;  3CCJ 3;  3JUN A;  4LZI A;  3DMC A;  1A2V A;  3D3L A;  3I0Y A;  3F8H A;  3IPT A;  5ELJ A;  2CG0 A;  1W5Z A;  4L8P A;  3CCQ 3;  3DZL A;  1NB5 I;  1N8Q A;  3MKI A;  3EQQ B;  3CC2 3;  1IDP A;  5KP1 A;  2GXF A;  2GU3 A;  1U5O A;  4G1M B;  3LOY A;  4N3V A;  2IA7 A;  4EBG A;  3K63 A;  4X2O A;  4K90 B;  4EXR A;  2XGL A;  2IMJ A;  2CH9 A;  3SX1 A;  1SIH A;  2C11 A;  3Q1C A;  3EN8 A;  3WOD G;  3Q90 A;  1VZZ A;  2GU1 A;  1KWI A;  1OF5 A;  3PS8 A;  4O8S A;  3BB9 A;  1OHP A;  1OCV A;  3ECF A;  2ZL8 A;  3KE7 A;  3CMA 3;  2GBX B;  4IT7 A;  3F7X A;  3N9H A;  4LMI A;  2M7O A;  3GAX A;  3S29 A;  3WA3 A;  5KP3 A;  5A0O B;  1YVB I;  3CPW 2;  3LT9 A;  4HYZ A;  4K1V A;  1NB3 I;  2MC8 A;  3X3X A;  2WO0 A;  3PCR A;  2A15 A;  2FNQ A;  2CKF B;  3HI7 A;  2BO9 B;  1OHS A;  2OOV A;  2V1L A;  1VQ9 3;  3U97 A;  1QVF 2;  1HU9 A;  1UI8 A;  1O7H B;  2OOV C;  4AEQ A;  1FGR A;  1Q42 A;  3GRD A;  1R4C A;  4AKY A;  3EC9 A;  2HMO B;  2ML5 A;  1RRL A;  3MG3 A;  1GS3 A;  4LGQ A;  4HM4 B;  3T8U A;  5JPP A;  2Z76 A;  1YHQ 3;  5IG5 A;  1TIJ A;  2P05 A;  3WMD A;  1IV7 A;  1RJO A;  4XM4 A;  3RGR A;  4O02 B;  1T5Y A;  3V98 A;  3T0U A;  1K8A 4;  2HMK B;  3G8Z A;  1K41 A;  1SII A;  4NHF A;  1YGE A;  3FLJ A;  1OHO A;  3GZY B;  3LTC A;  5EEO A;  1IVU A;  2GEY A;  5D82 A;  5LC7 A;  3NV0 B;  1YI2 3;  1EG9 B;  2YFI B;  3KZT A;  3G71 3;  2SBL A;  4PEJ A;  3OXA A;  5ELU A;  1DMM A;  4N6V 0;  1SJW A;  1Q82 4;  3KKG A;  4R4K A;  1JB2 A;  2MF7 A;  2WOH A;  3FKA A;  2L4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...