3CCVP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ccvP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ccvP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ccvP02
1YJNP 1YI2P 1M90Q 1YHQP 3CD6P 3CCQP 1KQSO 3CCSP 1QVFO 3CMEP 3CCVP 1Q7YQ 3CC4P 1VQPP 1W2BO 1Q86Q 3G4SP 3CCUP 1QVGO 1NJIQ 1YIJP 3G6EP 1KC8Q 1VQ5P 3CCRP 3CPWO 1VQ7P 1YJ9P 1K73Q 3CCJP 2QEXP 1Q81Q 3G71P 1M1KQ 1Q82Q 1JJ2O 3OW2O 1VQOP 1VQ4P 1VQNP 1S72P 1VQLP 3CC7P 1YJWP 1KD1Q 3CCLP 3CMAP 1K9MQ 3I56P 1N8RQ 1VQMP 1VQ8P 2OTLP 1VQKP 3CXCO 1YITP 1K8AQ 3CC2P 3CCEP 3I55P 3CCMP 1VQ6P 1VQ9P 2QA4P 2OTJP
chains in the Genus database with same CATH superfamily
1YJNP 3GHGB 1URQB 3D6ZA 3CXHI 2QSIA 1PEQA 1JY2O 3B5IA 2FADA 4KJMA 4PD4H 3L72D 1VPCA 2R3CA 2YXQB 4N78E 3L70G 2J5UA 4IL6E 1E6JP 4XE5B 2AEJA 3G9RA 1JY2N 2KG9A 1GD2E 1NTZJ 1DD3A 2WQYC 1IJDB 1SFCA 1KYOI 1N8RQ 1NYHA 3M06A 1RO0A 3RK3E 3CI9A 1KILC 1X22A 3AE9C 2Z5HA 4U0CA 2L6EA 1OW8A 1PFIA 3MIWA 4H0LB 3F5HA 2JB0A 4AQRD 3P7KA 2N6ZA 1DX7A 1RE4C 5KLVG 1NTMG 4L76A 4WYMA 4DCKA 3CCRP 1VQ7P 2OARA 5BS1A 1S72P 1FJPA 2LTEA 2FBWC 4IFFA 1A8OA 5KLVE 1Q2NA 2JBGA 1YHQP 2FQ0A 2O01H 5B66H 3BRTB 5CCGC 3CWBJ 3GKLC 4L74A 4XFXA 1ZRTD 1AF8A 2W6BA 1LTTC 1RE3C 1OIPA 2FHSC 2KNCA 2OYHB 1Q90D 2W6AA 2K1AA 5KJ7A 3Q5RA 2LKMA 3B4SA 2JKVA 3OJAB 1WT6A 4WBAA 1QVGO 1FZAA 3U1AA 2LIWA 4OGQC 5DJUB 2BCCJ 1NTKK 3CPWO 3AEDC 2WVRA 3RL0D 1USDA 3DS5A 2FFDB 3NTEA 4W7ZA 5CBOA 5DCKA 2E74D 3JCUH 2PEKA 3G28A 1P84I 2IX7C 3CX5I 4R0MA 2HPCA 2OYOA 1SP4A 2E75B 5CMZA 2BUOA 2VLQA 3L75G 1N7SD 3HE4B 1ZR4A 4K35A 2IZ0A 1RNIA 3T97B 1RF1B 1LTJC 5CCGA 1FS0E 3HE5A 2D2CB 2DNWA 3EWKA 4LGDE 1J1EC 2K9YA 4D6TE 3H1JD 3WUVA 1HGVA 1RE3A 2NRGA 3H1LD 2V7QJ 4U3FE 2W83C 2LR2A 3MP7B 3V4WA 2KWLA 3TGUG 1NOHA 1SQQD 2YIUB 2CPBA 3CXHD 1JMBA 3HUSC 1L4AD 2KORA 4WVZA 1PL5A 3TGUE 5HGLA 2FQ1A 1LTGC 3Q5PA 3DS3A 2JDIH 3WMM0 1M74A 3FXDA 4HJGH 5K5GB 1YI2P 1H0TB 3S1KA 2E76C 1S2EA 5BS2A 1LTJA 3B5NB 1YIJP 3P32A 4DOJA 1KTMA 5APUA 4IFMA 1OX3A 1BCCE 1K9MQ 5HVCA 2WPVB 1VDFA 1U7MA 3LIDA 3I55P 2IZ1A 3NXSA 2KZJA 3M0DA 2OQQA 2QJYB 4GT1A 1N7LA 1KILD 3Q1MA 2FKWB 3VYIA 3H1IJ 4EYYQ 2JU2A 4GOFA 2M8NA 3A0HH 1OW6A 2GDWA 2ZT9C 3RK2B 3AECC 3L72E 4U0AA 3AEAC 4BRYB 2XDJA 5KAIH 2MR8A 1GK6A 1IFNA 4QNBA 2JWDA 1SFCB 2KLUA 1OR5A 1ZV8A 1LNQA 2DGYA 1KQLA 2PEIA 3H1HJ 3H1KE 1EDKA 3BASA 2M3EA 1XTCC 1ZMBA 2P67A 5H2FE 3WU2E 4MN4C 3A3YB 3S9OA 3GF7A 1U7JA 3GLMA 2KB7P 1FZEA 1NKZB 3V4QA 4YXWH 3LIEA 2YNYA 1YQ3C 1ZLLA 3CX5D 1K30A 2FYUD 2KGAA 2G3AA 4PD4I 5AVYB 2HODA 4HKZH 2JQ4A 1GL2D 2C9NY 4PJ0E 2BHVA 1IUQA 2K2QA 5APQA 1NGMB 3H4EA 1JM0A 4JYBA 5AW4B 2A45G 4CPGA 4I7ZC 1YITP 1SQVG 1YYCA 1KQFB 2AEMA 2ZXXA 2XZ0D 2KOOA 2JP3A 1OW7A 1QL1A 2L5GB 1TU3F 1ZN5A 2CG5B 1NU1G 3AE6C 1SVFA 1XTGB 2ZYGA 1KZUB 4W7YA 5E79E 5AW8B 1HBWA 5AW1B 3DS2A 1JB0J 2CK3H 2LKIA 1PP9G 3VMYA 3RGUA 2HPCB 4H13D 2QRXA 3U43A 1NU1E 4N3YB 5HGMA 2Y0CA 2H7HA 2AXTE 4WY4D 3K5BA 1FR2A 2N1TB 1SQBK 2BCCD 1KFNA 1PP9E 3A7OA 1YTZT 3QH9A 1IK7A 4IFDK 2NPSA 3Q20A 2K93A 1RH5B 1MFZA 3N4XA 1GXGA 3O8ZA 2VSQA 3HD7A 5GTHE 2QJPC 2K9JA 3P05A 3G21A 2ITAA 1S5LH 2VLPA 3H0DA 1L0LK 3H1LE 3CLQA 1GMJA 1LT9A 5EW5E 2M8PA 2BASA 4GOEA 1BAJA 2YKQA 3Q5SA 4XA4A 2N5HA 3L74G 4NPEA 1JCDA 3VMAA 1UJZA 2JYLA 2H89C 4BWNA 3L73J 2E5TA 1SQXK 3BCCE 3KDPB 3CXHE 3NMDA 1JMMA 3MHVA 2WTYA 1LTIC 3L74E 2BEQD 4ASVA 4C7RA 2GA1A 2KK7A 2K0YA 1SQBJ 2FACA 1OVRA 2H88C 5KLIB 3Q2YA 1VF5D 4W80A 1NTKD 5AVXB 1EQ7A 2JO1A 2LMLA 1IC2A 2MJZA 3WBHA 4TT3H 3KXDA 3H1JJ 2C0XA 1FDIA 2M5AA 3RK3B 1E0HA 2KUBA 4L73A 1S9KE 1S3JA 1OMIA 5APTA 1SQQJ 1URQD 2Q1KA 1KYOE 1QX8A 3RL0C 3MTUE 2CWOA 1UNKA 1OWAA 1L0LJ 1JTHB 1LTBC 1X0TA 2E74C 2NZ2A 4U0FA 1T3UA 4BPHA 1KILE 2P2UA 3RG6C 1ZP0C 1N7SC 1NAYA 2AFDA 2O1KA 2KG6A 1SQXJ 2PENA 4PD4D 5KKZC 1SQPK 4COCA 1D7MA 1USEA 1EZVD 3FX0A 2KG8A 3GMAA 1BE3J 3M1MA 1NTZG 5CJ0A 3E1RA 4GODA 3UIAA 2PEMA 4UB6E 4H0LD 4Y99C 3CC4P 4H2XC 5APXA 3G1GA 2IBZI 2MY5A 1NTZE 2LOLA 3H1HD 2FYUK 2GZJA 1PGPA 1Z6MA 2GZGA 1VQNP 3A0BH 3CC7P 1L4AC 3U59A 1KFMA 1VQ8P 1VQKP 3DS4A 1NHLA 2N6YA 1E79H 1EOQA 2HODB 4WWIA 2P9XA 3GZMA 1P84E 2PRRA 3CX5E 1LTAC 1MV8A 4HH2A 1N73B 2CPSA 3NFQA 1FJKA 1N7SA 3OW2O 1JOCA 3SFEC 1EDIA 2Z44A 1GXHA 1YJWP 2FY8A 3TK1A 3SWYA 2EHTA 3CWBG 2K92A 1SQPJ 4UB8E 2ZFCA 2WSSH 3VMZA 1PGJA 2N50A 5EJDA 5AW5B 4U0DA 4N6JA 1OVVA 1BSHA 5AW9B 3CWBE 3GZLA 1T6AA 2FVFA 4L75A 5HGNA 1N86A 4UHPB 2L0QA 5TISE 2E75D 1HWTC 1BGYD 3SWKA 2FYUJ 1L4AA 4DZOA 1L0HA 4BPFA 3HTKA 5GTIH 3KZIH 1Y47A 2NPSB 2WT7A 1QGKB 1K04A 5AVZB 1M1JC 1HH0A 2D2CD 3TYYA 5CCHD 5KLVK 1NTMK 1JY3P 1YTZI 5AVTB 1FOSF 5KTBA 1JNMA 3N7NA 2OYIC 2P10A 5AW3B 2K0XA 1AQ5A 3CCUP 2IYOA 5KP6B 1HF9A 1OVUA 1LT9B 1MUUA 1PZQA 2ZVOB 3VP8A 1LT1A 4H44B 2YXRB 4HB1A 2QE7H 2R32A 4QMAA 2Q6QA 3NTNA 3II6A 3VMXA 1QEXA 4XRQA 3FGAD 2XNDH 3L70J 4ASWA 1IMQA 1KILA 4GR2A 1D1DA 2JWAA 2L4BA 3H47A 4XFJA 1RE4A 1GL2C 1IFIA 1QLED 5AVUB 3G1IA 3L73D 2JAZA 2PFXA 3B8EB 4RESB 3Q3DA 2UWJE 2Q9IA 3B5ND 2YO3A 1Q86Q 1M1JA 1Z56A 2QJKB 5CJ4A 2M5AB 2HFED 5F2NA 2EFJA 2J59M 4D6TG 3AE4C 1BXIA 1FZCC 3MGEA 3OA7A 4H2YC 2OYIA 4I1LA 1NO4A 1NTMJ 4U3FG 1SQBD 3I56P 1LWUC 1HQBA 1LJ2A 2OTJP 5AVWB 3DS1A 3TNUB 5B5EE 2I1KA 2KS1B 2IBZD 3P8CD 4H13C 4OVNF 1L0NG 2QNWA 2N98A 3A5TA 3MD0A 4WY4C 5APWA 2FYZA 1KB9D 3RK2D 2LF4A 1L0LD 2XT1A 1L0NE 4GR6A 3FWNA 3L37A 1NTKJ 3G26A 4HKGA 4PH0A 1IFPA 3H1IG 2JR8A 3L4FA 1GL2A 1SFCD 2A45H 3RL0g 1KV4A 1Q81Q 4PD4E 1HJ0A 1KORA 2W6JH 5HGOA 2P7JA 3B4QA 3CL3D 2KSEA 1SQXD 3H1IE 1ZR2A 3PP5A 1ACPA 1BDDA 2MKVA 1BCCG 1FZCA 1EIAA 1S5LX 3IFMA 1LWUA 1NH4A 2OGUA 1IO4A 3M9HA 2O3JA 2RH0A 2KP8A 1BE3D 1PPJD 3L75J 4PV1B 1BSNA 2X2BA 2KYVA 5CHXA 4WB4A 3H1HE 1JUNA 2I8DA 2CQ8A 4OH8B 3EJEA 2KIKA 5AVQB 2PNGA 1E5WA 4WY4A 4TLFA 3H32A 3KQGA 1KLPA 1KB9H 3KYQA 3L72G 2QEXP 5KAFH 1EC5A 1VF5C 3BATA 3GF3A 3HUSA 2WSFH 2QVAA 3A2AA 3L71D 5B66E 2N9BA 3LW5H 2QA4P 4U7JA 4GDOA 4A7PA 3H1KG 1J1DC 1CI6A 2A06D 2RKLA 2W8ZA 2IYPA 2Q3IA 3GHGC 5F2KA 1URQC 1RO2A 3VN0A 2DW3A 1GU5A 2FXOA 1SQPD 2WPTA 2IDBA 2XV6A 1WMKA 4XROA 2WMMA 2IPPA 2N1TD 4AYCA 3R2PA 2FYNB 3MGNA 1Y9BA 1AJYA 2GM4A 5HV8A 2PEJA 2ZXEB 1AFOA 3EFFK 3L36A 2GDYA 1X3OA 3JCUE 3NY7B 1VQMP 2O01N 2ROQA 1NAFA 2WPRA 2EIAA 3CCMP 1PEMA 2Q5UA 1WRGA 4YPCA 4JQ0D 1PEUA 3AEFC 1FZFA 2NO8A 2B87A 3GJNA 4LLHA 2KOPA 2KSJA 4EI2A 4JPZB 2LIUA 3SFDC 4RJTA 1DEBA 2PEQA 1EZVI 2M0BA 3EFGA 2FAEA 1G2CA 4H0LC 2KNCB 2Y0DA 1DNYA 3PTZA 1AVYA 2JYGA 1ZRTE 1NWQA 4NEOA 1FZBA 5M1BA 4U0BA 2FXPA 3GHGA 2WPSA 1URQA 2KGEA 2C9LY 2RN0A 4K3AA 1GZLA 1BGYJ 1KILB 3G3ZA 1SQVK 4N78D 1Q82Q 1VQ4P 3AEEC 4OWFA 2KOSA 4EDFA 1EXIA 4CA3A 1U57A 1N2DC 1NU1K 4JF7A 3CCSP 2MVVA 4H44C 1VL2A 3L70D 2WSEH 2KODA 1H88A 3L73E 2OYHC 1VQ5P 4ZKPA 3PHLA 3V2QA 3GG2A 1QL2A 3RG2A 1W2EA 3M0AA 1L2PA 3HE5B 1AA0A 3H1JG 1H8AA 2YMYA 3H1LG 1X79B 3ZDMA 1SQBE 2FFDC 2KOGA 2IFMA 2XU6A 2GZFA 3EJBA 2R5DA 2GZIA 1SQQG 3H1JE 5KLVD 2GYKA 1NTMD 1FZGA 2K94A 2VLOA 2E75C 1G1IA 2IBZE 2J58A 2KZIA 3BCCG 4OGQB 4B86A 4ZNCA 3W68A 1SQQE 2JO0A 4IL6H 1RF1C 1S4XA 1SQVJ 2V4HA 1RQVA 4H2WC 1HVVA 3USSA 1A02J 1L0LE 2D2CC 2GZEA 5CCHC 1FDMA 1W5CE 2AEFA 2K0DX 1NU1J 3A0HE 2OYHA 1R5LA 4C46A 5KAIE 1LTJB 1OFCX 3DTJA 1KN7A 1LTSC 2M5RA 1KC8Q 1NVOA 2YIUC 1J1EB 1K73Q 3AE2C 2N5IA 1L0IA 1VQLP 1RQUA 2FFDA 3LRYA 3CC2P 1BE3E 2CNRA 2M8LA 2Z4EA 1M90Q 4M3LA 3H32B 1OXZA 2WSFJ 1HTLC 4NPFX 3L75D 5BU5A 3E7KA 2ZYDA 3HUSB 3LW5J 2KOQA 3T97A 5JPAA 5AW7B 1KMIZ 3B5NC 5F2OA 4U3FD 3MUDC 2A45I 2PEOA 2B88A 5CCHA 1KQSO 1QVFO 4PV1C 2R44A 1M6NA 1FBMA 2XKMA 2JEEA 1UIIA 4DT0A 3DS0A 1J2JB 1ZMEC 3S4RA 1JJ2O 2E76B 2A06E 4DJGA 5BVZA 1DD4A 3TGUD 2QJYC 3V2NA 1A02F 2YO2A 5AW6B 1SQPE 4I6MC 1AVOA 4IZ6A 1DEEG 2R5BA 2Z45A 1NTZK 2NPSD 1LP1A 3RK2C 3H6PA 2Z46A 2FYUG 3B71A 3FXEA 1VQ9P 1KB9I 3ITKA 1SFCC 1H0TA 3L71J 1IFMA 1AUMA 4R4LA 1YQ4C 2ZAEB 3B5NA 2XZ1C 2FYUE 2ZT9B 4C7NA 2MF4A 4COPA 4H44D 1GW4A 1VHNA 1T8ZA 3BRVB 1S5LE 1IFDA 1A43A 2POHA 3HRNA 3F89A 1GDTA 5CZDB 3TDKA 2YMKA 3O6QA 2OTKE 2QM8A 3W67A 4XFZA 2XXMA 2WSEJ 2GUSA 1F80D 2BCCG 3CD6P 3AE5C 3H1KD 4BRYA 5KJ7C 3MZWB 2MR7A 1MKMA 1CW5A 3L70E 2SPZA 3V2PA 2BCCE 2LXCB 1NQ4A 4IPYA 5BU8B 3HD7B 1T3JA 2K9JB 3L35A 1VQPP 1CZQA 3HYBA 4I7ZB 5KP7B 4F37A 2L22A 2RMZA 3TSIA 1M1KQ 2XV5A 1MFTA 2N1TC 2Y9ZA 2E1MA 1NTME 1FAVA 2O1JA 2WPQA 2B9BA 1JY3O 4KHXA 4AUWA 3VTPC 1VQOP 2AF8A 3V5BA 1NTKG 3P8MC 4YTPC 2JJLA 4I2LC 1SQVD 1JY3N 2K37A 5H2FH 3WU2H 3G0VA 1ZOYC 1NTKE 2G8YA 1YJ9P 2QJPB 4PV1D 1NU1D 1EXJA 2BQ1E 3CCLP 4JBZA 5KLVJ 3M91A 4DG9A 1PP9D 4EIJA 3LMOA 2GUVA 5L8RJ 2FVAA 1HY8A 2KI7B 2N1TA 4RKUJ 4QKOA 2JU1A 2AVAA 3A0BE 4PH1A 5KLIC 4PJ0H 5EFWB 2C0WA 3G29A 3AE3C 2M8RA 2ZJSE 3CE7A 3L75E 1FE6A 3BVHA 1GPJA 3RK3C 5APVA 3CCQP 3D6YA 1L0NK 1EZVG 2PAJA 5AVSB 1ZXGA 1Y8AA 2EG5A 4BXLA 3M0DC 1SS1A 1RY3A 2HG5D 4PXHB 5E79H 4U0EA 1EZVE 4HYTB 1VQ6P 3BCCD 2XNXA 1M56D 1T2KD 3PRJA 1NKNA 3CCVP 1Q7YQ 3L74D 2E43A 2AXTH 3H1HG 1IMPA 1X8YA 2KGCA 2FVEA 1PIXA 2LL8A 1LP1B 4GIFA 2QM7A 3RL0B 5AW2B 5CBNA 1H89A 4KT0J 1QRJA 1RHZB 2E74B 5AVVB 3CCEP 4RO0A 4D6TJ 4ZKUA 4IL6X 4U3FJ 3QWOC 1OZHA 1KQGB 1VKUA 2Q3EA 5GTHH 3IR9A 5GTIE 1R5SA 1S9KD 4C7NB 3KZIE 1N7SB 5DJTB 1DH3A 1KYOD 1ZNVA 1UIXA 5KKZB 3C8VA 3V6IA 5KJ7D 4GKGA 1DV5A 5C39A 3D70A 1L0NJ 4R4MA 2EHSA 2KR5A 3WUTA 2H43A 3TGUJ 3HZQA 3RBXA 1EDJA 3O6QB 1JTHA 1PV3A 2I1JA 1FC2C 2P1JA 3E1IA 2BEZF 3AE1C 3CXHH 2MVUA 1FU1A 4Y99B 1T8KA 3SWFA 2W27A 2P58A 1BGYG 5KP8B 1N73C 1JEKA 1RF0C 1L4AB 7CEIA 3IF4A 3WUUA 1M6EX 3HTKB 4YXDC 2W90A 1BCCJ 2WT7B 1BGYE 4EOTA 5CCGD 2WITA 2E42A 2HYNA 1NTZD 3CMEP 1KYOH 3FWLA 2B89A 2R3SA 3G6EP 2LPKA 1YBKA 2KXPB 2O01J 5AW0B 4OGQD 1P84D 3TF5A 1CEIA 2WSCH 3L72J 1IFJA 3OAKA 4XFYA 2NPSC 3HD7C 1N73A 2Y9YA 3H1KJ 2E5YA 1RF0A 3CMAP 3GW6A 3L73G 3PLNA 4JYCA 3CWBD 1LT9C 2HLOA 3M9QA 4M0IA 5APSA 1M1JB 1GU4A 4UB6H 3ABVC 2YKOA 1SQVE 5AVRB 3RK3D 1SQBG 4BPGA 2OYIB 2KLVA 1KD1Q 2L91A 1IK9A 1PGOA 2PP6A 2PGDA 3I5CA 1ZW0A 1M8OB 1HJBA 5APYA 1CSBA 2IBZG 1PGQA 2HR3A 3E2DA 3AE8C 4Z1MH 1P84H 3CX5H 2K3RA 3P8CE 1L0LG 4PWVB 1LGHB 2QJKC 3H25A 3AEGC 4UB8H 3V2RA 1SQQK 2AXCA 1MZ8A 3EJDA 1GL2B 1KB9E 5KAFE 3VP9A 2E76D 2K5XA 1SQXG 2QIWA 1AV1A 5I4TG 2FXMA 1DIPA 3U1CA 1FZCB 2XZRA 3C9IA 1LWUB 1PP9J 2ZVNB 1BE3G 5TISH 1SQXE 1PPJG 1JCCA 3G71P 2FQ2A 3VOPA 2KW2A 1SLQA 1GK4A 3DPHA 3CXCO 1K8AQ 4H13B 2WZ7A 4NPDA 3D71A 2Z5IA 1PPJE 2GDXA 1AYIA 2LXBA 2VRSA 4WY4B 2KGDA 1W2BO 1PEOA 3IAOA 1GTWA 2ZT9D 1GW3A 3H1LJ 1G1JA 2PY8A 3HE4A 2Y0EA 3EQ2A 2QG4A 1S1CX 3SSUA 3L71G 4D6TD 1FOSE 3PH0A 1RF1A 3PJSK 1FDOA 1M7LA 3RBZA 2A06G 4MRTC 1CI6B 3BCCJ 4LC1A 4O9BA 2N9YB 3TNUA 3G4SP 3L71E 3JC22 3L74J 2ZYAA 1IZNB 3R4YA 2KS1A 1JO5A 1SQPG 2VLNA 3C1LA 2V7QH 1L0ND 3KHUA 1HUCA 5TJHA 4ZMDA 1MZ9A 1BDCA 3M9BA 1AQTA 2AFEA 2WWWA 2M3BA 3AEBC 2IFNA 1HGZA 3H1ID 2ERHA 3CCJP 2ONTA 1EDLA 2L9FA 2OTLP 3HD7D 2K88A 4IOIH 1X9VA 2B87B 1VF5B 1JY2P 2H8PD 1K05A 3IN6A 1NJIQ 1BCCD 1M57D 5B5EH 3JSVC 3MUDA 1EMVA 2WSCJ 2MD9A 2YKPA 1G2CB 1J1DB 2Q7CA 2CGQA 1T2KC 4Y28J 1R8EA 3KPEA 3VRLC 2JGPA 3AE7C 2FYNC
chains in the Genus database with same CATH topology
1YJNP 1K30A 2PEOA 1YI2P 2PEMA 4XROA 2LF4A 3CD6P 2XT1A 1KQSO 4M0IA 1QVFO 4GR6A 5BS2A 2JYLA 3CC4P 3HZQA 1M6NA 1W2BO 3G26A 4PH0A 1PEQA 3CCUP 1PEOA 1QVGO 1YIJP 3DS0A 2PY8A 3G1GA 2BHVA 1IUQA 3CPWO 4PH1A 3H4EA 1Q81Q 1JJ2O 2PEJA 3B5IA 3DS5A 1VQNP 3G29A 3NTEA 3CC7P 5DCKA 5HGOA 1KD1Q 1K9MQ 1VQMP 1VQ8P 4IPYA 1VQKP 1YITP 3DS4A 2PEKA 2EIAA 3G28A 3I55P 3CCMP 1PEMA 1E6JP 1PEUA 3CCQP 1EOQA 1EIAA 2JO0A 3WBHA 2P9XA 1VQPP 2BUOA 3HYBA 4XRQA 3G4SP 3E2DA 1M6EX 2EG5A 2PEQA 2Z45A 1M1KQ 3OW2O 1RNIA 4GR2A 3DS2A 1D1DA 2Z44A 3H47A 1YJWP 2Z46A 4U0EA 1N8RQ 1RO0A 2E1MA 2JYGA 1VQ6P 1VQ9P 2M8NA 4U0BA 3G1IA 5HGMA 4U0CA 2L6EA 3CMEP 3CCVP 3DTJA 4U0AA 1Q7YQ 4U0DA 2CWOA 1AUMA 1Q86Q 3G6EP 4WYMA 1KC8Q 4QNBA 5F2NA 3CCRP 1VQ7P 4COPA 2EFJA 4U0FA 2OARA 5BS1A 2QEXP 3CCJP 1K73Q 2ONTA 1Q82Q 1VQ4P 2DGYA 1VQOP 3MGEA 2PEIA 1S72P 1VQLP 1QRJA 3Q20A 3I56P 3LRYA 2OTLP 5I4TG 3CCEP 3RG6C 3CC2P 5HGNA 1A8OA 2QA4P 2M8LA 2OTJP 1ZMBA 1M90Q 1YHQP 4XFYA 2PENA 3CCSP 3P05A 3DS1A 1A43A 3G21A 4COCA 2KODA 3G0VA 1NJIQ 1VQ5P 3H0DA 4XFXA 5HGLA 1YJ9P 5F2KA 3G71P 1RO2A 3DS3A 2BQ1E 2M8PA 3DPHA 3CCLP 5JPAA 3M1MA 3VRLC 3CMAP 1BAJA 4XFZA 2XV6A 2XXMA 3CXCO 1M74A 1K8AQ 5F2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJN P;  1YI2 P;  1M90 Q;  1YHQ P;  3CD6 P;  3CCQ P;  1KQS O;  3CCS P;  1QVF O;  3CME P;  3CCV P;  1Q7Y Q;  3CC4 P;  1VQP P;  1W2B O;  1Q86 Q;  3G4S P;  3CCU P;  1QVG O;  1NJI Q;  1YIJ P;  3G6E P;  1KC8 Q;  1VQ5 P;  3CCR P;  3CPW O;  1VQ7 P;  1YJ9 P;  1K73 Q;  3CCJ P;  2QEX P;  1Q81 Q;  3G71 P;  1M1K Q;  1Q82 Q;  1JJ2 O;  3OW2 O;  1VQO P;  1VQ4 P;  1VQN P;  1S72 P;  1VQL P;  3CC7 P;  1YJW P;  1KD1 Q;  3CCL P;  3CMA P;  1K9M Q;  3I56 P;  1N8R Q;  1VQM P;  1VQ8 P;  2OTL P;  1VQK P;  3CXC O;  1YIT P;  1K8A Q;  3CC2 P;  3CCE P;  3I55 P;  3CCM P;  1VQ6 P;  1VQ9 P;  2QA4 P;  2OTJ P; 
#chains in the Genus database with same CATH topology
 1YJN P;  3GHG B;  1URQ B;  3D6Z A;  3CXH I;  2QSI A;  1PEQ A;  1JY2 O;  3B5I A;  2FAD A;  4KJM A;  4PD4 H;  3L72 D;  1VPC A;  2R3C A;  2YXQ B;  4N78 E;  3L70 G;  2J5U A;  4IL6 E;  1E6J P;  4XE5 B;  2AEJ A;  3G9R A;  1JY2 N;  2KG9 A;  1GD2 E;  1NTZ J;  1DD3 A;  2WQY C;  1IJD B;  1SFC A;  1KYO I;  1N8R Q;  1NYH A;  3M06 A;  1RO0 A;  3RK3 E;  3CI9 A;  1KIL C;  1X22 A;  3AE9 C;  2Z5H A;  4U0C A;  2L6E A;  1OW8 A;  1PFI A;  3MIW A;  4H0L B;  3F5H A;  2JB0 A;  4AQR D;  3P7K A;  2N6Z A;  1DX7 A;  1RE4 C;  5KLV G;  1NTM G;  4L76 A;  4WYM A;  4DCK A;  3CCR P;  1VQ7 P;  2OAR A;  5BS1 A;  1S72 P;  1FJP A;  2LTE A;  2FBW C;  4IFF A;  1A8O A;  5KLV E;  1Q2N A;  2JBG A;  1YHQ P;  2FQ0 A;  2O01 H;  5B66 H;  3BRT B;  5CCG C;  3CWB J;  3GKL C;  4L74 A;  4XFX A;  1ZRT D;  1AF8 A;  2W6B A;  1LTT C;  1RE3 C;  1OIP A;  2FHS C;  2KNC A;  2OYH B;  1Q90 D;  2W6A A;  2K1A A;  5KJ7 A;  3Q5R A;  2LKM A;  3B4S A;  2JKV A;  3OJA B;  1WT6 A;  4WBA A;  1QVG O;  1FZA A;  3U1A A;  2LIW A;  4OGQ C;  5DJU B;  2BCC J;  1NTK K;  3CPW O;  3AED C;  2WVR A;  3RL0 D;  1USD A;  3DS5 A;  2FFD B;  3NTE A;  4W7Z A;  5CBO A;  5DCK A;  2E74 D;  3JCU H;  2PEK A;  3G28 A;  1P84 I;  2IX7 C;  3CX5 I;  4R0M A;  2HPC A;  2OYO A;  1SP4 A;  2E75 B;  5CMZ A;  2BUO A;  2VLQ A;  3L75 G;  1N7S D;  3HE4 B;  1ZR4 A;  4K35 A;  2IZ0 A;  1RNI A;  3T97 B;  1RF1 B;  1LTJ C;  5CCG A;  1FS0 E;  3HE5 A;  2D2C B;  2DNW A;  3EWK A;  4LGD E;  1J1E C;  2K9Y A;  4D6T E;  3H1J D;  3WUV A;  1HGV A;  1RE3 A;  2NRG A;  3H1L D;  2V7Q J;  4U3F E;  2W83 C;  2LR2 A;  3MP7 B;  3V4W A;  2KWL A;  3TGU G;  1NOH A;  1SQQ D;  2YIU B;  2CPB A;  3CXH D;  1JMB A;  3HUS C;  1L4A D;  2KOR A;  4WVZ A;  1PL5 A;  3TGU E;  5HGL A;  2FQ1 A;  1LTG C;  3Q5P A;  3DS3 A;  2JDI H;  3WMM 0;  1M74 A;  3FXD A;  4HJG H;  5K5G B;  1YI2 P;  1H0T B;  3S1K A;  2E76 C;  1S2E A;  5BS2 A;  1LTJ A;  3B5N B;  1YIJ P;  3P32 A;  4DOJ A;  1KTM A;  5APU A;  4IFM A;  1OX3 A;  1BCC E;  1K9M Q;  5HVC A;  2WPV B;  1VDF A;  1U7M A;  3LID A;  3I55 P;  2IZ1 A;  3NXS A;  2KZJ A;  3M0D A;  2OQQ A;  2QJY B;  4GT1 A;  1N7L A;  1KIL D;  3Q1M A;  2FKW B;  3VYI A;  3H1I J;  4EYY Q;  2JU2 A;  4GOF A;  2M8N A;  3A0H H;  1OW6 A;  2GDW A;  2ZT9 C;  3RK2 B;  3AEC C;  3L72 E;  4U0A A;  3AEA C;  4BRY B;  2XDJ A;  5KAI H;  2MR8 A;  1GK6 A;  1IFN A;  4QNB A;  2JWD A;  1SFC B;  2KLU A;  1OR5 A;  1ZV8 A;  1LNQ A;  2DGY A;  1KQL A;  2PEI A;  3H1H J;  3H1K E;  1EDK A;  3BAS A;  2M3E A;  1XTC C;  1ZMB A;  2P67 A;  5H2F E;  3WU2 E;  4MN4 C;  3A3Y B;  3S9O A;  3GF7 A;  1U7J A;  3GLM A;  2KB7 P;  1FZE A;  1NKZ B;  3V4Q A;  4YXW H;  3LIE A;  2YNY A;  1YQ3 C;  1ZLL A;  3CX5 D;  1K30 A;  2FYU D;  2KGA A;  2G3A A;  4PD4 I;  5AVY B;  2HOD A;  4HKZ H;  2JQ4 A;  1GL2 D;  2C9N Y;  4PJ0 E;  2BHV A;  1IUQ A;  2K2Q A;  5APQ A;  1NGM B;  3H4E A;  1JM0 A;  4JYB A;  5AW4 B;  2A45 G;  4CPG A;  4I7Z C;  1YIT P;  1SQV G;  1YYC A;  1KQF B;  2AEM A;  2ZXX A;  2XZ0 D;  2KOO A;  2JP3 A;  1OW7 A;  1QL1 A;  2L5G B;  1TU3 F;  1ZN5 A;  2CG5 B;  1NU1 G;  3AE6 C;  1SVF A;  1XTG B;  2ZYG A;  1KZU B;  4W7Y A;  5E79 E;  5AW8 B;  1HBW A;  5AW1 B;  3DS2 A;  1JB0 J;  2CK3 H;  2LKI A;  1PP9 G;  3VMY A;  3RGU A;  2HPC B;  4H13 D;  2QRX A;  3U43 A;  1NU1 E;  4N3Y B;  5HGM A;  2Y0C A;  2H7H A;  2AXT E;  4WY4 D;  3K5B A;  1FR2 A;  2N1T B;  1SQB K;  2BCC D;  1KFN A;  1PP9 E;  3A7O A;  1YTZ T;  3QH9 A;  1IK7 A;  4IFD K;  2NPS A;  3Q20 A;  2K93 A;  1RH5 B;  1MFZ A;  3N4X A;  1GXG A;  3O8Z A;  2VSQ A;  3HD7 A;  5GTH E;  2QJP C;  2K9J A;  3P05 A;  3G21 A;  2ITA A;  1S5L H;  2VLP A;  3H0D A;  1L0L K;  3H1L E;  3CLQ A;  1GMJ A;  1LT9 A;  5EW5 E;  2M8P A;  2BAS A;  4GOE A;  1BAJ A;  2YKQ A;  3Q5S A;  4XA4 A;  2N5H A;  3L74 G;  4NPE A;  1JCD A;  3VMA A;  1UJZ A;  2JYL A;  2H89 C;  4BWN A;  3L73 J;  2E5T A;  1SQX K;  3BCC E;  3KDP B;  3CXH E;  3NMD A;  1JMM A;  3MHV A;  2WTY A;  1LTI C;  3L74 E;  2BEQ D;  4ASV A;  4C7R A;  2GA1 A;  2KK7 A;  2K0Y A;  1SQB J;  2FAC A;  1OVR A;  2H88 C;  5KLI B;  3Q2Y A;  1VF5 D;  4W80 A;  1NTK D;  5AVX B;  1EQ7 A;  2JO1 A;  2LML A;  1IC2 A;  2MJZ A;  3WBH A;  4TT3 H;  3KXD A;  3H1J J;  2C0X A;  1FDI A;  2M5A A;  3RK3 B;  1E0H A;  2KUB A;  4L73 A;  1S9K E;  1S3J A;  1OMI A;  5APT A;  1SQQ J;  1URQ D;  2Q1K A;  1KYO E;  1QX8 A;  3RL0 C;  3MTU E;  2CWO A;  1UNK A;  1OWA A;  1L0L J;  1JTH B;  1LTB C;  1X0T A;  2E74 C;  2NZ2 A;  4U0F A;  1T3U A;  4BPH A;  1KIL E;  2P2U A;  3RG6 C;  1ZP0 C;  1N7S C;  1NAY A;  2AFD A;  2O1K A;  2KG6 A;  1SQX J;  2PEN A;  4PD4 D;  5KKZ C;  1SQP K;  4COC A;  1D7M A;  1USE A;  1EZV D;  3FX0 A;  2KG8 A;  3GMA A;  1BE3 J;  3M1M A;  1NTZ G;  5CJ0 A;  3E1R A;  4GOD A;  3UIA A;  2PEM A;  4UB6 E;  4H0L D;  4Y99 C;  3CC4 P;  4H2X C;  5APX A;  3G1G A;  2IBZ I;  2MY5 A;  1NTZ E;  2LOL A;  3H1H D;  2FYU K;  2GZJ A;  1PGP A;  1Z6M A;  2GZG A;  1VQN P;  3A0B H;  3CC7 P;  1L4A C;  3U59 A;  1KFM A;  1VQ8 P;  1VQK P;  3DS4 A;  1NHL A;  2N6Y A;  1E79 H;  1EOQ A;  2HOD B;  4WWI A;  2P9X A;  3GZM A;  1P84 E;  2PRR A;  3CX5 E;  1LTA C;  1MV8 A;  4HH2 A;  1N73 B;  2CPS A;  3NFQ A;  1FJK A;  1N7S A;  3OW2 O;  1JOC A;  3SFE C;  1EDI A;  2Z44 A;  1GXH A;  1YJW P;  2FY8 A;  3TK1 A;  3SWY A;  2EHT A;  3CWB G;  2K92 A;  1SQP J;  4UB8 E;  2ZFC A;  2WSS H;  3VMZ A;  1PGJ A;  2N50 A;  5EJD A;  5AW5 B;  4U0D A;  4N6J A;  1OVV A;  1BSH A;  5AW9 B;  3CWB E;  3GZL A;  1T6A A;  2FVF A;  4L75 A;  5HGN A;  1N86 A;  4UHP B;  2L0Q A;  5TIS E;  2E75 D;  1HWT C;  1BGY D;  3SWK A;  2FYU J;  1L4A A;  4DZO A;  1L0H A;  4BPF A;  3HTK A;  5GTI H;  3KZI H;  1Y47 A;  2NPS B;  2WT7 A;  1QGK B;  1K04 A;  5AVZ B;  1M1J C;  1HH0 A;  2D2C D;  3TYY A;  5CCH D;  5KLV K;  1NTM K;  1JY3 P;  1YTZ I;  5AVT B;  1FOS F;  5KTB A;  1JNM A;  3N7N A;  2OYI C;  2P10 A;  5AW3 B;  2K0X A;  1AQ5 A;  3CCU P;  2IYO A;  5KP6 B;  1HF9 A;  1OVU A;  1LT9 B;  1MUU A;  1PZQ A;  2ZVO B;  3VP8 A;  1LT1 A;  4H44 B;  2YXR B;  4HB1 A;  2QE7 H;  2R32 A;  4QMA A;  2Q6Q A;  3NTN A;  3II6 A;  3VMX A;  1QEX A;  4XRQ A;  3FGA D;  2XND H;  3L70 J;  4ASW A;  1IMQ A;  1KIL A;  4GR2 A;  1D1D A;  2JWA A;  2L4B A;  3H47 A;  4XFJ A;  1RE4 A;  1GL2 C;  1IFI A;  1QLE D;  5AVU B;  3G1I A;  3L73 D;  2JAZ A;  2PFX A;  3B8E B;  4RES B;  3Q3D A;  2UWJ E;  2Q9I A;  3B5N D;  2YO3 A;  1Q86 Q;  1M1J A;  1Z56 A;  2QJK B;  5CJ4 A;  2M5A B;  2HFE D;  5F2N A;  2EFJ A;  2J59 M;  4D6T G;  3AE4 C;  1BXI A;  1FZC C;  3MGE A;  3OA7 A;  4H2Y C;  2OYI A;  4I1L A;  1NO4 A;  1NTM J;  4U3F G;  1SQB D;  3I56 P;  1LWU C;  1HQB A;  1LJ2 A;  2OTJ P;  5AVW B;  3DS1 A;  3TNU B;  5B5E E;  2I1K A;  2KS1 B;  2IBZ D;  3P8C D;  4H13 C;  4OVN F;  1L0N G;  2QNW A;  2N98 A;  3A5T A;  3MD0 A;  4WY4 C;  5APW A;  2FYZ A;  1KB9 D;  3RK2 D;  2LF4 A;  1L0L D;  2XT1 A;  1L0N E;  4GR6 A;  3FWN A;  3L37 A;  1NTK J;  3G26 A;  4HKG A;  4PH0 A;  1IFP A;  3H1I G;  2JR8 A;  3L4F A;  1GL2 A;  1SFC D;  2A45 H;  3RL0 g;  1KV4 A;  1Q81 Q;  4PD4 E;  1HJ0 A;  1KOR A;  2W6J H;  5HGO A;  2P7J A;  3B4Q A;  3CL3 D;  2KSE A;  1SQX D;  3H1I E;  1ZR2 A;  3PP5 A;  1ACP A;  1BDD A;  2MKV A;  1BCC G;  1FZC A;  1EIA A;  1S5L X;  3IFM A;  1LWU A;  1NH4 A;  2OGU A;  1IO4 A;  3M9H A;  2O3J A;  2RH0 A;  2KP8 A;  1BE3 D;  1PPJ D;  3L75 J;  4PV1 B;  1BSN A;  2X2B A;  2KYV A;  5CHX A;  4WB4 A;  3H1H E;  1JUN A;  2I8D A;  2CQ8 A;  4OH8 B;  3EJE A;  2KIK A;  5AVQ B;  2PNG A;  1E5W A;  4WY4 A;  4TLF A;  3H32 A;  3KQG A;  1KLP A;  1KB9 H;  3KYQ A;  3L72 G;  2QEX P;  5KAF H;  1EC5 A;  1VF5 C;  3BAT A;  3GF3 A;  3HUS A;  2WSF H;  2QVA A;  3A2A A;  3L71 D;  5B66 E;  2N9B A;  3LW5 H;  2QA4 P;  4U7J A;  4GDO A;  4A7P A;  3H1K G;  1J1D C;  1CI6 A;  2A06 D;  2RKL A;  2W8Z A;  2IYP A;  2Q3I A;  3GHG C;  5F2K A;  1URQ C;  1RO2 A;  3VN0 A;  2DW3 A;  1GU5 A;  2FXO A;  1SQP D;  2WPT A;  2IDB A;  2XV6 A;  1WMK A;  4XRO A;  2WMM A;  2IPP A;  2N1T D;  4AYC A;  3R2P A;  2FYN B;  3MGN A;  1Y9B A;  1AJY A;  2GM4 A;  5HV8 A;  2PEJ A;  2ZXE B;  1AFO A;  3EFF K;  3L36 A;  2GDY A;  1X3O A;  3JCU E;  3NY7 B;  1VQM P;  2O01 N;  2ROQ A;  1NAF A;  2WPR A;  2EIA A;  3CCM P;  1PEM A;  2Q5U A;  1WRG A;  4YPC A;  4JQ0 D;  1PEU A;  3AEF C;  1FZF A;  2NO8 A;  2B87 A;  3GJN A;  4LLH A;  2KOP A;  2KSJ A;  4EI2 A;  4JPZ B;  2LIU A;  3SFD C;  4RJT A;  1DEB A;  2PEQ A;  1EZV I;  2M0B A;  3EFG A;  2FAE A;  1G2C A;  4H0L C;  2KNC B;  2Y0D A;  1DNY A;  3PTZ A;  1AVY A;  2JYG A;  1ZRT E;  1NWQ A;  4NEO A;  1FZB A;  5M1B A;  4U0B A;  2FXP A;  3GHG A;  2WPS A;  1URQ A;  2KGE A;  2C9L Y;  2RN0 A;  4K3A A;  1GZL A;  1BGY J;  1KIL B;  3G3Z A;  1SQV K;  4N78 D;  1Q82 Q;  1VQ4 P;  3AEE C;  4OWF A;  2KOS A;  4EDF A;  1EXI A;  4CA3 A;  1U57 A;  1N2D C;  1NU1 K;  4JF7 A;  3CCS P;  2MVV A;  4H44 C;  1VL2 A;  3L70 D;  2WSE H;  2KOD A;  1H88 A;  3L73 E;  2OYH C;  1VQ5 P;  4ZKP A;  3PHL A;  3V2Q A;  3GG2 A;  1QL2 A;  3RG2 A;  1W2E A;  3M0A A;  1L2P A;  3HE5 B;  1AA0 A;  3H1J G;  1H8A A;  2YMY A;  3H1L G;  1X79 B;  3ZDM A;  1SQB E;  2FFD C;  2KOG A;  2IFM A;  2XU6 A;  2GZF A;  3EJB A;  2R5D A;  2GZI A;  1SQQ G;  3H1J E;  5KLV D;  2GYK A;  1NTM D;  1FZG A;  2K94 A;  2VLO A;  2E75 C;  1G1I A;  2IBZ E;  2J58 A;  2KZI A;  3BCC G;  4OGQ B;  4B86 A;  4ZNC A;  3W68 A;  1SQQ E;  2JO0 A;  4IL6 H;  1RF1 C;  1S4X A;  1SQV J;  2V4H A;  1RQV A;  4H2W C;  1HVV A;  3USS A;  1A02 J;  1L0L E;  2D2C C;  2GZE A;  5CCH C;  1FDM A;  1W5C E;  2AEF A;  2K0D X;  1NU1 J;  3A0H E;  2OYH A;  1R5L A;  4C46 A;  5KAI E;  1LTJ B;  1OFC X;  3DTJ A;  1KN7 A;  1LTS C;  2M5R A;  1KC8 Q;  1NVO A;  2YIU C;  1J1E B;  1K73 Q;  3AE2 C;  2N5I A;  1L0I A;  1VQL P;  1RQU A;  2FFD A;  3LRY A;  3CC2 P;  1BE3 E;  2CNR A;  2M8L A;  2Z4E A;  1M90 Q;  4M3L A;  3H32 B;  1OXZ A;  2WSF J;  1HTL C;  4NPF X;  3L75 D;  5BU5 A;  3E7K A;  2ZYD A;  3HUS B;  3LW5 J;  2KOQ A;  3T97 A;  5JPA A;  5AW7 B;  1KMI Z;  3B5N C;  5F2O A;  4U3F D;  3MUD C;  2A45 I;  2PEO A;  2B88 A;  5CCH A;  1KQS O;  1QVF O;  4PV1 C;  2R44 A;  1M6N A;  1FBM A;  2XKM A;  2JEE A;  1UII A;  4DT0 A;  3DS0 A;  1J2J B;  1ZME C;  3S4R A;  1JJ2 O;  2E76 B;  2A06 E;  4DJG A;  5BVZ A;  1DD4 A;  3TGU D;  2QJY C;  3V2N A;  1A02 F;  2YO2 A;  5AW6 B;  1SQP E;  4I6M C;  1AVO A;  4IZ6 A;  1DEE G;  2R5B A;  2Z45 A;  1NTZ K;  2NPS D;  1LP1 A;  3RK2 C;  3H6P A;  2Z46 A;  2FYU G;  3B71 A;  3FXE A;  1VQ9 P;  1KB9 I;  3ITK A;  1SFC C;  1H0T A;  3L71 J;  1IFM A;  1AUM A;  4R4L A;  1YQ4 C;  2ZAE B;  3B5N A;  2XZ1 C;  2FYU E;  2ZT9 B;  4C7N A;  2MF4 A;  4COP A;  4H44 D;  1GW4 A;  1VHN A;  1T8Z A;  3BRV B;  1S5L E;  1IFD A;  1A43 A;  2POH A;  3HRN A;  3F89 A;  1GDT A;  5CZD B;  3TDK A;  2YMK A;  3O6Q A;  2OTK E;  2QM8 A;  3W67 A;  4XFZ A;  2XXM A;  2WSE J;  2GUS A;  1F80 D;  2BCC G;  3CD6 P;  3AE5 C;  3H1K D;  4BRY A;  5KJ7 C;  3MZW B;  2MR7 A;  1MKM A;  1CW5 A;  3L70 E;  2SPZ A;  3V2P A;  2BCC E;  2LXC B;  1NQ4 A;  4IPY A;  5BU8 B;  3HD7 B;  1T3J A;  2K9J B;  3L35 A;  1VQP P;  1CZQ A;  3HYB A;  4I7Z B;  5KP7 B;  4F37 A;  2L22 A;  2RMZ A;  3TSI A;  1M1K Q;  2XV5 A;  1MFT A;  2N1T C;  2Y9Z A;  2E1M A;  1NTM E;  1FAV A;  2O1J A;  2WPQ A;  2B9B A;  1JY3 O;  4KHX A;  4AUW A;  3VTP C;  1VQO P;  2AF8 A;  3V5B A;  1NTK G;  3P8M C;  4YTP C;  2JJL A;  4I2L C;  1SQV D;  1JY3 N;  2K37 A;  5H2F H;  3WU2 H;  3G0V A;  1ZOY C;  1NTK E;  2G8Y A;  1YJ9 P;  2QJP B;  4PV1 D;  1NU1 D;  1EXJ A;  2BQ1 E;  3CCL P;  4JBZ A;  5KLV J;  3M91 A;  4DG9 A;  1PP9 D;  4EIJ A;  3LMO A;  2GUV A;  5L8R J;  2FVA A;  1HY8 A;  2KI7 B;  2N1T A;  4RKU J;  4QKO A;  2JU1 A;  2AVA A;  3A0B E;  4PH1 A;  5KLI C;  4PJ0 H;  5EFW B;  2C0W A;  3G29 A;  3AE3 C;  2M8R A;  2ZJS E;  3CE7 A;  3L75 E;  1FE6 A;  3BVH A;  1GPJ A;  3RK3 C;  5APV A;  3CCQ P;  3D6Y A;  1L0N K;  1EZV G;  2PAJ A;  5AVS B;  1ZXG A;  1Y8A A;  2EG5 A;  4BXL A;  3M0D C;  1SS1 A;  1RY3 A;  2HG5 D;  4PXH B;  5E79 H;  4U0E A;  1EZV E;  4HYT B;  1VQ6 P;  3BCC D;  2XNX A;  1M56 D;  1T2K D;  3PRJ A;  1NKN A;  3CCV P;  1Q7Y Q;  3L74 D;  2E43 A;  2AXT H;  3H1H G;  1IMP A;  1X8Y A;  2KGC A;  2FVE A;  1PIX A;  2LL8 A;  1LP1 B;  4GIF A;  2QM7 A;  3RL0 B;  5AW2 B;  5CBN A;  1H89 A;  4KT0 J;  1QRJ A;  1RHZ B;  2E74 B;  5AVV B;  3CCE P;  4RO0 A;  4D6T J;  4ZKU A;  4IL6 X;  4U3F J;  3QWO C;  1OZH A;  1KQG B;  1VKU A;  2Q3E A;  5GTH H;  3IR9 A;  5GTI E;  1R5S A;  1S9K D;  4C7N B;  3KZI E;  1N7S B;  5DJT B;  1DH3 A;  1KYO D;  1ZNV A;  1UIX A;  5KKZ B;  3C8V A;  3V6I A;  5KJ7 D;  4GKG A;  1DV5 A;  5C39 A;  3D70 A;  1L0N J;  4R4M A;  2EHS A;  2KR5 A;  3WUT A;  2H43 A;  3TGU J;  3HZQ A;  3RBX A;  1EDJ A;  3O6Q B;  1JTH A;  1PV3 A;  2I1J A;  1FC2 C;  2P1J A;  3E1I A;  2BEZ F;  3AE1 C;  3CXH H;  2MVU A;  1FU1 A;  4Y99 B;  1T8K A;  3SWF A;  2W27 A;  2P58 A;  1BGY G;  5KP8 B;  1N73 C;  1JEK A;  1RF0 C;  1L4A B;  7CEI A;  3IF4 A;  3WUU A;  1M6E X;  3HTK B;  4YXD C;  2W90 A;  1BCC J;  2WT7 B;  1BGY E;  4EOT A;  5CCG D;  2WIT A;  2E42 A;  2HYN A;  1NTZ D;  3CME P;  1KYO H;  3FWL A;  2B89 A;  2R3S A;  3G6E P;  2LPK A;  1YBK A;  2KXP B;  2O01 J;  5AW0 B;  4OGQ D;  1P84 D;  3TF5 A;  1CEI A;  2WSC H;  3L72 J;  1IFJ A;  3OAK A;  4XFY A;  2NPS C;  3HD7 C;  1N73 A;  2Y9Y A;  3H1K J;  2E5Y A;  1RF0 A;  3CMA P;  3GW6 A;  3L73 G;  3PLN A;  4JYC A;  3CWB D;  1LT9 C;  2HLO A;  3M9Q A;  4M0I A;  5APS A;  1M1J B;  1GU4 A;  4UB6 H;  3ABV C;  2YKO A;  1SQV E;  5AVR B;  3RK3 D;  1SQB G;  4BPG A;  2OYI B;  2KLV A;  1KD1 Q;  2L91 A;  1IK9 A;  1PGO A;  2PP6 A;  2PGD A;  3I5C A;  1ZW0 A;  1M8O B;  1HJB A;  5APY A;  1CSB A;  2IBZ G;  1PGQ A;  2HR3 A;  3E2D A;  3AE8 C;  4Z1M H;  1P84 H;  3CX5 H;  2K3R A;  3P8C E;  1L0L G;  4PWV B;  1LGH B;  2QJK C;  3H25 A;  3AEG C;  4UB8 H;  3V2R A;  1SQQ K;  2AXC A;  1MZ8 A;  3EJD A;  1GL2 B;  1KB9 E;  5KAF E;  3VP9 A;  2E76 D;  2K5X A;  1SQX G;  2QIW A;  1AV1 A;  5I4T G;  2FXM A;  1DIP A;  3U1C A;  1FZC B;  2XZR A;  3C9I A;  1LWU B;  1PP9 J;  2ZVN B;  1BE3 G;  5TIS H;  1SQX E;  1PPJ G;  1JCC A;  3G71 P;  2FQ2 A;  3VOP A;  2KW2 A;  1SLQ A;  1GK4 A;  3DPH A;  3CXC O;  1K8A Q;  4H13 B;  2WZ7 A;  4NPD A;  3D71 A;  2Z5I A;  1PPJ E;  2GDX A;  1AYI A;  2LXB A;  2VRS A;  4WY4 B;  2KGD A;  1W2B O;  1PEO A;  3IAO A;  1GTW A;  2ZT9 D;  1GW3 A;  3H1L J;  1G1J A;  2PY8 A;  3HE4 A;  2Y0E A;  3EQ2 A;  2QG4 A;  1S1C X;  3SSU A;  3L71 G;  4D6T D;  1FOS E;  3PH0 A;  1RF1 A;  3PJS K;  1FDO A;  1M7L A;  3RBZ A;  2A06 G;  4MRT C;  1CI6 B;  3BCC J;  4LC1 A;  4O9B A;  2N9Y B;  3TNU A;  3G4S P;  3L71 E;  3JC2 2;  3L74 J;  2ZYA A;  1IZN B;  3R4Y A;  2KS1 A;  1JO5 A;  1SQP G;  2VLN A;  3C1L A;  2V7Q H;  1L0N D;  3KHU A;  1HUC A;  5TJH A;  4ZMD A;  1MZ9 A;  1BDC A;  3M9B A;  1AQT A;  2AFE A;  2WWW A;  2M3B A;  3AEB C;  2IFN A;  1HGZ A;  3H1I D;  2ERH A;  3CCJ P;  2ONT A;  1EDL A;  2L9F A;  2OTL P;  3HD7 D;  2K88 A;  4IOI H;  1X9V A;  2B87 B;  1VF5 B;  1JY2 P;  2H8P D;  1K05 A;  3IN6 A;  1NJI Q;  1BCC D;  1M57 D;  5B5E H;  3JSV C;  3MUD A;  1EMV A;  2WSC J;  2MD9 A;  2YKP A;  1G2C B;  1J1D B;  2Q7C A;  2CGQ A;  1T2K C;  4Y28 J;  1R8E A;  3KPE A;  3VRL C;  2JGP A;  3AE7 C;  2FYN C; 
#chains in the Genus database with same CATH homology
 1YJN P;  1K30 A;  2PEO A;  1YI2 P;  2PEM A;  4XRO A;  2LF4 A;  3CD6 P;  2XT1 A;  1KQS O;  4M0I A;  1QVF O;  4GR6 A;  5BS2 A;  2JYL A;  3CC4 P;  3HZQ A;  1M6N A;  1W2B O;  3G26 A;  4PH0 A;  1PEQ A;  3CCU P;  1PEO A;  1QVG O;  1YIJ P;  3DS0 A;  2PY8 A;  3G1G A;  2BHV A;  1IUQ A;  3CPW O;  4PH1 A;  3H4E A;  1Q81 Q;  1JJ2 O;  2PEJ A;  3B5I A;  3DS5 A;  1VQN P;  3G29 A;  3NTE A;  3CC7 P;  5DCK A;  5HGO A;  1KD1 Q;  1K9M Q;  1VQM P;  1VQ8 P;  4IPY A;  1VQK P;  1YIT P;  3DS4 A;  2PEK A;  2EIA A;  3G28 A;  3I55 P;  3CCM P;  1PEM A;  1E6J P;  1PEU A;  3CCQ P;  1EOQ A;  1EIA A;  2JO0 A;  3WBH A;  2P9X A;  1VQP P;  2BUO A;  3HYB A;  4XRQ A;  3G4S P;  3E2D A;  1M6E X;  2EG5 A;  2PEQ A;  2Z45 A;  1M1K Q;  3OW2 O;  1RNI A;  4GR2 A;  3DS2 A;  1D1D A;  2Z44 A;  3H47 A;  1YJW P;  2Z46 A;  4U0E A;  1N8R Q;  1RO0 A;  2E1M A;  2JYG A;  1VQ6 P;  1VQ9 P;  2M8N A;  4U0B A;  3G1I A;  5HGM A;  4U0C A;  2L6E A;  3CME P;  3CCV P;  3DTJ A;  4U0A A;  1Q7Y Q;  4U0D A;  2CWO A;  1AUM A;  1Q86 Q;  3G6E P;  4WYM A;  1KC8 Q;  4QNB A;  5F2N A;  3CCR P;  1VQ7 P;  4COP A;  2EFJ A;  4U0F A;  2OAR A;  5BS1 A;  2QEX P;  3CCJ P;  1K73 Q;  2ONT A;  1Q82 Q;  1VQ4 P;  2DGY A;  1VQO P;  3MGE A;  2PEI A;  1S72 P;  1VQL P;  1QRJ A;  3Q20 A;  3I56 P;  3LRY A;  2OTL P;  5I4T G;  3CCE P;  3RG6 C;  3CC2 P;  5HGN A;  1A8O A;  2QA4 P;  2M8L A;  2OTJ P;  1ZMB A;  1M90 Q;  1YHQ P;  4XFY A;  2PEN A;  3CCS P;  3P05 A;  3DS1 A;  1A43 A;  3G21 A;  4COC A;  2KOD A;  3G0V A;  1NJI Q;  1VQ5 P;  3H0D A;  4XFX A;  5HGL A;  1YJ9 P;  5F2K A;  3G71 P;  1RO2 A;  3DS3 A;  2BQ1 E;  2M8P A;  3DPH A;  3CCL P;  5JPA A;  3M1M A;  3VRL C;  3CMA P;  1BAJ A;  4XFZ A;  2XV6 A;  2XXM A;  3CXC O;  1M74 A;  1K8A Q;  5F2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...