3CCVP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ccvP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ccvP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ccvP02
1YI2P 3CCRP 3I55P 1QVGO 1VQ7P 3CPWO 3CCSP 2OTJP 3CCQP 1VQ5P 3G71P 3CC7P 1VQPP 1Q81Q 3CCLP 3CCUP 1K8AQ 1VQLP 1KQSO 1YJ9P 3CCJP 3CCVP 3OW2O 2OTLP 3CMAP 1YHQP 1K9MQ 3CC2P 3CD6P 1YIJP 1S72P 1VQMP 1VQOP 1W2BO 1VQ9P 1Q86Q 1YJNP 2QA4P 1KD1Q 1K73Q 3I56P 1YITP 1N8RQ 1VQKP 3CC4P 1Q82Q 1QVFO 1VQNP 3G6EP 2QEXP 3CCEP 1VQ6P 1M90Q 1VQ8P 1Q7YQ 1NJIQ 3CMEP 3G4SP 1KC8Q 1M1KQ 3CXCO 3CCMP 1JJ2O 1YJWP 1VQ4P
chains in the Genus database with same CATH superfamily
3VYIA 1HTLC 3F5HA 4PD4D 3TK1A 3EJBA 3AE5C 4YPCA 3RK3B 2XZ1C 4GDOA 5KLVK 1VL2A 3L37A 1J2JB 2M8RA 5AVYB 2LXCB 3H47A 2K0DX 3SFEC 1BGYJ 2E42A 5CZDB 3AEDC 1SFCB 3H1LE 5AW1B 3RK3E 2ZT9B 3P7KA 3AEBC 1WRGA 2KIKA 1KQLA 3CCLP 1K8AQ 2GUVA 4PV1D 3L72J 1PEUA 2WSFJ 2R3CA 4WY4D 4WY4A 5KKZC 4H2WC 3LMOA 3G1GA 3AE2C 1NJIQ 2NPSB 2JYLA 2W6BA 5AVSB 1K04A 3BCCD 1NTKJ 2FYNB 3H25A 4GODA 1H88A 1M6NA 1BCCG 4PH1A 4XFYA 1RE3A 2L5GB 1K73Q 1BGYE 3EFGA 2QJKC 2WZ7A 3CI9A 2JQ4A 1E6JP 3SFDC 3VMZA 1PEOA 3R4YA 2QE7H 4OGQD 1QL1A 5L8RJ 3H1KD 3L72E 4I7ZC 1UIXA 3D71A 2FBWC 2QM7A 1EZVD 2BASA 2HODB 1HWTC 2A06E 1L0NG 4XA4A 1NTKE 2KOPA 1NTZJ 3Q2YA 4D6TG 1SQXK 2D2CD 3P8CD 4U7JA 2N50A 1E0HA 1SQVG 3HE4B 3MD0A 1FU1A 1BE3J 1HF9A 4H13C 3L73E 5AW5B 1S9KD 2HYNA 1GW4A 2KODA 3GKLC 3GF3A 2WMMA 3DS5A 4QKOA 2WPRA 4W7YA 2K9YA 3CPWO 3WU2H 1NTMJ 3ABVC 5CMZA 3HUSA 5B5EE 4NPEA 1GK4A 5C39A 2LTEA 3CCJP 2AFDA 3M0DC 4RKUJ 2FKWB 3AEEC 5JPAA 2FXPA 1RF0A 1FZBA 2Q7CA 4DOJA 2ONTA 3GMAA 1SP4A 4BWNA 1FZAA 3S1KA 3D70A 1LWUB 3L71D 1NTZE 1BXIA 1SQQG 5AW0B 1XTGB 1RO2A 3V2NA 1HJBA 2K0XA 1P84H 3LIDA 4HYTB 4DT0A 1R5SA 1AV1A 2OYIC 3WUTA 5KLVD 5CCHD 1NTME 3M1MA 2KORA 2KW2A 3P05A 1BDCA 4HJGH 2KP8A 1KN7A 1QX8A 2N1TC 3RG2A 1ZOYC 2KLVA 2WPSA 3H6PA 2R5BA 2VLPA 4O9BA 1ZR2A 4UHPB 3TNUA 2JEEA 1PEQA 1RF1A 3A0HE 1HH0A 1RE4C 3C8VA 2MVVA 3BCCG 2MR8A 4IPYA 2JU1A 1GD2E 3TSIA 1VF5B 2W6JH 3V2QA 1N73C 3KYQA 1FBMA 3AE1C 1BSHA 3M9HA 1DH3A 1KB9E 3FWNA 4ZNCA 1GXHA 3RL0D 1JNMA 5KP7B 1LTTC 5B66H 1E5WA 2FHSC 1LTBC 1Q7YQ 3H1KG 3SWKA 1AFOA 1LTJB 4WVZA 2RKLA 1FZGA 2OYHA 2N6ZA 1EZVG 3HE5A 4PD4H 4LGDE 2KS1A 2HPCB 1IFPA 2RH0A 2C9LY 2L9FA 2GZGA 2K94A 2FFDC 2PRRA 5BS2A 5AVTB 2QJPB 2YIUB 2ZVOB 3L4FA 2QIWA 1SQXD 4CA3A 2KGDA 2KXPB 1HBWA 3OAKA 1RY3A 1KTMA 4L75A 1MKMA 2H43A 4U0EA 3A3YB 4QNBA 1NAFA 3WU2E 1OW8A 3VRLC 5APUA 4KHXA 3W67A 1KILD 1KILA 1Q90D 1ZRTE 3MIWA 4K3AA 1IJDB 5CBOA 2Y9YA 1LP1A 3IN6A 1SFCC 2BCCD 4D6TJ 3A0BH 4EDFA 2ZT9C 5HGOA 2E76C 1FZCB 1SQVJ 3CL3D 3IFMA 1NU1J 2ZAEB 2IBZD 3L71G 1R5LA 1PV3A 3GG2A 1SQBK 1R8EA 1PP9D 1IFMA 1KB9I 4COPA 1P84E 2K92A 2NPSC 5APSA 2Z4EA 2FYNC 1HUCA 1FDMA 3M06A 4GR2A 5KLVG 2PP6A 1GMJA 3GW6A 5TISH 2FACA 4IL6X 5HGMA 2LF4A 3MGNA 5AW2B 2JR8A 1NOHA 1JOCA 3AE4C 3L74D 4BPFA 1ACPA 4GT1A 4D6TE 3L75J 1SQQJ 1OVUA 5CJ0A 2KNCB 1GZLA 3N4XA 1AYIA 1NU1E 1ZNVA 4PXHB 4AQRD 3CCEP 1EXJA 2KG8A 1KC8Q 2KYVA 2L22A 1ZXGA 2W27A 3PTZA 3CXHH 3M91A 1JMBA 4CPGA 2DW3A 4OWFA 1VHNA 3B5IA 2KK7A 2YMYA 1WMKA 2K9JA 2DNWA 2Q9IA 3L70J 1NWQA 2JKVA 1J1EB 1QEXA 5B66E 1X0TA 4Z1MH 1GTWA 1KORA 4U0FA 5I4TG 3L75E 1SQQE 1YITP 1FZEA 4GKGA 1KV4A 4PD4E 2IFMA 4KJMA 2WT7A 1PPJD 3MHVA 2M5AA 4AYCA 2FXMA 2CPBA 2WWWA 2JGPA 5H2FH 4W80A 2LKMA 1CSBA 4PV1B 1SLQA 5KAFE 4TLFA 4WY4B 3CMAP 1YHQP 1W5CE 1ZMBA 1SQXG 1LWUC 2E43A 2E5YA 3M9BA 1NKNA 1N86A 4I1LA 2FYUK 3HYBA 2QVAA 3H1JE 1FR2A 3B5ND 2VSQA 2KB7P 2YO2A 4ZKUA 3L70E 1EDIA 1DIPA 3AEFC 2AEMA 2P2UA 1SQPE 3NTEA 3VP8A 2JAZA 1AQTA 4BRYA 3Q20A 1M74A 3A0BE 1GPJA 2RN0A 4UB8H 1FJKA 3OA7A 3RK2D 2IBZG 1H0TB 2FAEA 1HY8A 4IZ6A 3H1HE 1S1CX 4OGQB 1USEA 1N7SD 2BEZF 1T2KC 3CC2P 1PP9G 2V7QH 3G21A 2QRXA 1MUUA 1VQKP 2FQ0A 1SQBD 2YKPA 4DG9A 3HZQA 2ZVNB 2D2CB 1KFNA 1Y47A 1T3UA 2A45G 4U3FJ 5GTIH 5CJ4A 3CX5H 3D6YA 1VF5C 1KYOH 3Q5RA 2C9NY 4ZMDA 3L74G 1JY3P 1QRJA 2EHTA 1X8YA 5KTBA 3MZWB 1LGHB 3AE6C 2B87B 2E74D 1YTZI 5AW6B 2R3SA 3M0DA 2IPPA 1G2CA 2N6YA 1S9KE 1LTJC 2UWJE 1VQ9P 2WTYA 3O6QB 3CXHE 1M1JB 1BAJA 1JCDA 3G28A 1OW6A 5F2KA 2K1AA 2M0BA 4UB6H 3S4RA 1KQFB 2E76B 2M8LA 5CHXA 3CCQP 3G9RA 2IZ1A 4JPZB 4PJ0H 1FE6A 5GTHE 1EDKA 3DPHA 2QJPC 4N6JA 2YIUC 4U3FE 3TGUD 2XU6A 1M57D 2ZYAA 1S5LH 2OYIA 2ZXXA 2FY8A 3C1LA 2PAJA 2SPZA 4C46A 1RQVA 5CCGC 1YI2P 3A2AA 1X79B 3AE8C 2P9XA 2YKQA 1YBKA 2N1TA 2LXBA 1PPJG 3JCUH 4XFZA 2Q1KA 5E79H 3H1IG 4C7NB 5H2FE 1YJNP 4IFFA 2OARA 2Y9ZA 2AF8A 2AEJA 3P32A 1FZCC 1RO0A 4GOFA 2V7QJ 2KUBA 1VQ4P 3TNUB 1LTIC 1RE4A 3HTKA 2XZ0D 3AEAC 2A45H 1K30A 4IFMA 3H32A 5KJ7D 5KJ7A 1KD1Q 2FYUD 3CWBJ 4R0MA 1PL5A 3LIEA 3CMEP 1FZFA 4U0DA 1N73A 3KZIH 3G71P 2R44A 2MY5A 1KQGB 1X22A 1VKUA 3E7KA 1SQXJ 2XKMA 3RL0B 1GDTA 1LT1A 2MJZA 1NTZK 2CQ8A 2MVUA 1PGOA 1VQ5P 2OYHB 1PGQA 1SQBG 5APWA 2FFDA 2KS1B 1AJYA 3PHLA 2M8PA 1EDLA 4LLHA 2ZFCA 5AVRB 3GLMA 2KG6A 1JY3O 2I1JA 1NTMK 2PFXA 2K88A 1S5LX 4EI2A 2BEQD 3CWBE 2GUSA 3EWKA 1L0LJ 1K05A 4U0CA 3CX5E 2J59M 2W90A 2EG5A 1KYOE 1FDOA 3H1LD 2M3BA 1LT9B 2OTLP 1J1EC 1PP9J 5APXA 2J58A 1KILB 1BE3E 1GU4A 1FAVA 2OTJP 1SFCA 3V2PA 2JBGA 5AW3B 2KWLA 5APTA 1H8AA 2PGDA 2AXCA 3SWFA 1LP1B 1LTGC 2CPSA 1PEMA 1NVOA 3GZMA 4UB6E 2WITA 5BU5A 4A7PA 1Q86Q 3E1IA 4PJ0E 4PV1C 2M8NA 3V6IA 3L74J 4WY4C 2C0XA 3RG6C 2GYKA 1JY2O 1L0LE 3TGUG 1BGYD 3I55P 3MGEA 5AVXB 1S2EA 3KDPB 2WPVB 1MZ8A 1K9MQ 3HD7D 1AA0A 3HD7A 2PEIA 1OWAA 1PP9E 2NRGA 1M7LA 3MUDC 3JCUE 2LPKA 3L72D 1PGJA 1IO4A 5E79E 1RE3C 2HFED 1HQBA 1YJWP 4XROA 2O01N 4JQ0D 1OW7A 1YTZT 1UJZA 2KZIA 1OIPA 2K2QA 2LR2A 4WBAA 2A06D 1IK9A 4M3LA 4OGQC 1M6EX 3CC4P 1NH4A 2KI7B 2GM4A 2W83C 3CE7A 4IL6H 3L74E 3L73D 2IYPA 1NO4A 5AVQB 1VQ7P 1BDDA 2FYUG 3VOPA 4N78E 1M8OB 3B4QA 3HE4A 1BCCJ 5APQA 3H1IJ 2D2CC 3USSA 2FQ1A 2FXOA 2O01H 3T97B 1NQ4A 2IX7C 3GHGA 4KT0J 2R5DA 1NYHA 2XXMA 3V5BA 1Z6MA 3G0VA 1JCCA 3DS3A 3EJDA 2KZJA 1DX7A 3CCUP 2J5UA 4PH0A 4RESB 3OW2O 3VMXA 2KG9A 2AXTH 3DS1A 1NTZD 3E2DA 2H8PD 3U43A 2PEMA 3F89A 1M1JC 4H0LD 2JB0A 1L0NJ 1RF0C 1LWUA 1EXIA 1KQSO 1FJPA 3OJAB 2JP3A 1QLED 1GXGA 1NTMD 1BCCE 2N5HA 3MP7B 3H1IE 3H1LG 4PWVB 2POHA 3IAOA 3JSVC 3B5NB 4OVNF 3G1IA 1ZMEC 2EHSA 3CCRP 4K35A 4BXLA 1NU1K 2P10A 1EC5A 3CLQA 3W68A 1UNKA 1FOSE 1GL2D 1A8OA 1GL2A 4BRYB 1NGMB 1MV8A 1W2BO 5CCHC 4RO0A 2AFEA 2E75D 2IDBA 3G26A 4L73A 2IYOA 1JM0A 1KLPA 3RK2B 2H89C 4DZOA 1L0NE 1N7SB 2K37A 1OVRA 3VP9A 1LTSC 2KOSA 2HLOA 1BGYG 4U0BA 1SQVE 1URQD 1URQA 1N8RQ 4H44D 3EFFK 1LTAC 1KB9D 1L0HA 3IR9A 3AE3C 2YNYA 1SQQK 2O01J 4H2YC 5EW5E 4HKZH 1L0IA 1VQLP 2FADA 2M5RA 1L4AD 1L4AA 4GR6A 2LKIA 1IC2A 1DNYA 3NXSA 5F2NA 4EIJA 4LC1A 2GZFA 2A06G 2MKVA 3CCMP 2XV5A 3BATA 1ZV8A 4GIFA 3RL0C 5M1BA 1CI6A 1QVGO 4MRTC 2CK3H 2E74B 3TGUJ 1MZ9A 5CBNA 3B8EB 4B86A 4IL6E 1N7LA 3L73G 2HPCA 2OYHC 1L2PA 3BCCJ 2QA4P 2PEKA 4L74A 1SQPK 1P84I 2CG5B 2N5IA 2W8ZA 1JMMA 2C0WA 1J1DB 2ITAA 1ZRTD 3NY7B 1W2EA 2GDXA 3EJEA 2O1JA 5APVA 2MF4A 2P58A 2Z46A 3HRNA 1LT9C 2Q6QA 3AE9C 3NFQA 2AXTE 2I1KA 3H1KJ 1KILC 2V4HA 2JDIH 3TGUE 3VMYA 1FZCA 4JBZA 3Q5PA 1P84D 5DCKA 5KAIH 4RJTA 2CNRA 4EYYQ 3BCCE 2BCCG 3FXDA 4M0IA 3HTKB 3GF7A 3LW5H 1NTMG 2LIWA 3G3ZA 2OGUA 1ZLLA 2FVAA 3L36A 1YIJP 2KOQA 3FXEA 2KOGA 4D6TD 2ZXEB 2QEXP 4JYCA 1Z56A 1JB0J 4ASWA 1TU3F 4W7ZA 2KGAA 4JYBA 1KMIZ 1NU1D 2QJYB 1OMIA 3H1KE 3U1AA 4NEOA 2P7JA 1FDIA 4H13D 1VQPP 5TISE 4PD4I 2XNDH 1EZVE 4ASVA 4IFDK 3DS0A 5KP6B 1QVFO 3H1LJ 3RL0g 1YQ3C 1OR5A 3L35A 3L71J 1RNIA 4XFXA 5DJTB 3P8CE 3DS4A 5BVZA 2IZ0A 3HUSB 2PENA 1S3JA 2VRSA 3BRTB 3CCVP 1QL2A 1CZQA 1S72P 3ITKA 3VN0A 2QG4A 5KLVJ 2IFNA 1G1IA 4NPDA 3D6ZA 3L75D 1SQQD 2K93A 2LOLA 4IOIH 1IMQA 4BPHA 4Y28J 1FS0E 1JTHA 2YXQB 2FQ2A 1HJ0A 1VQMP 1G1JA 4QMAA 2XV6A 5EJDA 1VQNP 3V4WA 3G4SP 3L71E 1CEIA 5AW9B 1BSNA 2YO3A 2OQQA 3H1JD 1JY2P 2N1TD 3FX0A 3LW5J 1EDJA 3K5BA 2KR5A 3UIAA 3H4EA 3L70D 4C7RA 2LL8A 2E1MA 3I56P 1SQPD 1NTKK 5HGLA 4F37A 2K0YA 5KLVE 3TF5A 3A0HH 1OXZA 2NZ2A 1AQ5A 1EZVI 3CCSP 2Q3IA 3MUDA 1RF1B 3B5NC 1RQUA 1A02J 2QM8A 3TDKA 3HD7B 3L73J 4HKGA 3H1HD 3WMM0 2YKOA 5KAIE 1H0TA 1LJ2A 1KB9H 4NPFX 1AVOA 3CXHI 2JO0A 4UB8E 3Q5SA 2Q5UA 2P67A 3FGAD 3RK2C 2XT1A 2B9BA 3KPEA 3RBXA 1E79H 1YQ4C 2AVAA 4YXWH 1N7SC 2LIUA 1IK7A 1U7JA 3C9IA 1JJ2O 2WVRA 2N98A 1MFTA 2K5XA 3SWYA 4DJGA 1EIAA 3HE5B 2PNGA 1N2DC 3A5TA 1NU1G 1F80D 1UIIA 2BCCJ 3GHGB 3NMDA 3AEGC 3H0DA 4L76A 5GTIE 3CXHD 2B87A 2QSIA 3AE7C 1FC2C 1USDA 3PP5A 1HGVA 2BUOA 3IF4A 1T6AA 3E1RA 3RK3D 1U7MA 2Z5IA 2E74C 2Z44A 1L0LK 2P1JA 2FVFA 3M9QA 2YMKA 2G8YA 3MTUE 3O6QA 4WB4A 1IFNA 1M1JA 1SQXE 2R32A 3B71A 1SFCD 3DTJA 4U3FD 1EMVA 2PEOA 2H88C 2ZT9D 2E76D 3WBHA 4AUWA 3PH0A 2L4BA 4H0LB 1WT6A 1VDFA 2ZYGA 1DV5A 5HVCA 2Q3EA 3L75G 5AW4B 1KILE 1J1DC 2HR3A 5BS1A 2PEJA 1PFIA 2BQ1E 1D1DA 2VLQA 3PRJA 2NPSD 2NPSA 2BCCE 4XRQA 2ZYDA 5AVVB 1FOSF 1S5LE 5CCHA 2KGCA 3V2RA 1JO5A 4Y99B 2IBZE 1DEBA 5K5GB 3VTPC 1GL2B 4WYMA 3Q3DA 4C7NA 2E75B 4COCA 3H1JG 1Q82Q 1PGPA 5KLIB 2OTKE 3KQGA 1ZP0C 3L70G 2QNWA 5BU8B 5HV8A 1SQPG 2E5TA 2W6AA 2KSJA 3CC7P 2BHVA 3TYYA 1Y8AA 2VLNA 4EOTA 1T8KA 1NTKD 3CX5I 2GZJA 1URQB 1KYOI 3PJSK 2CWOA 4H44B 1T3JA 5KJ7C 4U0AA 2HODA 3H1HG 4ZKPA 1DD3A 1NHLA 1L4AB 1M56D 2QJYC 3KZIE 2KSEA 1DEEG 5APYA 3N7NA 1VPCA 1Y9BA 3M0AA 5EFWB 2MD9A 2EIAA 1XTCC 1YYCA 2O3JA 3DS2A 2K9JB 1CI6B 1GU5A 2K3RA 3CWBD 3U1CA 1KZUB 2GDYA 1EOQA 3CX5D 2JO1A 1KYOD 5F2OA 3LRYA 2YXRB 5TJHA 2KLUA 5AVWB 5AW7B 1X9VA 3HUSC 2IBZI 4R4LA 2B88A 2WT7B 2G3AA 2JU2A 2M5AB 5KAFH 2CGQA 1BE3D 2KGEA 5KKZB 1IFDA 5AW8B 1ZN5A 2H7HA 3WUUA 1AUMA 3JC22 1GK6A 1YJ9P 2L91A 3II6A 1LT9A 4YXDC 2PY8A 1PPJE 1AVYA 3RK3C 2GDWA 1NAYA 3SSUA 2X2BA 1L0NK 3B4SA 2XZRA 1JEKA 3AECC 1SQVK 2O1KA 2A45I 2AEFA 3R2PA 1SQBJ 4U3FG 1L0LD 2QJKB 3QWOC 5DJUB 2ERHA 3RGUA 2OYOA 3GJNA 3WUVA 1PIXA 1A43A 1T2KD 4I7ZB 1GW3A 4XE5B 5AVZB 5AVUB 1HVVA 1CW5A 2PEQA 2Y0DA 2N9BA 2VLOA 1NKZB 2HG5D 2WSCH 2WSEH 1RF1C 4TT3H 1PZQA 3G6EP 3HD7C 3BRVB 2ZJSE 1D7MA 1LNQA 1ZW0A 1OVVA 3A7OA 4H13B 1VF5D 3L72G 1SQBE 1DD4A 1OFCX 2DGYA 4N78D 2RMZA 3RBZA 5KP8B 3FWLA 2MR7A 4DCKA 1NTKG 1JUNA 1RHZB 1LTJA 3PLNA 2WPTA 1JY3N 2XNXA 2LMLA 2L6EA 1G2CB 2ROQA 3H1JJ 3T97A 2WQYC 1IMPA 5GTHH 2EFJA 2L0QA 3CXCO 2JWAA 1ZR4A 3V4QA 3S9OA 3GZLA 2Y0CA 1SQPJ 1JTHB 2GZIA 3GHGC 3P8MC 3QH9A 3VMAA 3KXDA 1VQOP 3ZDMA 1H89A 4YTPC 5CCGD 3CWBG 5CCGA 4I6MC 2OYIB 1X3OA 1M1KQ 1SVFA 2N9YB 1BCCD 3Q1MA 3H1ID 4I2LC 3H1HJ 1NTZG 1OX3A 2FYUJ 2N1TB 2FYZA 1IFIA 3G29A 3KHUA 4H0LC 1BE3G 2NO8A 3I5CA 1JY2N 2B89A 2Z45A 2JWDA 1M90Q 3NTNA 3B5NA 2Z5HA 2WSCJ 2WSEJ 2I8DA 1IUQA 1KFMA 2WSFH 1HGZA 1RH5B 1Q2NA 3BASA 1T8ZA 1OZHA 3H32B 1MFZA 2Y0EA 1QGKB 2JYGA 4JF7A 2FVEA 2GA1A 4Y99C 1L0ND 1GL2C 1L0LG 2KOOA 1SQVD 1IZNB 1N73B 2E75C 1U57A 2XDJA 5KLIC 1Q81Q 4HH2A 1N7SA 2FYUE 1S4XA 3CD6P 4WWIA 2WSSH 2WPQA 2KNCA 7CEIA 4N3YB 4R4MA 3BVHA 1VQ6P 5B5EH 3O8ZA 1EQ7A 1SS1A 1URQC 1AF8A 5HGNA 1A02F 3EQ2A 4H44C 4MN4C 4HB1A 2FFDB 2M3EA 2GZEA 2JJLA 4OH8B 4BPGA 4H2XC 1L4AC 3U59A 4XFJA 1VQ8P 1IFJA 4GOEA
chains in the Genus database with same CATH topology
3HZQA 1A43A 3G0VA 3DS3A 2BUOA 1PEQA 1PEMA 3CCUP 1K30A 4PH0A 1VQLP 4U0FA 2PEQA 5HGOA 4GR6A 3OW2O 3G29A 3H4EA 2Z44A 1YIJP 5I4TG 3H47A 5F2NA 2E1MA 1Q86Q 1KD1Q 3DS1A 4IPYA 3I56P 1YITP 5HGLA 3E2DA 2M8NA 2Z45A 3G6EP 2QEXP 1QRJA 2EIAA 2KODA 2PEMA 1M90Q 3CMEP 3DTJA 3CCMP 3DS5A 4U0DA 2PEOA 3RG6C 3DS2A 3WBHA 1IUQA 3I55P 1QVGO 4COPA 3CPWO 3CCSP 3MGEA 3G71P 1VQPP 3CCLP 1K8AQ 1KQSO 1EOQA 1PEUA 3CCJP 5F2OA 5BS1A 2PEJA 3CMAP 3LRYA 1YHQP 1K9MQ 2JYGA 1ZMBA 2PEIA 1VQ9P 2DGYA 4GR2A 2QA4P 2BQ1E 1D1DA 2PEKA 3DS0A 1QVFO 1BAJA 3G1GA 5JPAA 3G28A 1RNIA 4XFXA 1Q7YQ 1NJIQ 2JYLA 3HYBA 5F2KA 4XROA 2ONTA 1YJWP 3G1IA 4XRQA 5HGMA 3DS4A 3CCRP 2LF4A 2M8LA 3CCQP 1VQ5P 2JO0A 1AUMA 1Q81Q 2L6EA 2PENA 3DPHA 1M6NA 1YJ9P 3NTEA 4WYMA 3CCVP 1A8OA 2M8PA 4PH1A 2Z46A 2XT1A 2PY8A 1S72P 3CD6P 4XFYA 1W2BO 3Q20A 1RO2A 1M74A 1K73Q 4COCA 1M6EX 3CC4P 1Q82Q 3G26A 3CCEP 1VQ6P 5BS2A 1KC8Q 2EFJA 3CXCO 1JJ2O 1E6JP 4U0CA 1YI2P 2EG5A 1VQ7P 5HGNA 2P9XA 1EIAA 3CC7P 1PEOA 3M1MA 2BHVA 4XFZA 3P05A 2OTLP 4U0EA 4U0AA 3CC2P 4QNBA 1VQMP 1VQOP 3G21A 4U0BA 5DCKA 3VRLC 1YJNP 2OARA 1N8RQ 1VQKP 2XV6A 2CWOA 1VQNP 3B5IA 1RO0A 1VQ8P 2OTJP 3G4SP 3H0DA 1M1KQ 1VQ4P 4M0IA 2XXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YI2 P;  3CCR P;  3I55 P;  1QVG O;  1VQ7 P;  3CPW O;  3CCS P;  2OTJ P;  3CCQ P;  1VQ5 P;  3G71 P;  3CC7 P;  1VQP P;  1Q81 Q;  3CCL P;  3CCU P;  1K8A Q;  1VQL P;  1KQS O;  1YJ9 P;  3CCJ P;  3CCV P;  3OW2 O;  2OTL P;  3CMA P;  1YHQ P;  1K9M Q;  3CC2 P;  3CD6 P;  1YIJ P;  1S72 P;  1VQM P;  1VQO P;  1W2B O;  1VQ9 P;  1Q86 Q;  1YJN P;  2QA4 P;  1KD1 Q;  1K73 Q;  3I56 P;  1YIT P;  1N8R Q;  1VQK P;  3CC4 P;  1Q82 Q;  1QVF O;  1VQN P;  3G6E P;  2QEX P;  3CCE P;  1VQ6 P;  1M90 Q;  1VQ8 P;  1Q7Y Q;  1NJI Q;  3CME P;  3G4S P;  1KC8 Q;  1M1K Q;  3CXC O;  3CCM P;  1JJ2 O;  1YJW P;  1VQ4 P; 
#chains in the Genus database with same CATH topology
 3VYI A;  1HTL C;  3F5H A;  4PD4 D;  3TK1 A;  3EJB A;  3AE5 C;  4YPC A;  3RK3 B;  2XZ1 C;  4GDO A;  5KLV K;  1VL2 A;  3L37 A;  1J2J B;  2M8R A;  5AVY B;  2LXC B;  3H47 A;  2K0D X;  3SFE C;  1BGY J;  2E42 A;  5CZD B;  3AED C;  1SFC B;  3H1L E;  5AW1 B;  3RK3 E;  2ZT9 B;  3P7K A;  3AEB C;  1WRG A;  2KIK A;  1KQL A;  3CCL P;  1K8A Q;  2GUV A;  4PV1 D;  3L72 J;  1PEU A;  2WSF J;  2R3C A;  4WY4 D;  4WY4 A;  5KKZ C;  4H2W C;  3LMO A;  3G1G A;  3AE2 C;  1NJI Q;  2NPS B;  2JYL A;  2W6B A;  5AVS B;  1K04 A;  3BCC D;  1NTK J;  2FYN B;  3H25 A;  4GOD A;  1H88 A;  1M6N A;  1BCC G;  4PH1 A;  4XFY A;  1RE3 A;  2L5G B;  1K73 Q;  1BGY E;  3EFG A;  2QJK C;  2WZ7 A;  3CI9 A;  2JQ4 A;  1E6J P;  3SFD C;  3VMZ A;  1PEO A;  3R4Y A;  2QE7 H;  4OGQ D;  1QL1 A;  5L8R J;  3H1K D;  3L72 E;  4I7Z C;  1UIX A;  3D71 A;  2FBW C;  2QM7 A;  1EZV D;  2BAS A;  2HOD B;  1HWT C;  2A06 E;  1L0N G;  4XA4 A;  1NTK E;  2KOP A;  1NTZ J;  3Q2Y A;  4D6T G;  1SQX K;  2D2C D;  3P8C D;  4U7J A;  2N50 A;  1E0H A;  1SQV G;  3HE4 B;  3MD0 A;  1FU1 A;  1BE3 J;  1HF9 A;  4H13 C;  3L73 E;  5AW5 B;  1S9K D;  2HYN A;  1GW4 A;  2KOD A;  3GKL C;  3GF3 A;  2WMM A;  3DS5 A;  4QKO A;  2WPR A;  4W7Y A;  2K9Y A;  3CPW O;  3WU2 H;  1NTM J;  3ABV C;  5CMZ A;  3HUS A;  5B5E E;  4NPE A;  1GK4 A;  5C39 A;  2LTE A;  3CCJ P;  2AFD A;  3M0D C;  4RKU J;  2FKW B;  3AEE C;  5JPA A;  2FXP A;  1RF0 A;  1FZB A;  2Q7C A;  4DOJ A;  2ONT A;  3GMA A;  1SP4 A;  4BWN A;  1FZA A;  3S1K A;  3D70 A;  1LWU B;  3L71 D;  1NTZ E;  1BXI A;  1SQQ G;  5AW0 B;  1XTG B;  1RO2 A;  3V2N A;  1HJB A;  2K0X A;  1P84 H;  3LID A;  4HYT B;  4DT0 A;  1R5S A;  1AV1 A;  2OYI C;  3WUT A;  5KLV D;  5CCH D;  1NTM E;  3M1M A;  2KOR A;  2KW2 A;  3P05 A;  1BDC A;  4HJG H;  2KP8 A;  1KN7 A;  1QX8 A;  2N1T C;  3RG2 A;  1ZOY C;  2KLV A;  2WPS A;  3H6P A;  2R5B A;  2VLP A;  4O9B A;  1ZR2 A;  4UHP B;  3TNU A;  2JEE A;  1PEQ A;  1RF1 A;  3A0H E;  1HH0 A;  1RE4 C;  3C8V A;  2MVV A;  3BCC G;  2MR8 A;  4IPY A;  2JU1 A;  1GD2 E;  3TSI A;  1VF5 B;  2W6J H;  3V2Q A;  1N73 C;  3KYQ A;  1FBM A;  3AE1 C;  1BSH A;  3M9H A;  1DH3 A;  1KB9 E;  3FWN A;  4ZNC A;  1GXH A;  3RL0 D;  1JNM A;  5KP7 B;  1LTT C;  5B66 H;  1E5W A;  2FHS C;  1LTB C;  1Q7Y Q;  3H1K G;  3SWK A;  1AFO A;  1LTJ B;  4WVZ A;  2RKL A;  1FZG A;  2OYH A;  2N6Z A;  1EZV G;  3HE5 A;  4PD4 H;  4LGD E;  2KS1 A;  2HPC B;  1IFP A;  2RH0 A;  2C9L Y;  2L9F A;  2GZG A;  2K94 A;  2FFD C;  2PRR A;  5BS2 A;  5AVT B;  2QJP B;  2YIU B;  2ZVO B;  3L4F A;  2QIW A;  1SQX D;  4CA3 A;  2KGD A;  2KXP B;  1HBW A;  3OAK A;  1RY3 A;  1KTM A;  4L75 A;  1MKM A;  2H43 A;  4U0E A;  3A3Y B;  4QNB A;  1NAF A;  3WU2 E;  1OW8 A;  3VRL C;  5APU A;  4KHX A;  3W67 A;  1KIL D;  1KIL A;  1Q90 D;  1ZRT E;  3MIW A;  4K3A A;  1IJD B;  5CBO A;  2Y9Y A;  1LP1 A;  3IN6 A;  1SFC C;  2BCC D;  4D6T J;  3A0B H;  4EDF A;  2ZT9 C;  5HGO A;  2E76 C;  1FZC B;  1SQV J;  3CL3 D;  3IFM A;  1NU1 J;  2ZAE B;  2IBZ D;  3L71 G;  1R5L A;  1PV3 A;  3GG2 A;  1SQB K;  1R8E A;  1PP9 D;  1IFM A;  1KB9 I;  4COP A;  1P84 E;  2K92 A;  2NPS C;  5APS A;  2Z4E A;  2FYN C;  1HUC A;  1FDM A;  3M06 A;  4GR2 A;  5KLV G;  2PP6 A;  1GMJ A;  3GW6 A;  5TIS H;  2FAC A;  4IL6 X;  5HGM A;  2LF4 A;  3MGN A;  5AW2 B;  2JR8 A;  1NOH A;  1JOC A;  3AE4 C;  3L74 D;  4BPF A;  1ACP A;  4GT1 A;  4D6T E;  3L75 J;  1SQQ J;  1OVU A;  5CJ0 A;  2KNC B;  1GZL A;  3N4X A;  1AYI A;  1NU1 E;  1ZNV A;  4PXH B;  4AQR D;  3CCE P;  1EXJ A;  2KG8 A;  1KC8 Q;  2KYV A;  2L22 A;  1ZXG A;  2W27 A;  3PTZ A;  3CXH H;  3M91 A;  1JMB A;  4CPG A;  2DW3 A;  4OWF A;  1VHN A;  3B5I A;  2KK7 A;  2YMY A;  1WMK A;  2K9J A;  2DNW A;  2Q9I A;  3L70 J;  1NWQ A;  2JKV A;  1J1E B;  1QEX A;  5B66 E;  1X0T A;  4Z1M H;  1GTW A;  1KOR A;  4U0F A;  5I4T G;  3L75 E;  1SQQ E;  1YIT P;  1FZE A;  4GKG A;  1KV4 A;  4PD4 E;  2IFM A;  4KJM A;  2WT7 A;  1PPJ D;  3MHV A;  2M5A A;  4AYC A;  2FXM A;  2CPB A;  2WWW A;  2JGP A;  5H2F H;  4W80 A;  2LKM A;  1CSB A;  4PV1 B;  1SLQ A;  5KAF E;  4TLF A;  4WY4 B;  3CMA P;  1YHQ P;  1W5C E;  1ZMB A;  1SQX G;  1LWU C;  2E43 A;  2E5Y A;  3M9B A;  1NKN A;  1N86 A;  4I1L A;  2FYU K;  3HYB A;  2QVA A;  3H1J E;  1FR2 A;  3B5N D;  2VSQ A;  2KB7 P;  2YO2 A;  4ZKU A;  3L70 E;  1EDI A;  1DIP A;  3AEF C;  2AEM A;  2P2U A;  1SQP E;  3NTE A;  3VP8 A;  2JAZ A;  1AQT A;  4BRY A;  3Q20 A;  1M74 A;  3A0B E;  1GPJ A;  2RN0 A;  4UB8 H;  1FJK A;  3OA7 A;  3RK2 D;  2IBZ G;  1H0T B;  2FAE A;  1HY8 A;  4IZ6 A;  3H1H E;  1S1C X;  4OGQ B;  1USE A;  1N7S D;  2BEZ F;  1T2K C;  3CC2 P;  1PP9 G;  2V7Q H;  3G21 A;  2QRX A;  1MUU A;  1VQK P;  2FQ0 A;  1SQB D;  2YKP A;  4DG9 A;  3HZQ A;  2ZVN B;  2D2C B;  1KFN A;  1Y47 A;  1T3U A;  2A45 G;  4U3F J;  5GTI H;  5CJ4 A;  3CX5 H;  3D6Y A;  1VF5 C;  1KYO H;  3Q5R A;  2C9N Y;  4ZMD A;  3L74 G;  1JY3 P;  1QRJ A;  2EHT A;  1X8Y A;  5KTB A;  3MZW B;  1LGH B;  3AE6 C;  2B87 B;  2E74 D;  1YTZ I;  5AW6 B;  2R3S A;  3M0D A;  2IPP A;  1G2C A;  2N6Y A;  1S9K E;  1LTJ C;  2UWJ E;  1VQ9 P;  2WTY A;  3O6Q B;  3CXH E;  1M1J B;  1BAJ A;  1JCD A;  3G28 A;  1OW6 A;  5F2K A;  2K1A A;  2M0B A;  4UB6 H;  3S4R A;  1KQF B;  2E76 B;  2M8L A;  5CHX A;  3CCQ P;  3G9R A;  2IZ1 A;  4JPZ B;  4PJ0 H;  1FE6 A;  5GTH E;  1EDK A;  3DPH A;  2QJP C;  4N6J A;  2YIU C;  4U3F E;  3TGU D;  2XU6 A;  1M57 D;  2ZYA A;  1S5L H;  2OYI A;  2ZXX A;  2FY8 A;  3C1L A;  2PAJ A;  2SPZ A;  4C46 A;  1RQV A;  5CCG C;  1YI2 P;  3A2A A;  1X79 B;  3AE8 C;  2P9X A;  2YKQ A;  1YBK A;  2N1T A;  2LXB A;  1PPJ G;  3JCU H;  4XFZ A;  2Q1K A;  5E79 H;  3H1I G;  4C7N B;  5H2F E;  1YJN P;  4IFF A;  2OAR A;  2Y9Z A;  2AF8 A;  2AEJ A;  3P32 A;  1FZC C;  1RO0 A;  4GOF A;  2V7Q J;  2KUB A;  1VQ4 P;  3TNU B;  1LTI C;  1RE4 A;  3HTK A;  2XZ0 D;  3AEA C;  2A45 H;  1K30 A;  4IFM A;  3H32 A;  5KJ7 D;  5KJ7 A;  1KD1 Q;  2FYU D;  3CWB J;  4R0M A;  1PL5 A;  3LIE A;  3CME P;  1FZF A;  4U0D A;  1N73 A;  3KZI H;  3G71 P;  2R44 A;  2MY5 A;  1KQG B;  1X22 A;  1VKU A;  3E7K A;  1SQX J;  2XKM A;  3RL0 B;  1GDT A;  1LT1 A;  2MJZ A;  1NTZ K;  2CQ8 A;  2MVU A;  1PGO A;  1VQ5 P;  2OYH B;  1PGQ A;  1SQB G;  5APW A;  2FFD A;  2KS1 B;  1AJY A;  3PHL A;  2M8P A;  1EDL A;  4LLH A;  2ZFC A;  5AVR B;  3GLM A;  2KG6 A;  1JY3 O;  2I1J A;  1NTM K;  2PFX A;  2K88 A;  1S5L X;  4EI2 A;  2BEQ D;  3CWB E;  2GUS A;  3EWK A;  1L0L J;  1K05 A;  4U0C A;  3CX5 E;  2J59 M;  2W90 A;  2EG5 A;  1KYO E;  1FDO A;  3H1L D;  2M3B A;  1LT9 B;  2OTL P;  1J1E C;  1PP9 J;  5APX A;  2J58 A;  1KIL B;  1BE3 E;  1GU4 A;  1FAV A;  2OTJ P;  1SFC A;  3V2P A;  2JBG A;  5AW3 B;  2KWL A;  5APT A;  1H8A A;  2PGD A;  2AXC A;  3SWF A;  1LP1 B;  1LTG C;  2CPS A;  1PEM A;  1NVO A;  3GZM A;  4UB6 E;  2WIT A;  5BU5 A;  4A7P A;  1Q86 Q;  3E1I A;  4PJ0 E;  4PV1 C;  2M8N A;  3V6I A;  3L74 J;  4WY4 C;  2C0X A;  3RG6 C;  2GYK A;  1JY2 O;  1L0L E;  3TGU G;  1BGY D;  3I55 P;  3MGE A;  5AVX B;  1S2E A;  3KDP B;  2WPV B;  1MZ8 A;  1K9M Q;  3HD7 D;  1AA0 A;  3HD7 A;  2PEI A;  1OWA A;  1PP9 E;  2NRG A;  1M7L A;  3MUD C;  3JCU E;  2LPK A;  3L72 D;  1PGJ A;  1IO4 A;  5E79 E;  1RE3 C;  2HFE D;  1HQB A;  1YJW P;  4XRO A;  2O01 N;  4JQ0 D;  1OW7 A;  1YTZ T;  1UJZ A;  2KZI A;  1OIP A;  2K2Q A;  2LR2 A;  4WBA A;  2A06 D;  1IK9 A;  4M3L A;  4OGQ C;  1M6E X;  3CC4 P;  1NH4 A;  2KI7 B;  2GM4 A;  2W83 C;  3CE7 A;  4IL6 H;  3L74 E;  3L73 D;  2IYP A;  1NO4 A;  5AVQ B;  1VQ7 P;  1BDD A;  2FYU G;  3VOP A;  4N78 E;  1M8O B;  3B4Q A;  3HE4 A;  1BCC J;  5APQ A;  3H1I J;  2D2C C;  3USS A;  2FQ1 A;  2FXO A;  2O01 H;  3T97 B;  1NQ4 A;  2IX7 C;  3GHG A;  4KT0 J;  2R5D A;  1NYH A;  2XXM A;  3V5B A;  1Z6M A;  3G0V A;  1JCC A;  3DS3 A;  3EJD A;  2KZJ A;  1DX7 A;  3CCU P;  2J5U A;  4PH0 A;  4RES B;  3OW2 O;  3VMX A;  2KG9 A;  2AXT H;  3DS1 A;  1NTZ D;  3E2D A;  2H8P D;  3U43 A;  2PEM A;  3F89 A;  1M1J C;  4H0L D;  2JB0 A;  1L0N J;  1RF0 C;  1LWU A;  1EXI A;  1KQS O;  1FJP A;  3OJA B;  2JP3 A;  1QLE D;  1GXG A;  1NTM D;  1BCC E;  2N5H A;  3MP7 B;  3H1I E;  3H1L G;  4PWV B;  2POH A;  3IAO A;  3JSV C;  3B5N B;  4OVN F;  3G1I A;  1ZME C;  2EHS A;  3CCR P;  4K35 A;  4BXL A;  1NU1 K;  2P10 A;  1EC5 A;  3CLQ A;  3W68 A;  1UNK A;  1FOS E;  1GL2 D;  1A8O A;  1GL2 A;  4BRY B;  1NGM B;  1MV8 A;  1W2B O;  5CCH C;  4RO0 A;  2AFE A;  2E75 D;  2IDB A;  3G26 A;  4L73 A;  2IYO A;  1JM0 A;  1KLP A;  3RK2 B;  2H89 C;  4DZO A;  1L0N E;  1N7S B;  2K37 A;  1OVR A;  3VP9 A;  1LTS C;  2KOS A;  2HLO A;  1BGY G;  4U0B A;  1SQV E;  1URQ D;  1URQ A;  1N8R Q;  4H44 D;  3EFF K;  1LTA C;  1KB9 D;  1L0H A;  3IR9 A;  3AE3 C;  2YNY A;  1SQQ K;  2O01 J;  4H2Y C;  5EW5 E;  4HKZ H;  1L0I A;  1VQL P;  2FAD A;  2M5R A;  1L4A D;  1L4A A;  4GR6 A;  2LKI A;  1IC2 A;  1DNY A;  3NXS A;  5F2N A;  4EIJ A;  4LC1 A;  2GZF A;  2A06 G;  2MKV A;  3CCM P;  2XV5 A;  3BAT A;  1ZV8 A;  4GIF A;  3RL0 C;  5M1B A;  1CI6 A;  1QVG O;  4MRT C;  2CK3 H;  2E74 B;  3TGU J;  1MZ9 A;  5CBN A;  3B8E B;  4B86 A;  4IL6 E;  1N7L A;  3L73 G;  2HPC A;  2OYH C;  1L2P A;  3BCC J;  2QA4 P;  2PEK A;  4L74 A;  1SQP K;  1P84 I;  2CG5 B;  2N5I A;  2W8Z A;  1JMM A;  2C0W A;  1J1D B;  2ITA A;  1ZRT D;  3NY7 B;  1W2E A;  2GDX A;  3EJE A;  2O1J A;  5APV A;  2MF4 A;  2P58 A;  2Z46 A;  3HRN A;  1LT9 C;  2Q6Q A;  3AE9 C;  3NFQ A;  2AXT E;  2I1K A;  3H1K J;  1KIL C;  2V4H A;  2JDI H;  3TGU E;  3VMY A;  1FZC A;  4JBZ A;  3Q5P A;  1P84 D;  5DCK A;  5KAI H;  4RJT A;  2CNR A;  4EYY Q;  3BCC E;  2BCC G;  3FXD A;  4M0I A;  3HTK B;  3GF7 A;  3LW5 H;  1NTM G;  2LIW A;  3G3Z A;  2OGU A;  1ZLL A;  2FVA A;  3L36 A;  1YIJ P;  2KOQ A;  3FXE A;  2KOG A;  4D6T D;  2ZXE B;  2QEX P;  4JYC A;  1Z56 A;  1JB0 J;  4ASW A;  1TU3 F;  4W7Z A;  2KGA A;  4JYB A;  1KMI Z;  1NU1 D;  2QJY B;  1OMI A;  3H1K E;  3U1A A;  4NEO A;  2P7J A;  1FDI A;  4H13 D;  1VQP P;  5TIS E;  4PD4 I;  2XND H;  1EZV E;  4ASV A;  4IFD K;  3DS0 A;  5KP6 B;  1QVF O;  3H1L J;  3RL0 g;  1YQ3 C;  1OR5 A;  3L35 A;  3L71 J;  1RNI A;  4XFX A;  5DJT B;  3P8C E;  3DS4 A;  5BVZ A;  2IZ0 A;  3HUS B;  2PEN A;  1S3J A;  2VRS A;  3BRT B;  3CCV P;  1QL2 A;  1CZQ A;  1S72 P;  3ITK A;  3VN0 A;  2QG4 A;  5KLV J;  2IFN A;  1G1I A;  4NPD A;  3D6Z A;  3L75 D;  1SQQ D;  2K93 A;  2LOL A;  4IOI H;  1IMQ A;  4BPH A;  4Y28 J;  1FS0 E;  1JTH A;  2YXQ B;  2FQ2 A;  1HJ0 A;  1VQM P;  1G1J A;  4QMA A;  2XV6 A;  5EJD A;  1VQN P;  3V4W A;  3G4S P;  3L71 E;  1CEI A;  5AW9 B;  1BSN A;  2YO3 A;  2OQQ A;  3H1J D;  1JY2 P;  2N1T D;  3FX0 A;  3LW5 J;  1EDJ A;  3K5B A;  2KR5 A;  3UIA A;  3H4E A;  3L70 D;  4C7R A;  2LL8 A;  2E1M A;  3I56 P;  1SQP D;  1NTK K;  5HGL A;  4F37 A;  2K0Y A;  5KLV E;  3TF5 A;  3A0H H;  1OXZ A;  2NZ2 A;  1AQ5 A;  1EZV I;  3CCS P;  2Q3I A;  3MUD A;  1RF1 B;  3B5N C;  1RQU A;  1A02 J;  2QM8 A;  3TDK A;  3HD7 B;  3L73 J;  4HKG A;  3H1H D;  3WMM 0;  2YKO A;  5KAI E;  1H0T A;  1LJ2 A;  1KB9 H;  4NPF X;  1AVO A;  3CXH I;  2JO0 A;  4UB8 E;  3Q5S A;  2Q5U A;  2P67 A;  3FGA D;  3RK2 C;  2XT1 A;  2B9B A;  3KPE A;  3RBX A;  1E79 H;  1YQ4 C;  2AVA A;  4YXW H;  1N7S C;  2LIU A;  1IK7 A;  1U7J A;  3C9I A;  1JJ2 O;  2WVR A;  2N98 A;  1MFT A;  2K5X A;  3SWY A;  4DJG A;  1EIA A;  3HE5 B;  2PNG A;  1N2D C;  3A5T A;  1NU1 G;  1F80 D;  1UII A;  2BCC J;  3GHG B;  3NMD A;  3AEG C;  3H0D A;  4L76 A;  5GTI E;  3CXH D;  2B87 A;  2QSI A;  3AE7 C;  1FC2 C;  1USD A;  3PP5 A;  1HGV A;  2BUO A;  3IF4 A;  1T6A A;  3E1R A;  3RK3 D;  1U7M A;  2Z5I A;  2E74 C;  2Z44 A;  1L0L K;  2P1J A;  2FVF A;  3M9Q A;  2YMK A;  2G8Y A;  3MTU E;  3O6Q A;  4WB4 A;  1IFN A;  1M1J A;  1SQX E;  2R32 A;  3B71 A;  1SFC D;  3DTJ A;  4U3F D;  1EMV A;  2PEO A;  2H88 C;  2ZT9 D;  2E76 D;  3WBH A;  4AUW A;  3PH0 A;  2L4B A;  4H0L B;  1WT6 A;  1VDF A;  2ZYG A;  1DV5 A;  5HVC A;  2Q3E A;  3L75 G;  5AW4 B;  1KIL E;  1J1D C;  2HR3 A;  5BS1 A;  2PEJ A;  1PFI A;  2BQ1 E;  1D1D A;  2VLQ A;  3PRJ A;  2NPS D;  2NPS A;  2BCC E;  4XRQ A;  2ZYD A;  5AVV B;  1FOS F;  1S5L E;  5CCH A;  2KGC A;  3V2R A;  1JO5 A;  4Y99 B;  2IBZ E;  1DEB A;  5K5G B;  3VTP C;  1GL2 B;  4WYM A;  3Q3D A;  4C7N A;  2E75 B;  4COC A;  3H1J G;  1Q82 Q;  1PGP A;  5KLI B;  2OTK E;  3KQG A;  1ZP0 C;  3L70 G;  2QNW A;  5BU8 B;  5HV8 A;  1SQP G;  2E5T A;  2W6A A;  2KSJ A;  3CC7 P;  2BHV A;  3TYY A;  1Y8A A;  2VLN A;  4EOT A;  1T8K A;  1NTK D;  3CX5 I;  2GZJ A;  1URQ B;  1KYO I;  3PJS K;  2CWO A;  4H44 B;  1T3J A;  5KJ7 C;  4U0A A;  2HOD A;  3H1H G;  4ZKP A;  1DD3 A;  1NHL A;  1L4A B;  1M56 D;  2QJY C;  3KZI E;  2KSE A;  1DEE G;  5APY A;  3N7N A;  1VPC A;  1Y9B A;  3M0A A;  5EFW B;  2MD9 A;  2EIA A;  1XTC C;  1YYC A;  2O3J A;  3DS2 A;  2K9J B;  1CI6 B;  1GU5 A;  2K3R A;  3CWB D;  3U1C A;  1KZU B;  2GDY A;  1EOQ A;  3CX5 D;  2JO1 A;  1KYO D;  5F2O A;  3LRY A;  2YXR B;  5TJH A;  2KLU A;  5AVW B;  5AW7 B;  1X9V A;  3HUS C;  2IBZ I;  4R4L A;  2B88 A;  2WT7 B;  2G3A A;  2JU2 A;  2M5A B;  5KAF H;  2CGQ A;  1BE3 D;  2KGE A;  5KKZ B;  1IFD A;  5AW8 B;  1ZN5 A;  2H7H A;  3WUU A;  1AUM A;  3JC2 2;  1GK6 A;  1YJ9 P;  2L91 A;  3II6 A;  1LT9 A;  4YXD C;  2PY8 A;  1PPJ E;  1AVY A;  3RK3 C;  2GDW A;  1NAY A;  3SSU A;  2X2B A;  1L0N K;  3B4S A;  2XZR A;  1JEK A;  3AEC C;  1SQV K;  2O1K A;  2A45 I;  2AEF A;  3R2P A;  1SQB J;  4U3F G;  1L0L D;  2QJK B;  3QWO C;  5DJU B;  2ERH A;  3RGU A;  2OYO A;  3GJN A;  3WUV A;  1PIX A;  1A43 A;  1T2K D;  4I7Z B;  1GW3 A;  4XE5 B;  5AVZ B;  5AVU B;  1HVV A;  1CW5 A;  2PEQ A;  2Y0D A;  2N9B A;  2VLO A;  1NKZ B;  2HG5 D;  2WSC H;  2WSE H;  1RF1 C;  4TT3 H;  1PZQ A;  3G6E P;  3HD7 C;  3BRV B;  2ZJS E;  1D7M A;  1LNQ A;  1ZW0 A;  1OVV A;  3A7O A;  4H13 B;  1VF5 D;  3L72 G;  1SQB E;  1DD4 A;  1OFC X;  2DGY A;  4N78 D;  2RMZ A;  3RBZ A;  5KP8 B;  3FWL A;  2MR7 A;  4DCK A;  1NTK G;  1JUN A;  1RHZ B;  1LTJ A;  3PLN A;  2WPT A;  1JY3 N;  2XNX A;  2LML A;  2L6E A;  1G2C B;  2ROQ A;  3H1J J;  3T97 A;  2WQY C;  1IMP A;  5GTH H;  2EFJ A;  2L0Q A;  3CXC O;  2JWA A;  1ZR4 A;  3V4Q A;  3S9O A;  3GZL A;  2Y0C A;  1SQP J;  1JTH B;  2GZI A;  3GHG C;  3P8M C;  3QH9 A;  3VMA A;  3KXD A;  1VQO P;  3ZDM A;  1H89 A;  4YTP C;  5CCG D;  3CWB G;  5CCG A;  4I6M C;  2OYI B;  1X3O A;  1M1K Q;  1SVF A;  2N9Y B;  1BCC D;  3Q1M A;  3H1I D;  4I2L C;  3H1H J;  1NTZ G;  1OX3 A;  2FYU J;  2N1T B;  2FYZ A;  1IFI A;  3G29 A;  3KHU A;  4H0L C;  1BE3 G;  2NO8 A;  3I5C A;  1JY2 N;  2B89 A;  2Z45 A;  2JWD A;  1M90 Q;  3NTN A;  3B5N A;  2Z5H A;  2WSC J;  2WSE J;  2I8D A;  1IUQ A;  1KFM A;  2WSF H;  1HGZ A;  1RH5 B;  1Q2N A;  3BAS A;  1T8Z A;  1OZH A;  3H32 B;  1MFZ A;  2Y0E A;  1QGK B;  2JYG A;  4JF7 A;  2FVE A;  2GA1 A;  4Y99 C;  1L0N D;  1GL2 C;  1L0L G;  2KOO A;  1SQV D;  1IZN B;  1N73 B;  2E75 C;  1U57 A;  2XDJ A;  5KLI C;  1Q81 Q;  4HH2 A;  1N7S A;  2FYU E;  1S4X A;  3CD6 P;  4WWI A;  2WSS H;  2WPQ A;  2KNC A;  7CEI A;  4N3Y B;  4R4M A;  3BVH A;  1VQ6 P;  5B5E H;  3O8Z A;  1EQ7 A;  1SS1 A;  1URQ C;  1AF8 A;  5HGN A;  1A02 F;  3EQ2 A;  4H44 C;  4MN4 C;  4HB1 A;  2FFD B;  2M3E A;  2GZE A;  2JJL A;  4OH8 B;  4BPG A;  4H2X C;  1L4A C;  3U59 A;  4XFJ A;  1VQ8 P;  1IFJ A;  4GOE A; 
#chains in the Genus database with same CATH homology
 3HZQ A;  1A43 A;  3G0V A;  3DS3 A;  2BUO A;  1PEQ A;  1PEM A;  3CCU P;  1K30 A;  4PH0 A;  1VQL P;  4U0F A;  2PEQ A;  5HGO A;  4GR6 A;  3OW2 O;  3G29 A;  3H4E A;  2Z44 A;  1YIJ P;  5I4T G;  3H47 A;  5F2N A;  2E1M A;  1Q86 Q;  1KD1 Q;  3DS1 A;  4IPY A;  3I56 P;  1YIT P;  5HGL A;  3E2D A;  2M8N A;  2Z45 A;  3G6E P;  2QEX P;  1QRJ A;  2EIA A;  2KOD A;  2PEM A;  1M90 Q;  3CME P;  3DTJ A;  3CCM P;  3DS5 A;  4U0D A;  2PEO A;  3RG6 C;  3DS2 A;  3WBH A;  1IUQ A;  3I55 P;  1QVG O;  4COP A;  3CPW O;  3CCS P;  3MGE A;  3G71 P;  1VQP P;  3CCL P;  1K8A Q;  1KQS O;  1EOQ A;  1PEU A;  3CCJ P;  5F2O A;  5BS1 A;  2PEJ A;  3CMA P;  3LRY A;  1YHQ P;  1K9M Q;  2JYG A;  1ZMB A;  2PEI A;  1VQ9 P;  2DGY A;  4GR2 A;  2QA4 P;  2BQ1 E;  1D1D A;  2PEK A;  3DS0 A;  1QVF O;  1BAJ A;  3G1G A;  5JPA A;  3G28 A;  1RNI A;  4XFX A;  1Q7Y Q;  1NJI Q;  2JYL A;  3HYB A;  5F2K A;  4XRO A;  2ONT A;  1YJW P;  3G1I A;  4XRQ A;  5HGM A;  3DS4 A;  3CCR P;  2LF4 A;  2M8L A;  3CCQ P;  1VQ5 P;  2JO0 A;  1AUM A;  1Q81 Q;  2L6E A;  2PEN A;  3DPH A;  1M6N A;  1YJ9 P;  3NTE A;  4WYM A;  3CCV P;  1A8O A;  2M8P A;  4PH1 A;  2Z46 A;  2XT1 A;  2PY8 A;  1S72 P;  3CD6 P;  4XFY A;  1W2B O;  3Q20 A;  1RO2 A;  1M74 A;  1K73 Q;  4COC A;  1M6E X;  3CC4 P;  1Q82 Q;  3G26 A;  3CCE P;  1VQ6 P;  5BS2 A;  1KC8 Q;  2EFJ A;  3CXC O;  1JJ2 O;  1E6J P;  4U0C A;  1YI2 P;  2EG5 A;  1VQ7 P;  5HGN A;  2P9X A;  1EIA A;  3CC7 P;  1PEO A;  3M1M A;  2BHV A;  4XFZ A;  3P05 A;  2OTL P;  4U0E A;  4U0A A;  3CC2 P;  4QNB A;  1VQM P;  1VQO P;  3G21 A;  4U0B A;  5DCK A;  3VRL C;  1YJN P;  2OAR A;  1N8R Q;  1VQK P;  2XV6 A;  2CWO A;  1VQN P;  3B5I A;  1RO0 A;  1VQ8 P;  2OTJ P;  3G4S P;  3H0D A;  1M1K Q;  1VQ4 P;  4M0I A;  2XXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...