3CCV3

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ccv300
3CMA3 3G713 3CXC2 2OTJ3 3CD63 3CCU3 3I563 3CCM3 3CCL3 3CME3 1VQ73 1YJ93 1N8R4 1VQ43 1M1K4 3I553 3CCS3 3CC23 1YHQ3 3G4S3 3CC43 1VQL3 1QVG2 1VQ53 1VQP3 1KC84 3CCR3 1JJ22 1VQ93 2QA43 1VQN3 1Q824 2OTL3 1YI23 2QEX3 1VQ63 3CC73 3OW22 3G6E3 1YJN3 1K8A4 1QVF2 1VQM3 3CCJ3 1YIJ3 1VQK3 1VQ83 1NJI4 1S723 1KD14 3CCE3 1YIT3 1Q814 1M904 3CPW2 3CCV3 1W2B2 3CCQ3 1YJW3 1K734 1K9M4 1Q864 1KQS2 1VQO3 1Q7Y4
chains in the Genus database with same CATH superfamily
1JBRA 4RNTA 2FXTA 4XM4A 6GSPA 2KF6A 4EYCA 3L0RA 3VF1A 3UL6A 1GSPA 1AVKA 2BNGA 4CJNA 2CHCA 1UDII 3D9RA 5KP3A 1ZS7A 3FGYA 2HMMB 3TDGA 3N54B 1BRKA 1RJOA 4HM8B 1OF5A 1RGLA 1N8QA 4KFFA 4RNYA 5EQLA 1HYFA 1VQ83 1EKMA 1AQZA 1X1YA 1UI7A 1CEWI 1BGSA 4HZBB 5AEUB 3H3HA 5AIHA 1O7NB 5DREA 4MMYB 3D5IA 3IPTA 2LQVA 3KZTA 2JQ5A 1JB5A 3E99A 5FW5A 1BOXA 1ISKA 3LTDA 1MWTA 3DZLA 1IQ8A 2FNQA 1BSBA 2KCDA 3F9SA 2F98A 3GSPA 3LT8A 1KC84 3EBYA 4K90B 1US1A 4FCZA 4HM2B 1SIIA 1JKGB 2KF3A 3F8HA 3BNBA 4DKIA 1RGCA 4JRFA 2GBWB 4MEIA 2MC8A 2XR8B 3DGNA 4RNZA 4RZMA 1CYVA 1VQK3 2XRXB 4CCVA 2LYXA 2R4IA 3DH2A 1BRJA 1OHSA 1M1XB 2CKFB 1D6UA 2V1LA 1DE3A 2D1WA 4GSPA 2SARA 3I563 2KXGA 3UNLA 3U97A 2OOVC 1WTHA 4J9AA 1UUWB 3DGLA 2CWUA 4EXRA 4J8TA 2UX0A 2CG0A 5IEOA 1BANA 1O7PB 3S67A 3T0UA 1TRPA 1ZO2A 2C10A 1G02A 1B2ZA 1M9GA 1SJWA 2B1XB 4LEHA 5BU4A 3OXAA 1RN4A 3PZWA 4HM5B 1RTUA 3OWYA 1G96A 4STDA 1AV4A 1SIHA 1D6ZA 4BTYA 1FGOA 2UUGC 5EVHA 3DM8A 1JN5B 5CK6A 4EV5A 5BXQA 3D3LA 4K61A 3WHOA 2W56A 5EEOA 3CPW2 1PY3A 3D5GA 1K9M4 2GU3A 1AR0A 2YFLB 3FKAA 1HU9A 1RN7A 3QRDA 3RNTA 3T8NA 1VQO3 5D81A 3G713 2PNCA 2ZDJA 3IMAB 2GSPA 3I553 4JF8A 2O9UX 2IY2A 3MG2A 1FUWA 1UCLA 1SPUA 4IIAA 5ELUA 3SOAA 1EQKA 8RNTA 2RSXA 2CW9A 4I4KA 3NHXA 2XFTA 2OTL3 1BUQA 2K0MA 5BIRA 2XF3A 1HZ1A 1N9EA 1X1XA 3AHSA 2QEX3 1BNIA 1JBTA 1TJDA 1BRSA 1LVNA 2STDA 1TUHA 1I3IA 1FGMA 2W6JH 3V92A 2K54A 3HZPA 3STDA 3DUKA 3BB9A 3X41A 4Q53A 2MF7A 2RNTA 3NBRA 4LSOA 1K734 1LXEA 5IEPA 1MOLA 4HM7B 1ULIB 5G1LA 4N6NB 1IQXA 5AEWB 1LQGC 7STDA 5G1KA 3O8YA 3ROBA 1BRGA 4OUQA 4BTXA 3WODG 3CU3A 4O3VA 1JN5A 2F56A 4N3VA 1OCVA 3G4S3 4GB5A 4EC6A 1SARA 1E97A 3BLZA 1LOVA 1IV7A 3D79A 3CPOA 3FSDA 3Q1CA 3D4AA 1T3BA 1YVSA 3CC73 5M1AA 3S29A 7GSPA 5IG4A 2PZVA 3JUPA 5M18A 3DGOA 3FLJA 3K5TA 3JUNA 3S27A 3CCJ3 1RNBA 4N6UA 2GEXA 4RBNA 1NJI4 1OHPA 4HM4B 1RKYA 1B2SA 3EN8A 5JBSA 1YJW3 2ZL8A 3SYUA 3FF0A 1TTOA 3RGRA 3S5CA 1VQQA 3LXUX 3NX0A 1IDPA 1FGRA 4FCMA 2D42A 4HBRA 5IF6A 1RCLA 2CIUA 1B20A 3PCRA 2CX0A 1OGZA 1O7WB 3G0KA 1VZZA 3FG4A 3MKIA 2F99A 2RFRA 3EX9A 1Z1SA 2H0GA 3SVAA 1EG9B 1OH0A 2J8XB 3DGMA 4BL3A 1FUTA 3MWZA 1YJN3 8CHOA 1LOXA 1RRLA 2KAAA 2Z76A 1YIT3 1LOYA 3HIIA 2L1SA 3NQZA 2W9QA 1IT8A 2H0HA 4R4KA 3EF8A 3QK9A 4MJDA 1JKGA 3JUOA 4K1VA 4LMIA 2CG1A 1FA3A 1MWSA 1WMNA 1RMSA 3NM2A 4EV2A 1GS3A 4XDVA 3CCS3 1I8VA 1K28A 9RNTA 3GRDA 4OK0A 3F40A 3LMLA 4NHFA 2H0IA 1BSDA 4XBTA 3BU4A 3DXOA 5GSPA 4J5GA 1IT7A 1RNTA 3WOFB 1IYYA 1GY6A 3SOYA 1GD3A 1FGTA 3PYJA 1A2KA 1TP6A 1LQMB 3LT9A 1LNHA 4N6LA 3CCE3 1DYUA 1TFOA 3FG3A 1BAOA 2W56B 1BSEA 2BU4A 1DETA 3GAXA 3BIRA 3HOHA 6STDA 2C11A 4HZ9B 1T2HA 4TX4A 1F8NA 1NWWA 1RGFA 3FF2A 3VSYA 1PYLA 1YVBI 1BU4A 1DMNA 3JUQA 3HK4A 2FGTA 3NV0B 3CCU3 2INXA 5IG3A 3CME3 1VQ73 3A76A 2GU1A 2OCTA 2HMKB 4HOHA 1GMPA 3EB8A 3N8BA 5CF2A 1BSCA 1JB4A 1UUGB 1C7HA 5M19A 1U5OA 2Z77A 4HM6B 1VQ53 1NDOB 3EJVA 1RN1A 4KVHA 4QWTA 5D82A 3HI7A 3LYGA 1QALA 3OX9A 4LGQA 5AYRB 2YFIB 1GY7A 2HOHA 4L7KA 4AKYA 2F5MA 1A2VA 3I0YA 1OHOA 2M7OA 1W5ZA 3MG3A 3K7CA 1CH0A 3M8CA 1W01A 4FR9A 1Q7HA 1K8A4 1W7CA 1GMQA 1KD14 1I3FA 3X40A 2L4VA 1W2B2 1BNRA 4GHOA 1DVDA 4X2OA 2Y73A 1BNFA 3RGAA 3CXC2 1NU3A 3NBBA 1UI8A 3MSOA 5AI1A 2W04A 2KRTA 1BNEA 1VQ43 2CFKA 4N6V0 5KP1A 3UB1A 1YHQ3 1STDA 1ROVA 2BMRB 2CX1A 3CCM3 1STFI 1JZOA 3KKGA 1A67A 1D6YA 1WNHA 1WQLB 2OWPA 3GWRA 2F86B 1DMQA 3PCSA 3NM7A 4IPBA 1UUVB 1MGRA 1MWRA 1LNIA 3JVCA 1X1UA 4KZ1A 1I0XA 2KF4A 3B4OA 1N9JA 2W9PA 1BNSA 3HX8A 3DGYA 1RGGA 4CPKA 5RNTA 5JPUA 1CQSA 2Z7AA 2BMOB 2Z6BA 1YGEA 1OUNA 2YX9A 3KIIA 1GD4A 3NV0A 2BIRA 3AMOB 4R80A 3AHWA 3EQQB 3OWUA 3FCSB 1WMPA 1IVWA 1QMAA 3CC43 1VQL3 1RGAA 1QVG2 4AKZA 3X42A 2QA43 2P05A 3B8LA 1W6GA 4IT7A 3BNCA 1A90A 3SLUA 3BNEA 3EE1A 2OOVA 1JBSA 1EUIC 3DMCA 2I9WA 1IK3A 1C54A 2GEYA 4BIRA 4MMXB 3SXXA 1FW7A 2F4YA 3WA3A 1OACA 3ECFA 2XSOB 4HAAA 3Q3FA 1KQS2 1PFPA 1Q7Y4 1RLSA 4KFDA 2CH9A 3CD63 2RBIA 1J2BA 5I97A 3G8ZA 1W02A 4WHAA 1V58A 3ER7A 3CCL3 1AY7A 2XH9A 3EC9A 1W6YA 3V99A 5IERA 1VQP3 1HKXA 4HYZA 3HIGA 2E2UA 3WOEB 1Q824 3RDEA 2W2CA 2XEPA 2GBXB 1IQYA 1UGIA 4WYKB 3G6E3 3JUMA 3F14A 4HM1B 1JV2B 3V98A 4LZIA 1I2GA 2IYJA 3Q90A 5JPPA 5KP4A 2BO9B 3AMOA 3LTAA 4N6OB 1A2PA 5A0OB 4LYLB 1RCKA 2Y74A 1FUSA 5FGOA 1Q814 1B21A 1RGKA 1UCIA 1TRQA 4EW5A 1OPYA 5AIIA 3MYTA 3LZAA 1LRAA 1V74A 5CF1A 5AIFA 3KSED 1UGHI 1UW1A 2CWTA 2P0MA 3NXJA 4R9KA 1GY5A 3EN1B 3ZFZA 2QGUA 2WOHA 4KT3B 1SQWA 5D83A 3ZG5A 1BUJA 1S5AA 2UGIA 1R4CA 2HMOB 1K41A 1VQN3 4XDWA 2AADA 2C4BA 2OQEA 1E3RA 3CNXA 2WGOA 2O3OA 3K63A 1IV9A 3BNDA 5DRVA 5HGRA 2CC3A 4WFOA 2CFDA 2Q07A 4K1UA 1DMMA 5IG5A 4HM0B 3SEDA 1PU4A 1B27A 2BT3A 3AGOA 3G16A 3S28A 1G0TA 1ZX2A 1QJGA 2BMQB 4U13A 1OGXA 3B4PA 2QIYA 4FMCA 3CMA3 2OTJ3 1O7HB 1RDSA 1UCKA 1BSAA 4CDLA 1IVVA 2W03A 2CFWA 1N8R4 1Q40B 4H61A 4XBXA 1N5HA 2YFJB 4FMAA 3VGNA 3IJEB 1MGWA 3LTBA 3X3YA 2WOFA 1I2FA 1RSNA 3CC23 1BNJA 1IVXA 2A15A 5LC6A 3U1WA 1W4NA 1BRHA 1VQ93 1IVUA 1TFKA 3NUVA 3ZG0A 3LOYA 1GOVA 1GMRA 1MNLA 3FZWA 3OWSA 4GL6A 4R1KA 3GZYB 1BNGA 4R9LA 2ML6A 2E2VA 4NPBA 4WYKA 1LOWA 4ILFA 3PS8A 4HM3B 2WO0A 2RCDA 1BIRA 3GZRA 1EA2A 1KSIA 1I70A 1B2UA 3H51A 4FCJA 1I2EA 4O8SA 3DY5A 1NNVA 4KFEA 5CXOA 5LC7A 1FYSA 1L5GB 3PXMA 3J7Yd 1Q864 3ALAA 2P09A 4L8PA 5IW9A 2E2TA 1N5PA 5TGNA 3X3ZA 2CK3H 2XGNA 3B7CA 2ZA4A 1EEJA 2XFSA 1BRNL 1ULJB 3KFQC 3F7XA 1ZGXA 1QAFA 1Y4KA 2HMJB 3LTCA 5CLKA 3WMDA 1AVLA 1QAKA 1Q9EA 4I5QA 1YNVX 3WA2X 1UCJA 1QVF2 3AGNA 1FGQA 1VQM3 2IUJA 4BTWA 4N6MA 3OV4A 5IG0A 7RNTA 1B2MA 4WWUC 5ELJA 1CYUA 3N9HA 2R41A 3KCHA 3Q2PA 1NB3I 3CCV3 1JNQA 5G2GA 2HMLB 4WP5A 2HMNB 3FH1A 1R4YA 4HJLB 4J5KA 1X1WA 1NB5I 1T2IA 4FMDA 1W2ZA 5AIGA 2GXFA 3LH4A 1O7MB 4BL2A 1IU7A 3URPA 1M1K4 5HOHA 2BHMA 1DVCA 4ZM8A 1Q40A 3CNMA 3K9MC 2P0XA 3F8XA 4L8OA 3WDGB 2ML5A 1JRQA 2CFLA 1W00A 5IENA 3MPHA 1ASKA 1RGEA 2XGLA 5STDA 1YI23 1U8CB 3OW22 3WR2A 1RHLA 2CWVA 4H3UA 1B2XA 4MMZB 1T5YA 2IA7A 1YIJ3 1KWIA 6RNTA 1S723 1MWUA 4O2HA 2KF5A 1M904 1W6CA 3NQYA 2P38A 4HKVB 1BVIA 3CCQ3 4BU4A 4OVMA 1GOYA 2SBLA 3K0ZA 5BVBA 1TIJA 3F7SA 1WMOA 3KSPA 3UJMA 4AEQA 1B3SA 4X2HA 1GOUA 2IUKA 4FMBA 1OF5B 2B24B 3GZXB 1YJ93 1ROAA 3UL5A 3KN4A 3PGBA 1GYBA 1O7GB 3MHEA 4ORLA 3EHCA 2JDIH 4XB5A 3SX1A 1Q42A 1JZDA 2K3DA 1FZUA 3NBJA 3A5EA 1BRIA 2F5WA 3T8UA 3CCR3 1JJ22 2WGQA 3KE7A 4XBYA 2ZHXB 3MG1A 1NO3A 1YGWA 1JB2A 2XSHB 4EBGA 3X3XA 1E3VA 3FG1A 1RGHA 1V57A 2RGQA 4O02B 4PEJA 1RRHA 2AAEA 1I0VA 1VQ63 4HVNA 3EBTA 2W0QA 1TU5A 2CFGA 4N6TA 2IMJA 4G1MB 3GZBA 5AYSC 2OQEC 4NREA
chains in the Genus database with same CATH topology
2FXTA 4XM4A 4EYCA 3L0RA 3VF1A 3UL6A 2BNGA 1AVKA 2CHCA 3D9RA 5KP3A 3FGYA 2HMMB 3TDGA 3N54B 1RJOA 4HM8B 1OF5A 1N8QA 4KFFA 4RNYA 5EQLA 1VQ83 1EKMA 1UI7A 1CEWI 4HZBB 5AEUB 3H3HA 5AIHA 1O7NB 5DREA 4MMYB 3IPTA 2LQVA 3KZTA 2JQ5A 1JB5A 3E99A 5FW5A 1ISKA 3LTDA 3DZLA 1IQ8A 2FNQA 2KCDA 3F9SA 2F98A 3LT8A 1KC84 3EBYA 4K90B 1US1A 4FCZA 4HM2B 1SIIA 1JKGB 3F8HA 3BNBA 4JRFA 2GBWB 4MEIA 2MC8A 2XR8B 3DGNA 4RNZA 4RZMA 1CYVA 1VQK3 2XRXB 4CCVA 2LYXA 2R4IA 1OHSA 1M1XB 2CKFB 1D6UA 2V1LA 2D1WA 3I563 2KXGA 3UNLA 3U97A 2OOVC 1WTHA 4J9AA 1UUWB 3DGLA 2CWUA 4EXRA 4J8TA 2UX0A 2CG0A 5IEOA 1O7PB 3S67A 3T0UA 1ZO2A 2C10A 2OTL3 1M9GA 1SJWA 2B1XB 4LEHA 8CHOA 3OXAA 4HM5B 3PZWA 4STDA 3OWYA 1G96A 1AV4A 1SIHA 1D6ZA 4BTYA 1FGOA 5EVHA 3DM8A 1JN5B 5CK6A 4EV5A 5BXQA 3D3LA 4K61A 2W56A 5EEOA 3CPW2 1K9M4 2GU3A 1AR0A 2YFLB 3FKAA 1HU9A 1RN7A 3QRDA 3T8NA 1VQO3 5D81A 3G713 2PNCA 2ZDJA 3IMAB 3I553 4JF8A 2O9UX 3MG2A 1FUWA 4IIAA 1SPUA 5ELUA 3SOAA 1EQKA 2RSXA 2CW9A 4I4KA 3NHXA 2XFTA 1BUQA 2K0MA 2XF3A 2QEX3 1N9EA 1VQ63 1LVNA 2STDA 1TUHA 1FGMA 2W6JH 3V92A 2K54A 3HZPA 3STDA 3DUKA 3BB9A 3X41A 4Q53A 2MF7A 3NBRA 4LSOA 1K734 1LXEA 5IEPA 1MOLA 4HM7B 1ULIB 4N6NB 1IQXA 5AEWB 7STDA 3O8YA 3ROBA 4OUQA 4BTXA 3WODG 3CU3A 4O3VA 1JN5A 4N3VA 1OCVA 3G4S3 4GB5A 4EC6A 1E97A 3BLZA 1IV7A 3FSDA 3CPOA 3Q1CA 3CC73 3S29A 5IG4A 2PZVA 3JUPA 3DGOA 3FLJA 3K5TA 3JUNA 3S27A 3CCJ3 4N6UA 2GEXA 4RBNA 1NJI4 1OHPA 4HM4B 1RKYA 3EN8A 5JBSA 1YJW3 2ZL8A 3FF0A 3RGRA 3S5CA 3LXUX 3NX0A 1IDPA 1FGRA 4FCMA 2D42A 4HBRA 5IF6A 3PCRA 2CIUA 1OGZA 1O7WB 3G0KA 1VZZA 3FG4A 3MKIA 2F99A 2RFRA 3EX9A 1Z1SA 3SVAA 1EG9B 1OH0A 3DGMA 3MWZA 1YJN3 1LOXA 1RRLA 2Z76A 1YIT3 3HIIA 3NQZA 2W9QA 1IT8A 4R4KA 3EF8A 3QK9A 4MJDA 1JKGA 3JUOA 4K1VA 4LMIA 2CG1A 1FA3A 1WMNA 3NM2A 4EV2A 1GS3A 4XDVA 3CCS3 1K28A 3GRDA 4OK0A 3F40A 3LMLA 4NHFA 4XBTA 3DXOA 1IT7A 3WOFB 1GY6A 3SOYA 1GD3A 1FGTA 3PYJA 1A2KA 1TP6A 3LT9A 1LNHA 4N6LA 3CCE3 1DYUA 1TFOA 3FG3A 2W56B 5JPUA 3GAXA 6STDA 2C11A 4HZ9B 4TX4A 1F8NA 1NWWA 3FF2A 3VSYA 1YVBI 1DMNA 3JUQA 3HK4A 2FGTA 3NV0B 3CCU3 2INXA 5IG3A 3CME3 1VQ73 3A76A 2GU1A 2OCTA 2HMKB 3EB8A 3N8BA 5CF2A 1JB4A 1C7HA 1U5OA 2Z77A 4HM6B 1VQ53 1NDOB 3EJVA 4KVHA 4QWTA 5D82A 3HI7A 3LYGA 1QALA 3OX9A 4LGQA 5AYRB 2YFIB 1GY7A 4L7KA 4AKYA 1A2VA 3I0YA 1OHOA 2M7OA 1W5ZA 3MG3A 3K7CA 3M8CA 4FR9A 1W01A 1K8A4 1W7CA 1KD14 3X40A 2L4VA 1W2B2 1DVDA 4X2OA 2Y73A 3RGAA 3CXC2 1NU3A 3NBBA 1UI8A 3MSOA 5AI1A 2W04A 2KRTA 1VQ43 2CFKA 4N6V0 5KP1A 3UB1A 1YHQ3 1STDA 1ROVA 2BMRB 1STFI 3KKGA 1A67A 1D6YA 1WNHA 1WQLB 2OWPA 3GWRA 2F86B 1DMQA 3PCSA 3NM7A 4IPBA 1UUVB 3JVCA 4KZ1A 3B4OA 1N9JA 2W9PA 3HX8A 1CQSA 2Z7AA 2BMOB 2Z6BA 1YGEA 1OUNA 2YX9A 3KIIA 1GD4A 3NV0A 3AMOB 4R80A 3OWUA 3EQQB 3FCSB 1WMPA 1IVWA 1QMAA 3CC43 1VQL3 1QVG2 4AKZA 3X42A 2QA43 2P05A 3B8LA 1W6GA 4IT7A 3BNCA 1A90A 3SLUA 3BNEA 3EE1A 2OOVA 3DMCA 2I9WA 1IK3A 2GEYA 4MMXB 3SXXA 3WA3A 1OACA 3ECFA 2XSOB 1KQS2 1PFPA 1Q7Y4 4KFDA 2CH9A 3CD63 1J2BA 5I97A 3G8ZA 1W02A 4WHAA 3CCL3 3ER7A 2XH9A 3EC9A 1W6YA 3V99A 5IERA 1VQP3 1HKXA 4HYZA 3HIGA 2E2UA 3WOEB 1Q824 3RDEA 2W2CA 2XEPA 2GBXB 1IQYA 4WYKB 3G6E3 3JUMA 3F14A 4HM1B 1JV2B 3V98A 4LZIA 3Q90A 5JPPA 5KP4A 2BO9B 3AMOA 3LTAA 4N6OB 5A0OB 2Y74A 5FGOA 1Q814 1OPYA 5AIIA 3MYTA 3LZAA 1V74A 5CF1A 5AIFA 3KSED 1UW1A 2CWTA 2P0MA 3NXJA 4R9KA 1GY5A 3EN1B 3CCM3 2QGUA 2WOHA 1SQWA 5D83A 1S5AA 1R4CA 2HMOB 1K41A 1VQN3 4XDWA 2OQEA 1E3RA 3CNXA 2WGOA 2O3OA 3K63A 3BNDA 1IV9A 5DRVA 5HGRA 2CC3A 4WFOA 2CFDA 2Q07A 4K1UA 1DMMA 5IG5A 4HM0B 3SEDA 1PU4A 2BT3A 3G16A 3S28A 1ZX2A 1QJGA 2BMQB 4U13A 1OGXA 3B4PA 2QIYA 4FMCA 3CMA3 2OTJ3 1O7HB 4CDLA 1IVVA 2W03A 2CFWA 1N8R4 1Q40B 4H61A 4XBXA 1N5HA 2YFJB 4FMAA 3VGNA 3IJEB 3LTBA 3X3YA 2WOFA 3CC23 2A15A 1IVXA 5LC6A 3U1WA 1W4NA 1VQ93 1IVUA 1TFKA 3NUVA 3LOYA 1MNLA 3FZWA 3OWSA 4R1KA 4GL6A 3GZYB 4R9LA 2ML6A 2E2VA 4WYKA 3PS8A 4HM3B 2WO0A 2RCDA 3GZRA 1EA2A 1KSIA 3H51A 4FCJA 4O8SA 3DY5A 4KFEA 5CXOA 5LC7A 1L5GB 3J7Yd 1Q864 3PXMA 3ALAA 2P09A 4L8PA 5IW9A 2E2TA 1N5PA 5TGNA 3X3ZA 2XGNA 2CK3H 3B7CA 2XFSA 1ULJB 3KFQC 3F7XA 1QAFA 1Y4KA 2HMJB 3LTCA 5CLKA 3WMDA 1AVLA 1QAKA 3WA2X 1QVF2 1VQM3 1FGQA 2IUJA 4BTWA 4N6MA 3OV4A 5IG0A 1CYUA 4WWUC 5ELJA 3N9HA 3Q2PA 1NB3I 3CCV3 1JNQA 5G2GA 2HMLB 4WP5A 2HMNB 3FH1A 4HJLB 1NB5I 5AIGA 4FMDA 1W2ZA 2GXFA 3LH4A 1O7MB 1IU7A 1M1K4 2BHMA 1DVCA 4ZM8A 1Q40A 3CNMA 3K9MC 2P0XA 3F8XA 4L8OA 3WDGB 2ML5A 1JRQA 2CFLA 1W00A 5IENA 3MPHA 1ASKA 2XGLA 5STDA 1YI23 1U8CB 3OW22 2CWVA 4MMZB 4H3UA 1T5YA 2IA7A 1YIJ3 1KWIA 1S723 4O2HA 1M904 1W6CA 3NQYA 2P38A 4HKVB 3CCQ3 4OVMA 2SBLA 3K0ZA 5BVBA 1TIJA 3F7SA 1WMOA 3KSPA 3UJMA 4AEQA 4X2HA 4FMBA 2IUKA 1OF5B 2B24B 3GZXB 1YJ93 1ROAA 3UL5A 3KN4A 3PGBA 1GYBA 1O7GB 3MHEA 4ORLA 3EHCA 2JDIH 4XB5A 3SX1A 1Q42A 3NBJA 3T8UA 3CCR3 1JJ22 2WGQA 3KE7A 4XBYA 3MG1A 1NO3A 1JB2A 2XSHB 4EBGA 3X3XA 1E3VA 3FG1A 2RGQA 4O02B 4PEJA 1RRHA 4HVNA 3EBTA 2W0QA 1TU5A 2CFGA 4N6TA 2IMJA 4G1MB 3GZBA 5AYSC 2OQEC 4NREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA 3;  3G71 3;  3CXC 2;  2OTJ 3;  3CD6 3;  3CCU 3;  3I56 3;  3CCM 3;  3CCL 3;  3CME 3;  1VQ7 3;  1YJ9 3;  1N8R 4;  1VQ4 3;  1M1K 4;  3I55 3;  3CCS 3;  3CC2 3;  1YHQ 3;  3G4S 3;  3CC4 3;  1VQL 3;  1QVG 2;  1VQ5 3;  1VQP 3;  1KC8 4;  3CCR 3;  1JJ2 2;  1VQ9 3;  2QA4 3;  1VQN 3;  1Q82 4;  2OTL 3;  1YI2 3;  2QEX 3;  1VQ6 3;  3CC7 3;  3OW2 2;  3G6E 3;  1YJN 3;  1K8A 4;  1QVF 2;  1VQM 3;  3CCJ 3;  1YIJ 3;  1VQK 3;  1VQ8 3;  1NJI 4;  1S72 3;  1KD1 4;  3CCE 3;  1YIT 3;  1Q81 4;  1M90 4;  3CPW 2;  3CCV 3;  1W2B 2;  3CCQ 3;  1YJW 3;  1K73 4;  1K9M 4;  1Q86 4;  1KQS 2;  1VQO 3;  1Q7Y 4; 
#chains in the Genus database with same CATH topology
 1JBR A;  4RNT A;  2FXT A;  4XM4 A;  6GSP A;  2KF6 A;  4EYC A;  3L0R A;  3VF1 A;  3UL6 A;  1GSP A;  1AVK A;  2BNG A;  4CJN A;  2CHC A;  1UDI I;  3D9R A;  5KP3 A;  1ZS7 A;  3FGY A;  2HMM B;  3TDG A;  3N54 B;  1BRK A;  1RJO A;  4HM8 B;  1OF5 A;  1RGL A;  1N8Q A;  4KFF A;  4RNY A;  5EQL A;  1HYF A;  1VQ8 3;  1EKM A;  1AQZ A;  1X1Y A;  1UI7 A;  1CEW I;  1BGS A;  4HZB B;  5AEU B;  3H3H A;  5AIH A;  1O7N B;  5DRE A;  4MMY B;  3D5I A;  3IPT A;  2LQV A;  3KZT A;  2JQ5 A;  1JB5 A;  3E99 A;  5FW5 A;  1BOX A;  1ISK A;  3LTD A;  1MWT A;  3DZL A;  1IQ8 A;  2FNQ A;  1BSB A;  2KCD A;  3F9S A;  2F98 A;  3GSP A;  3LT8 A;  1KC8 4;  3EBY A;  4K90 B;  1US1 A;  4FCZ A;  4HM2 B;  1SII A;  1JKG B;  2KF3 A;  3F8H A;  3BNB A;  4DKI A;  1RGC A;  4JRF A;  2GBW B;  4MEI A;  2MC8 A;  2XR8 B;  3DGN A;  4RNZ A;  4RZM A;  1CYV A;  1VQK 3;  2XRX B;  4CCV A;  2LYX A;  2R4I A;  3DH2 A;  1BRJ A;  1OHS A;  1M1X B;  2CKF B;  1D6U A;  2V1L A;  1DE3 A;  2D1W A;  4GSP A;  2SAR A;  3I56 3;  2KXG A;  3UNL A;  3U97 A;  2OOV C;  1WTH A;  4J9A A;  1UUW B;  3DGL A;  2CWU A;  4EXR A;  4J8T A;  2UX0 A;  2CG0 A;  5IEO A;  1BAN A;  1O7P B;  3S67 A;  3T0U A;  1TRP A;  1ZO2 A;  2C10 A;  1G02 A;  1B2Z A;  1M9G A;  1SJW A;  2B1X B;  4LEH A;  5BU4 A;  3OXA A;  1RN4 A;  3PZW A;  4HM5 B;  1RTU A;  3OWY A;  1G96 A;  4STD A;  1AV4 A;  1SIH A;  1D6Z A;  4BTY A;  1FGO A;  2UUG C;  5EVH A;  3DM8 A;  1JN5 B;  5CK6 A;  4EV5 A;  5BXQ A;  3D3L A;  4K61 A;  3WHO A;  2W56 A;  5EEO A;  3CPW 2;  1PY3 A;  3D5G A;  1K9M 4;  2GU3 A;  1AR0 A;  2YFL B;  3FKA A;  1HU9 A;  1RN7 A;  3QRD A;  3RNT A;  3T8N A;  1VQO 3;  5D81 A;  3G71 3;  2PNC A;  2ZDJ A;  3IMA B;  2GSP A;  3I55 3;  4JF8 A;  2O9U X;  2IY2 A;  3MG2 A;  1FUW A;  1UCL A;  1SPU A;  4IIA A;  5ELU A;  3SOA A;  1EQK A;  8RNT A;  2RSX A;  2CW9 A;  4I4K A;  3NHX A;  2XFT A;  2OTL 3;  1BUQ A;  2K0M A;  5BIR A;  2XF3 A;  1HZ1 A;  1N9E A;  1X1X A;  3AHS A;  2QEX 3;  1BNI A;  1JBT A;  1TJD A;  1BRS A;  1LVN A;  2STD A;  1TUH A;  1I3I A;  1FGM A;  2W6J H;  3V92 A;  2K54 A;  3HZP A;  3STD A;  3DUK A;  3BB9 A;  3X41 A;  4Q53 A;  2MF7 A;  2RNT A;  3NBR A;  4LSO A;  1K73 4;  1LXE A;  5IEP A;  1MOL A;  4HM7 B;  1ULI B;  5G1L A;  4N6N B;  1IQX A;  5AEW B;  1LQG C;  7STD A;  5G1K A;  3O8Y A;  3ROB A;  1BRG A;  4OUQ A;  4BTX A;  3WOD G;  3CU3 A;  4O3V A;  1JN5 A;  2F56 A;  4N3V A;  1OCV A;  3G4S 3;  4GB5 A;  4EC6 A;  1SAR A;  1E97 A;  3BLZ A;  1LOV A;  1IV7 A;  3D79 A;  3CPO A;  3FSD A;  3Q1C A;  3D4A A;  1T3B A;  1YVS A;  3CC7 3;  5M1A A;  3S29 A;  7GSP A;  5IG4 A;  2PZV A;  3JUP A;  5M18 A;  3DGO A;  3FLJ A;  3K5T A;  3JUN A;  3S27 A;  3CCJ 3;  1RNB A;  4N6U A;  2GEX A;  4RBN A;  1NJI 4;  1OHP A;  4HM4 B;  1RKY A;  1B2S A;  3EN8 A;  5JBS A;  1YJW 3;  2ZL8 A;  3SYU A;  3FF0 A;  1TTO A;  3RGR A;  3S5C A;  1VQQ A;  3LXU X;  3NX0 A;  1IDP A;  1FGR A;  4FCM A;  2D42 A;  4HBR A;  5IF6 A;  1RCL A;  2CIU A;  1B20 A;  3PCR A;  2CX0 A;  1OGZ A;  1O7W B;  3G0K A;  1VZZ A;  3FG4 A;  3MKI A;  2F99 A;  2RFR A;  3EX9 A;  1Z1S A;  2H0G A;  3SVA A;  1EG9 B;  1OH0 A;  2J8X B;  3DGM A;  4BL3 A;  1FUT A;  3MWZ A;  1YJN 3;  8CHO A;  1LOX A;  1RRL A;  2KAA A;  2Z76 A;  1YIT 3;  1LOY A;  3HII A;  2L1S A;  3NQZ A;  2W9Q A;  1IT8 A;  2H0H A;  4R4K A;  3EF8 A;  3QK9 A;  4MJD A;  1JKG A;  3JUO A;  4K1V A;  4LMI A;  2CG1 A;  1FA3 A;  1MWS A;  1WMN A;  1RMS A;  3NM2 A;  4EV2 A;  1GS3 A;  4XDV A;  3CCS 3;  1I8V A;  1K28 A;  9RNT A;  3GRD A;  4OK0 A;  3F40 A;  3LML A;  4NHF A;  2H0I A;  1BSD A;  4XBT A;  3BU4 A;  3DXO A;  5GSP A;  4J5G A;  1IT7 A;  1RNT A;  3WOF B;  1IYY A;  1GY6 A;  3SOY A;  1GD3 A;  1FGT A;  3PYJ A;  1A2K A;  1TP6 A;  1LQM B;  3LT9 A;  1LNH A;  4N6L A;  3CCE 3;  1DYU A;  1TFO A;  3FG3 A;  1BAO A;  2W56 B;  1BSE A;  2BU4 A;  1DET A;  3GAX A;  3BIR A;  3HOH A;  6STD A;  2C11 A;  4HZ9 B;  1T2H A;  4TX4 A;  1F8N A;  1NWW A;  1RGF A;  3FF2 A;  3VSY A;  1PYL A;  1YVB I;  1BU4 A;  1DMN A;  3JUQ A;  3HK4 A;  2FGT A;  3NV0 B;  3CCU 3;  2INX A;  5IG3 A;  3CME 3;  1VQ7 3;  3A76 A;  2GU1 A;  2OCT A;  2HMK B;  4HOH A;  1GMP A;  3EB8 A;  3N8B A;  5CF2 A;  1BSC A;  1JB4 A;  1UUG B;  1C7H A;  5M19 A;  1U5O A;  2Z77 A;  4HM6 B;  1VQ5 3;  1NDO B;  3EJV A;  1RN1 A;  4KVH A;  4QWT A;  5D82 A;  3HI7 A;  3LYG A;  1QAL A;  3OX9 A;  4LGQ A;  5AYR B;  2YFI B;  1GY7 A;  2HOH A;  4L7K A;  4AKY A;  2F5M A;  1A2V A;  3I0Y A;  1OHO A;  2M7O A;  1W5Z A;  3MG3 A;  3K7C A;  1CH0 A;  3M8C A;  1W01 A;  4FR9 A;  1Q7H A;  1K8A 4;  1W7C A;  1GMQ A;  1KD1 4;  1I3F A;  3X40 A;  2L4V A;  1W2B 2;  1BNR A;  4GHO A;  1DVD A;  4X2O A;  2Y73 A;  1BNF A;  3RGA A;  3CXC 2;  1NU3 A;  3NBB A;  1UI8 A;  3MSO A;  5AI1 A;  2W04 A;  2KRT A;  1BNE A;  1VQ4 3;  2CFK A;  4N6V 0;  5KP1 A;  3UB1 A;  1YHQ 3;  1STD A;  1ROV A;  2BMR B;  2CX1 A;  3CCM 3;  1STF I;  1JZO A;  3KKG A;  1A67 A;  1D6Y A;  1WNH A;  1WQL B;  2OWP A;  3GWR A;  2F86 B;  1DMQ A;  3PCS A;  3NM7 A;  4IPB A;  1UUV B;  1MGR A;  1MWR A;  1LNI A;  3JVC A;  1X1U A;  4KZ1 A;  1I0X A;  2KF4 A;  3B4O A;  1N9J A;  2W9P A;  1BNS A;  3HX8 A;  3DGY A;  1RGG A;  4CPK A;  5RNT A;  5JPU A;  1CQS A;  2Z7A A;  2BMO B;  2Z6B A;  1YGE A;  1OUN A;  2YX9 A;  3KII A;  1GD4 A;  3NV0 A;  2BIR A;  3AMO B;  4R80 A;  3AHW A;  3EQQ B;  3OWU A;  3FCS B;  1WMP A;  1IVW A;  1QMA A;  3CC4 3;  1VQL 3;  1RGA A;  1QVG 2;  4AKZ A;  3X42 A;  2QA4 3;  2P05 A;  3B8L A;  1W6G A;  4IT7 A;  3BNC A;  1A90 A;  3SLU A;  3BNE A;  3EE1 A;  2OOV A;  1JBS A;  1EUI C;  3DMC A;  2I9W A;  1IK3 A;  1C54 A;  2GEY A;  4BIR A;  4MMX B;  3SXX A;  1FW7 A;  2F4Y A;  3WA3 A;  1OAC A;  3ECF A;  2XSO B;  4HAA A;  3Q3F A;  1KQS 2;  1PFP A;  1Q7Y 4;  1RLS A;  4KFD A;  2CH9 A;  3CD6 3;  2RBI A;  1J2B A;  5I97 A;  3G8Z A;  1W02 A;  4WHA A;  1V58 A;  3ER7 A;  3CCL 3;  1AY7 A;  2XH9 A;  3EC9 A;  1W6Y A;  3V99 A;  5IER A;  1VQP 3;  1HKX A;  4HYZ A;  3HIG A;  2E2U A;  3WOE B;  1Q82 4;  3RDE A;  2W2C A;  2XEP A;  2GBX B;  1IQY A;  1UGI A;  4WYK B;  3G6E 3;  3JUM A;  3F14 A;  4HM1 B;  1JV2 B;  3V98 A;  4LZI A;  1I2G A;  2IYJ A;  3Q90 A;  5JPP A;  5KP4 A;  2BO9 B;  3AMO A;  3LTA A;  4N6O B;  1A2P A;  5A0O B;  4LYL B;  1RCK A;  2Y74 A;  1FUS A;  5FGO A;  1Q81 4;  1B21 A;  1RGK A;  1UCI A;  1TRQ A;  4EW5 A;  1OPY A;  5AII A;  3MYT A;  3LZA A;  1LRA A;  1V74 A;  5CF1 A;  5AIF A;  3KSE D;  1UGH I;  1UW1 A;  2CWT A;  2P0M A;  3NXJ A;  4R9K A;  1GY5 A;  3EN1 B;  3ZFZ A;  2QGU A;  2WOH A;  4KT3 B;  1SQW A;  5D83 A;  3ZG5 A;  1BUJ A;  1S5A A;  2UGI A;  1R4C A;  2HMO B;  1K41 A;  1VQN 3;  4XDW A;  2AAD A;  2C4B A;  2OQE A;  1E3R A;  3CNX A;  2WGO A;  2O3O A;  3K63 A;  1IV9 A;  3BND A;  5DRV A;  5HGR A;  2CC3 A;  4WFO A;  2CFD A;  2Q07 A;  4K1U A;  1DMM A;  5IG5 A;  4HM0 B;  3SED A;  1PU4 A;  1B27 A;  2BT3 A;  3AGO A;  3G16 A;  3S28 A;  1G0T A;  1ZX2 A;  1QJG A;  2BMQ B;  4U13 A;  1OGX A;  3B4P A;  2QIY A;  4FMC A;  3CMA 3;  2OTJ 3;  1O7H B;  1RDS A;  1UCK A;  1BSA A;  4CDL A;  1IVV A;  2W03 A;  2CFW A;  1N8R 4;  1Q40 B;  4H61 A;  4XBX A;  1N5H A;  2YFJ B;  4FMA A;  3VGN A;  3IJE B;  1MGW A;  3LTB A;  3X3Y A;  2WOF A;  1I2F A;  1RSN A;  3CC2 3;  1BNJ A;  1IVX A;  2A15 A;  5LC6 A;  3U1W A;  1W4N A;  1BRH A;  1VQ9 3;  1IVU A;  1TFK A;  3NUV A;  3ZG0 A;  3LOY A;  1GOV A;  1GMR A;  1MNL A;  3FZW A;  3OWS A;  4GL6 A;  4R1K A;  3GZY B;  1BNG A;  4R9L A;  2ML6 A;  2E2V A;  4NPB A;  4WYK A;  1LOW A;  4ILF A;  3PS8 A;  4HM3 B;  2WO0 A;  2RCD A;  1BIR A;  3GZR A;  1EA2 A;  1KSI A;  1I70 A;  1B2U A;  3H51 A;  4FCJ A;  1I2E A;  4O8S A;  3DY5 A;  1NNV A;  4KFE A;  5CXO A;  5LC7 A;  1FYS A;  1L5G B;  3PXM A;  3J7Y d;  1Q86 4;  3ALA A;  2P09 A;  4L8P A;  5IW9 A;  2E2T A;  1N5P A;  5TGN A;  3X3Z A;  2CK3 H;  2XGN A;  3B7C A;  2ZA4 A;  1EEJ A;  2XFS A;  1BRN L;  1ULJ B;  3KFQ C;  3F7X A;  1ZGX A;  1QAF A;  1Y4K A;  2HMJ B;  3LTC A;  5CLK A;  3WMD A;  1AVL A;  1QAK A;  1Q9E A;  4I5Q A;  1YNV X;  3WA2 X;  1UCJ A;  1QVF 2;  3AGN A;  1FGQ A;  1VQM 3;  2IUJ A;  4BTW A;  4N6M A;  3OV4 A;  5IG0 A;  7RNT A;  1B2M A;  4WWU C;  5ELJ A;  1CYU A;  3N9H A;  2R41 A;  3KCH A;  3Q2P A;  1NB3 I;  3CCV 3;  1JNQ A;  5G2G A;  2HML B;  4WP5 A;  2HMN B;  3FH1 A;  1R4Y A;  4HJL B;  4J5K A;  1X1W A;  1NB5 I;  1T2I A;  4FMD A;  1W2Z A;  5AIG A;  2GXF A;  3LH4 A;  1O7M B;  4BL2 A;  1IU7 A;  3URP A;  1M1K 4;  5HOH A;  2BHM A;  1DVC A;  4ZM8 A;  1Q40 A;  3CNM A;  3K9M C;  2P0X A;  3F8X A;  4L8O A;  3WDG B;  2ML5 A;  1JRQ A;  2CFL A;  1W00 A;  5IEN A;  3MPH A;  1ASK A;  1RGE A;  2XGL A;  5STD A;  1YI2 3;  1U8C B;  3OW2 2;  3WR2 A;  1RHL A;  2CWV A;  4H3U A;  1B2X A;  4MMZ B;  1T5Y A;  2IA7 A;  1YIJ 3;  1KWI A;  6RNT A;  1S72 3;  1MWU A;  4O2H A;  2KF5 A;  1M90 4;  1W6C A;  3NQY A;  2P38 A;  4HKV B;  1BVI A;  3CCQ 3;  4BU4 A;  4OVM A;  1GOY A;  2SBL A;  3K0Z A;  5BVB A;  1TIJ A;  3F7S A;  1WMO A;  3KSP A;  3UJM A;  4AEQ A;  1B3S A;  4X2H A;  1GOU A;  2IUK A;  4FMB A;  1OF5 B;  2B24 B;  3GZX B;  1YJ9 3;  1ROA A;  3UL5 A;  3KN4 A;  3PGB A;  1GYB A;  1O7G B;  3MHE A;  4ORL A;  3EHC A;  2JDI H;  4XB5 A;  3SX1 A;  1Q42 A;  1JZD A;  2K3D A;  1FZU A;  3NBJ A;  3A5E A;  1BRI A;  2F5W A;  3T8U A;  3CCR 3;  1JJ2 2;  2WGQ A;  3KE7 A;  4XBY A;  2ZHX B;  3MG1 A;  1NO3 A;  1YGW A;  1JB2 A;  2XSH B;  4EBG A;  3X3X A;  1E3V A;  3FG1 A;  1RGH A;  1V57 A;  2RGQ A;  4O02 B;  4PEJ A;  1RRH A;  2AAE A;  1I0V A;  1VQ6 3;  4HVN A;  3EBT A;  2W0Q A;  1TU5 A;  2CFG A;  4N6T A;  2IMJ A;  4G1M B;  3GZB A;  5AYS C;  2OQE C;  4NRE A; 
#chains in the Genus database with same CATH homology
 2FXT A;  4XM4 A;  4EYC A;  3L0R A;  3VF1 A;  3UL6 A;  2BNG A;  1AVK A;  2CHC A;  3D9R A;  5KP3 A;  3FGY A;  2HMM B;  3TDG A;  3N54 B;  1RJO A;  4HM8 B;  1OF5 A;  1N8Q A;  4KFF A;  4RNY A;  5EQL A;  1VQ8 3;  1EKM A;  1UI7 A;  1CEW I;  4HZB B;  5AEU B;  3H3H A;  5AIH A;  1O7N B;  5DRE A;  4MMY B;  3IPT A;  2LQV A;  3KZT A;  2JQ5 A;  1JB5 A;  3E99 A;  5FW5 A;  1ISK A;  3LTD A;  3DZL A;  1IQ8 A;  2FNQ A;  2KCD A;  3F9S A;  2F98 A;  3LT8 A;  1KC8 4;  3EBY A;  4K90 B;  1US1 A;  4FCZ A;  4HM2 B;  1SII A;  1JKG B;  3F8H A;  3BNB A;  4JRF A;  2GBW B;  4MEI A;  2MC8 A;  2XR8 B;  3DGN A;  4RNZ A;  4RZM A;  1CYV A;  1VQK 3;  2XRX B;  4CCV A;  2LYX A;  2R4I A;  1OHS A;  1M1X B;  2CKF B;  1D6U A;  2V1L A;  2D1W A;  3I56 3;  2KXG A;  3UNL A;  3U97 A;  2OOV C;  1WTH A;  4J9A A;  1UUW B;  3DGL A;  2CWU A;  4EXR A;  4J8T A;  2UX0 A;  2CG0 A;  5IEO A;  1O7P B;  3S67 A;  3T0U A;  1ZO2 A;  2C10 A;  2OTL 3;  1M9G A;  1SJW A;  2B1X B;  4LEH A;  8CHO A;  3OXA A;  4HM5 B;  3PZW A;  4STD A;  3OWY A;  1G96 A;  1AV4 A;  1SIH A;  1D6Z A;  4BTY A;  1FGO A;  5EVH A;  3DM8 A;  1JN5 B;  5CK6 A;  4EV5 A;  5BXQ A;  3D3L A;  4K61 A;  2W56 A;  5EEO A;  3CPW 2;  1K9M 4;  2GU3 A;  1AR0 A;  2YFL B;  3FKA A;  1HU9 A;  1RN7 A;  3QRD A;  3T8N A;  1VQO 3;  5D81 A;  3G71 3;  2PNC A;  2ZDJ A;  3IMA B;  3I55 3;  4JF8 A;  2O9U X;  3MG2 A;  1FUW A;  4IIA A;  1SPU A;  5ELU A;  3SOA A;  1EQK A;  2RSX A;  2CW9 A;  4I4K A;  3NHX A;  2XFT A;  1BUQ A;  2K0M A;  2XF3 A;  2QEX 3;  1N9E A;  1VQ6 3;  1LVN A;  2STD A;  1TUH A;  1FGM A;  2W6J H;  3V92 A;  2K54 A;  3HZP A;  3STD A;  3DUK A;  3BB9 A;  3X41 A;  4Q53 A;  2MF7 A;  3NBR A;  4LSO A;  1K73 4;  1LXE A;  5IEP A;  1MOL A;  4HM7 B;  1ULI B;  4N6N B;  1IQX A;  5AEW B;  7STD A;  3O8Y A;  3ROB A;  4OUQ A;  4BTX A;  3WOD G;  3CU3 A;  4O3V A;  1JN5 A;  4N3V A;  1OCV A;  3G4S 3;  4GB5 A;  4EC6 A;  1E97 A;  3BLZ A;  1IV7 A;  3FSD A;  3CPO A;  3Q1C A;  3CC7 3;  3S29 A;  5IG4 A;  2PZV A;  3JUP A;  3DGO A;  3FLJ A;  3K5T A;  3JUN A;  3S27 A;  3CCJ 3;  4N6U A;  2GEX A;  4RBN A;  1NJI 4;  1OHP A;  4HM4 B;  1RKY A;  3EN8 A;  5JBS A;  1YJW 3;  2ZL8 A;  3FF0 A;  3RGR A;  3S5C A;  3LXU X;  3NX0 A;  1IDP A;  1FGR A;  4FCM A;  2D42 A;  4HBR A;  5IF6 A;  3PCR A;  2CIU A;  1OGZ A;  1O7W B;  3G0K A;  1VZZ A;  3FG4 A;  3MKI A;  2F99 A;  2RFR A;  3EX9 A;  1Z1S A;  3SVA A;  1EG9 B;  1OH0 A;  3DGM A;  3MWZ A;  1YJN 3;  1LOX A;  1RRL A;  2Z76 A;  1YIT 3;  3HII A;  3NQZ A;  2W9Q A;  1IT8 A;  4R4K A;  3EF8 A;  3QK9 A;  4MJD A;  1JKG A;  3JUO A;  4K1V A;  4LMI A;  2CG1 A;  1FA3 A;  1WMN A;  3NM2 A;  4EV2 A;  1GS3 A;  4XDV A;  3CCS 3;  1K28 A;  3GRD A;  4OK0 A;  3F40 A;  3LML A;  4NHF A;  4XBT A;  3DXO A;  1IT7 A;  3WOF B;  1GY6 A;  3SOY A;  1GD3 A;  1FGT A;  3PYJ A;  1A2K A;  1TP6 A;  3LT9 A;  1LNH A;  4N6L A;  3CCE 3;  1DYU A;  1TFO A;  3FG3 A;  2W56 B;  5JPU A;  3GAX A;  6STD A;  2C11 A;  4HZ9 B;  4TX4 A;  1F8N A;  1NWW A;  3FF2 A;  3VSY A;  1YVB I;  1DMN A;  3JUQ A;  3HK4 A;  2FGT A;  3NV0 B;  3CCU 3;  2INX A;  5IG3 A;  3CME 3;  1VQ7 3;  3A76 A;  2GU1 A;  2OCT A;  2HMK B;  3EB8 A;  3N8B A;  5CF2 A;  1JB4 A;  1C7H A;  1U5O A;  2Z77 A;  4HM6 B;  1VQ5 3;  1NDO B;  3EJV A;  4KVH A;  4QWT A;  5D82 A;  3HI7 A;  3LYG A;  1QAL A;  3OX9 A;  4LGQ A;  5AYR B;  2YFI B;  1GY7 A;  4L7K A;  4AKY A;  1A2V A;  3I0Y A;  1OHO A;  2M7O A;  1W5Z A;  3MG3 A;  3K7C A;  3M8C A;  4FR9 A;  1W01 A;  1K8A 4;  1W7C A;  1KD1 4;  3X40 A;  2L4V A;  1W2B 2;  1DVD A;  4X2O A;  2Y73 A;  3RGA A;  3CXC 2;  1NU3 A;  3NBB A;  1UI8 A;  3MSO A;  5AI1 A;  2W04 A;  2KRT A;  1VQ4 3;  2CFK A;  4N6V 0;  5KP1 A;  3UB1 A;  1YHQ 3;  1STD A;  1ROV A;  2BMR B;  1STF I;  3KKG A;  1A67 A;  1D6Y A;  1WNH A;  1WQL B;  2OWP A;  3GWR A;  2F86 B;  1DMQ A;  3PCS A;  3NM7 A;  4IPB A;  1UUV B;  3JVC A;  4KZ1 A;  3B4O A;  1N9J A;  2W9P A;  3HX8 A;  1CQS A;  2Z7A A;  2BMO B;  2Z6B A;  1YGE A;  1OUN A;  2YX9 A;  3KII A;  1GD4 A;  3NV0 A;  3AMO B;  4R80 A;  3OWU A;  3EQQ B;  3FCS B;  1WMP A;  1IVW A;  1QMA A;  3CC4 3;  1VQL 3;  1QVG 2;  4AKZ A;  3X42 A;  2QA4 3;  2P05 A;  3B8L A;  1W6G A;  4IT7 A;  3BNC A;  1A90 A;  3SLU A;  3BNE A;  3EE1 A;  2OOV A;  3DMC A;  2I9W A;  1IK3 A;  2GEY A;  4MMX B;  3SXX A;  3WA3 A;  1OAC A;  3ECF A;  2XSO B;  1KQS 2;  1PFP A;  1Q7Y 4;  4KFD A;  2CH9 A;  3CD6 3;  1J2B A;  5I97 A;  3G8Z A;  1W02 A;  4WHA A;  3CCL 3;  3ER7 A;  2XH9 A;  3EC9 A;  1W6Y A;  3V99 A;  5IER A;  1VQP 3;  1HKX A;  4HYZ A;  3HIG A;  2E2U A;  3WOE B;  1Q82 4;  3RDE A;  2W2C A;  2XEP A;  2GBX B;  1IQY A;  4WYK B;  3G6E 3;  3JUM A;  3F14 A;  4HM1 B;  1JV2 B;  3V98 A;  4LZI A;  3Q90 A;  5JPP A;  5KP4 A;  2BO9 B;  3AMO A;  3LTA A;  4N6O B;  5A0O B;  2Y74 A;  5FGO A;  1Q81 4;  1OPY A;  5AII A;  3MYT A;  3LZA A;  1V74 A;  5CF1 A;  5AIF A;  3KSE D;  1UW1 A;  2CWT A;  2P0M A;  3NXJ A;  4R9K A;  1GY5 A;  3EN1 B;  3CCM 3;  2QGU A;  2WOH A;  1SQW A;  5D83 A;  1S5A A;  1R4C A;  2HMO B;  1K41 A;  1VQN 3;  4XDW A;  2OQE A;  1E3R A;  3CNX A;  2WGO A;  2O3O A;  3K63 A;  3BND A;  1IV9 A;  5DRV A;  5HGR A;  2CC3 A;  4WFO A;  2CFD A;  2Q07 A;  4K1U A;  1DMM A;  5IG5 A;  4HM0 B;  3SED A;  1PU4 A;  2BT3 A;  3G16 A;  3S28 A;  1ZX2 A;  1QJG A;  2BMQ B;  4U13 A;  1OGX A;  3B4P A;  2QIY A;  4FMC A;  3CMA 3;  2OTJ 3;  1O7H B;  4CDL A;  1IVV A;  2W03 A;  2CFW A;  1N8R 4;  1Q40 B;  4H61 A;  4XBX A;  1N5H A;  2YFJ B;  4FMA A;  3VGN A;  3IJE B;  3LTB A;  3X3Y A;  2WOF A;  3CC2 3;  2A15 A;  1IVX A;  5LC6 A;  3U1W A;  1W4N A;  1VQ9 3;  1IVU A;  1TFK A;  3NUV A;  3LOY A;  1MNL A;  3FZW A;  3OWS A;  4R1K A;  4GL6 A;  3GZY B;  4R9L A;  2ML6 A;  2E2V A;  4WYK A;  3PS8 A;  4HM3 B;  2WO0 A;  2RCD A;  3GZR A;  1EA2 A;  1KSI A;  3H51 A;  4FCJ A;  4O8S A;  3DY5 A;  4KFE A;  5CXO A;  5LC7 A;  1L5G B;  3J7Y d;  1Q86 4;  3PXM A;  3ALA A;  2P09 A;  4L8P A;  5IW9 A;  2E2T A;  1N5P A;  5TGN A;  3X3Z A;  2XGN A;  2CK3 H;  3B7C A;  2XFS A;  1ULJ B;  3KFQ C;  3F7X A;  1QAF A;  1Y4K A;  2HMJ B;  3LTC A;  5CLK A;  3WMD A;  1AVL A;  1QAK A;  3WA2 X;  1QVF 2;  1VQM 3;  1FGQ A;  2IUJ A;  4BTW A;  4N6M A;  3OV4 A;  5IG0 A;  1CYU A;  4WWU C;  5ELJ A;  3N9H A;  3Q2P A;  1NB3 I;  3CCV 3;  1JNQ A;  5G2G A;  2HML B;  4WP5 A;  2HMN B;  3FH1 A;  4HJL B;  1NB5 I;  5AIG A;  4FMD A;  1W2Z A;  2GXF A;  3LH4 A;  1O7M B;  1IU7 A;  1M1K 4;  2BHM A;  1DVC A;  4ZM8 A;  1Q40 A;  3CNM A;  3K9M C;  2P0X A;  3F8X A;  4L8O A;  3WDG B;  2ML5 A;  1JRQ A;  2CFL A;  1W00 A;  5IEN A;  3MPH A;  1ASK A;  2XGL A;  5STD A;  1YI2 3;  1U8C B;  3OW2 2;  2CWV A;  4MMZ B;  4H3U A;  1T5Y A;  2IA7 A;  1YIJ 3;  1KWI A;  1S72 3;  4O2H A;  1M90 4;  1W6C A;  3NQY A;  2P38 A;  4HKV B;  3CCQ 3;  4OVM A;  2SBL A;  3K0Z A;  5BVB A;  1TIJ A;  3F7S A;  1WMO A;  3KSP A;  3UJM A;  4AEQ A;  4X2H A;  4FMB A;  2IUK A;  1OF5 B;  2B24 B;  3GZX B;  1YJ9 3;  1ROA A;  3UL5 A;  3KN4 A;  3PGB A;  1GYB A;  1O7G B;  3MHE A;  4ORL A;  3EHC A;  2JDI H;  4XB5 A;  3SX1 A;  1Q42 A;  3NBJ A;  3T8U A;  3CCR 3;  1JJ2 2;  2WGQ A;  3KE7 A;  4XBY A;  3MG1 A;  1NO3 A;  1JB2 A;  2XSH B;  4EBG A;  3X3X A;  1E3V A;  3FG1 A;  2RGQ A;  4O02 B;  4PEJ A;  1RRH A;  4HVN A;  3EBT A;  2W0Q A;  1TU5 A;  2CFG A;  4N6T A;  2IMJ A;  4G1M B;  3GZB A;  5AYS C;  2OQE C;  4NRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...