3CCVP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ccvP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ccvP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ccvP02
1M90Q 3I56P 1K9MQ 3CCQP 1VQLP 3CPWO 1VQ6P 1K73Q 3CD6P 1KQSO 1Q81Q 3CXCO 1NJIQ 1YHQP 3G71P 3CCRP 3CCSP 1VQ7P 1Q86Q 1VQ9P 1JJ2O 3CC4P 3CCMP 1VQ4P 2OTJP 3I55P 3OW2O 1VQPP 1YIJP 1YITP 3CC2P 3CMEP 2QEXP 3G6EP 1VQNP 1W2BO 1YJ9P 3CCUP 1YI2P 1QVFO 1VQOP 1N8RQ 2OTLP 3CCEP 1QVGO 1VQ8P 2QA4P 1S72P 1M1KQ 1KC8Q 3CCJP 3CCVP 1VQMP 3CMAP 3CCLP 1K8AQ 1YJWP 1VQ5P 1Q7YQ 1YJNP 1VQKP 3CC7P 1Q82Q 3G4SP 1KD1Q
chains in the Genus database with same CATH superfamily
2BQ1E 4BRYA 2GM4A 1KILD 1IO4A 4ZNCA 5AVVB 1RQUA 2KOSA 1NTMD 3RK2B 4KT0J 1N7SD 3T97B 3VP8A 1URQB 5CJ4A 2QA4P 2K0DX 1E79H 3RK3E 1JB0J 2H7HA 3TGUJ 3DS4A 2N1TD 1RHZB 5CJ0A 2PFXA 2JO1A 2LPKA 1SQPG 2IFNA 3L37A 1LTIC 1ZRTD 2CQ8A 1HVVA 1FZAA 2KSJA 4BWNA 2VRSA 5AW5B 1QVFO 5I4TG 3CWBE 3BCCJ 1TU3F 1JY2O 2PEOA 4U0FA 1QL2A 1MFTA 2MJZA 2FHSC 2VLPA 3IFMA 1UIXA 5BS1A 3B5ND 2JWDA 5F2KA 1LTAC 4D6TE 3AE5C 3PRJA 4H0LC 4OGQB 3D6ZA 1KD1Q 1Z56A 2R44A 1AFOA 1S2EA 3M0AA 3AE8C 1IK7A 2P10A 3S9OA 3M1MA 1VKUA 1VQ4P 1SQVJ 3LIEA 4GODA 2P2UA 2PY8A 2XZRA 1KZUB 2MVUA 2WSEH 1H0TA 2FFDC 1CI6A 4WBAA 3L71J 1H0TB 2GZIA 1CI6B 3I56P 1K9MQ 3FXDA 5KJ7D 3Q2YA 1AUMA 1SQBE 4JPZB 1KILC 1OW6A 3RL0B 1NTMJ 1GXGA 4GOEA 3MUDC 1VL2A 1HBWA 2QVAA 3D70A 2FYUJ 3H1HJ 4PJ0E 1PEMA 2W27A 5TISE 4I7ZB 3HTKB 2N1TC 2D2CD 3IR9A 2YMYA 4COCA 2LKIA 2GUVA 2ITAA 2G3AA 2A06D 3M9HA 4EIJA 2VSQA 3EFGA 1K73Q 1LGHB 1J2JB 3SFEC 2R3SA 2PENA 3G71P 2E75C 7CEIA 4U0CA 3EJDA 2DGYA 1NU1E 3H1IE 1BCCG 1E5WA 3B5NC 2XDJA 3H1KJ 2OYOA 3CMAP 1HTLC 5DJUB 1GPJA 1FAVA 2E74C 1FJPA 1BE3E 1OW7A 2IBZG 1JOCA 4UB6E 1AJYA 1PPJG 3H1LD 1NTKD 1SQQK 2WPSA 2LKMA 2P1JA 1IFIA 3TF5A 1GZLA 3G28A 5GTHH 1EC5A 4JF7A 1LWUA 2WSEJ 3L74G 1L0IA 1A43A 1K04A 1QEXA 1VQKP 4IL6E 3L72G 2AFDA 1LTGC 4ZMDA 3CCRP 2MF4A 3CXHI 3CX5D 3AE9C 1CEIA 4WB4A 3HD7D 3HE4A 3MHVA 4HYTB 1LP1A 4H2WC 4LLHA 3G9RA 2Q6QA 1LP1B 3N7NA 3U59A 1QGKB 1CZQA 2OYHC 5H2FH 2O1JA 2KODA 3WMM0 1SS1A 2J5UA 3TNUA 1FE6A 3L70E 1FOSF 1VF5B 1FZCC 1IUQA 4YXDC 1JTHA 1SP4A 3L35A 2IBZD 1SQXD 2N5HA 1SQVK 2QNWA 2M3EA 1MV8A 3PHLA 2QM8A 4UHPB 5DCKA 5B5EH 3G29A 1IMPA 2ZT9B 2PEMA 1BXIA 4WY4A 1W2BO 3H1LJ 1KQLA 1BSHA 2ZVOB 1T3JA 2NO8A 2QRXA 4PD4I 2WPVB 4Y99B 2IDBA 2M5AA 1Z6MA 2AEJA 3B5IA 1BDCA 2ZXEB 2IFMA 2FVAA 4YTPC 2ZJSE 4RO0A 5AVQB 3D71A 3CXHE 2Q9IA 4U0AA 1YJ9P 1M7LA 2C0XA 4Y28J 2HR3A 1N8RQ 2P58A 1BGYD 4XFYA 2KGEA 2KXPB 1RE4A 3AE6C 3B4SA 2I1JA 2HFED 2E75B 3A7OA 1GDTA 2K88A 3LW5H 3M0DA 2WPRA 5GTIE 3G26A 2H88C 3M9BA 1S1CX 4YPCA 1RE3A 1FS0E 3HD7C 1FU1A 2OTLP 2YIUC 1SQQG 2E74B 1PP9E 1L0LE 1FDOA 3WUTA 4BPFA 1BCCJ 3H1JE 1OMIA 1NYHA 2V4HA 1A02J 3A0BE 3UIAA 2AFEA 1JUNA 1LT9C 1NTZK 3RK3B 3AEDC 1YITP 4H44C 2KOOA 1NHLA 1PGQA 1M1KQ 3VP9A 3MTUE 4XRQA 1OXZA 4L76A 3HUSB 1QLED 2BCCG 3EWKA 2QJKB 4MRTC 2OTKE 2NPSC 3TGUE 3E2DA 3A0HE 5KP7B 2ROQA 2PP6A 2E42A 1ACPA 4XROA 2W90A 4NPEA 3PP5A 3L74J 4H2XC 1GL2A 4H13D 5CHXA 3BCCE 1ZXGA 4W7YA 2O01J 1GL2B 1KB9H 3BATA 1YTZT 1SQPK 1Q86Q 2LR2A 1KYOD 1JJ2O 4PV1B 1LTJC 3CMEP 1L0NE 3FWLA 3L72J 4GOFA 1IFNA 2KZIA 5KLIC 2I8DA 3L75E 3L73D 3VMAA 2E76B 4HH2A 2OYHB 1UNKA 1T6AA 5F2OA 3WU2H 4DT0A 1HGZA 2IYPA 3P7KA 2JEEA 1GTWA 5KKZB 4PWVB 2XZ0D 2VLOA 1ZN5A 2QJPB 3AE3C 1FOSE 2FACA 1UIIA 1CSBA 1VQPP 3LW5J 1EQ7A 3TSIA 4PD4D 3F5HA 2KG6A 2PAJA 1R5LA 3E1IA 4IOIH 5KAFE 3WUVA 1NOHA 1KILE 2K9YA 2FKWB 1NQ4A 2ERHA 3U1AA 1MZ9A 1GXHA 3U1CA 1EZVG 1NTME 1P84H 3TDKA 1VQMP 1LTBC 1OVVA 5BU5A 2JR8A 2QM7A 1M90Q 3H32A 2FBWC 1DNYA 4U0BA 3QWOC 2Y9ZA 2XNDH 4IFMA 5B66H 1KN7A 1GW3A 4A7PA 5KLVK 1DH3A 1ZRTE 1JO5A 3MGNA 4ASVA 2ZXXA 3DS0A 3KHUA 1ZNVA 2M8PA 3C8VA 4H13C 3RBZA 1BSNA 5HGMA 1OWAA 4QMAA 1FJKA 1NTZG 2PEKA 2OGUA 1SQVD 3L73J 4DOJA 4R0MA 3L71D 2Z5IA 3SSUA 1LT9B 3GKLC 5CBNA 4H44B 1SQQJ 3RGUA 2KG8A 1Q2NA 3T97A 1URQA 1NU1K 5K5GB 5AW8B 2GZFA 1MFZA 2FYUD 3H1HD 1JY3O 3IAOA 3G4SP 1KMIZ 2NPSB 3KZIH 3AE7C 2O01N 2XU6A 3CCSP 2BCCJ 1AYIA 2LOLA 2N6YA 5AW6B 1PV3A 2IYOA 3W68A 1VQOP 1DX7A 1JY3P 1HWTC 3ABVC 2CPSA 4WY4D 3CWBG 4TLFA 4YXWH 4DCKA 3FXEA 1M8OB 3L36A 1D7MA 1KQSO 1L0HA 2N6ZA 1LNQA 2AVAA 4C7RA 1PIXA 3G6EP 1N73C 3SWFA 2N9YB 3H1KD 4D6TG 1ZP0C 1FC2C 5APSA 1K8AQ 1HQBA 3MD0A 1PZQA 3DTJA 2BUOA 4RKUJ 1OVRA 1ZV8A 1NTZD 3QH9A 2A06E 4NEOA 1SFCD 2AXTE 1EOQA 5CCHA 4IPYA 1W2EA 3KYQA 1L4AA 3KXDA 4N6JA 1JMBA 1L4AB 3CX5I 1GD2E 2WSCH 1M74A 2QIWA 1VQ8P 2E5TA 2JYLA 1Y9BA 5E79E 2Z46A 1PGPA 1K30A 3H25A 2OQQA 4L75A 2NZ2A 1SQBG 1X22A 2RKLA 5KLVG 3CCUP 3Q1MA 1SVFA 1G2CB 5HGNA 1N7SC 4AYCA 1S72P 1SQPD 3HTKA 1VQ5P 3H1LE 1H89A 1NVOA 1RF1B 2KS1B 1NTKE 2IBZI 2K9JB 3GLMA 3B71A 2L5GB 3OW2O 2GUSA 2L0QA 1RF0C 4CA3A 3CCLP 2Y0DA 4WY4C 4U3FG 4IL6X 2QJYB 2FYZA 3CI9A 2XKMA 5HGLA 2Q1KA 2WWWA 1ZOYC 2KOPA 1A8OA 2ONTA 1IZNB 1NU1G 4B86A 1IMQA 3V2RA 3CX5E 5APXA 3RL0g 2LIUA 1EIAA 4LC1A 3D6YA 2MVVA 3NTEA 1MZ8A 1J1EC 4NPFX 1YJNP 1NTZJ 2KI7B 3C9IA 4N3YB 2YNYA 1WMKA 1RE4C 3CXCO 3VN0A 1SFCC 1YHQP 1RQVA 1E0HA 5AW1B 1BE3G 3HRNA 1FZEA 2Y0EA 3II6A 1GMJA 4PH1A 2JGPA 1YYCA 1RO0A 2KUBA 5AVUB 2R32A 1FZFA 4PJ0H 2N5IA 3GHGC 5TISH 3BASA 1S5LE 1ZW0A 1L0LK 1NGMB 5KLVD 3V2QA 1FBMA 2BASA 2IBZE 5KJ7C 1SQXE 2B88A 1G1IA 1JY3N 4AUWA 3DS5A 2KIKA 1SQPJ 1KLPA 2W6AA 3ITKA 1T2KD 1Q82Q 4WWIA 5APYA 5KP6B 5AVRB 3LMOA 2D2CC 2K93A 4U3FD 2L4BA 3I55P 3AEBC 1OR5A 4H0LB 2M0BA 1M1JC 2J59M 3O6QB 2KLUA 2YO2A 3V2PA 4CPGA 4R4MA 2AEMA 2ZYAA 1NWQA 1BGYE 3CCQP 3HYBA 1BCCD 1X9VA 4D6TJ 2IPPA 4GR2A 3M91A 3H6PA 2WT7A 1LTTC 1KYOI 1N7LA 2YMKA 4UB6H 2WT7B 2FFDB 1L0NK 5BU8B 5KAIE 3DS3A 1RO2A 3N4XA 4DG9A 1Q7YQ 2WTYA 1KB9I 1KILB 3RG6C 3AEGC 1PPJD 4NPDA 2OYIC 2YKOA 1IFPA 1N7SB 2IZ1A 3E7KA 3M06A 2CG5B 1YIJP 1J1DC 2NRGA 5AW0B 3RK2D 2KGAA 1ZR2A 2IZ0A 1JMMA 1AQ5A 1URQD 3LIDA 2HG5D 3NY7B 2N1TB 3L74D 4IL6H 2N98A 5KLVJ 2R3CA 1X0TA 1PEUA 1OW8A 1YBKA 2K5XA 2XV5A 3BRTB 2N9BA 2C9LY 4C7NA 3WBHA 2FYNC 2XV6A 3L72D 3Q5PA 4C7NB 2HPCA 3B8EB 4U0EA 1T2KC 2HPCB 3S4RA 3F89A 2RH0A 2W8ZA 1VQ6P 3G1GA 3HZQA 2R5DA 3B5NA 2K0YA 5KTBA 3B5NB 4U3FJ 2KOQA 2YO3A 1DD3A 1RNIA 2WSFH 4ZKPA 1NH4A 1KYOE 2A45I 1MKMA 2MKVA 1VPCA 5CBOA 1SLQA 4OGQD 3L73E 1L0LG 1NU1J 5F2NA 1NKNA 3H1JG 5CCGA 2LIWA 2M8NA 2M5RA 2ZYGA 1S9KD 3VOPA 2MY5A 2GZGA 1X3OA 3HUSA 5CZDB 2PGDA 2RN0A 3JCUE 2Z44A 4R4LA 4PD4E 2V7QH 5APWA 3RL0D 3TGUG 1FZGA 1VDFA 4MN4C 3DS2A 2QSIA 3CXHH 4Z1MH 3RK2C 2CWOA 3KQGA 3FGAD 1URQC 3BVHA 2JJLA 2KSEA 1YJWP 2QE7H 1MUUA 4HJGH 2D2CB 1VQLP 4BXLA 1NJIQ 3BCCG 1IFDA 4XFJA 1EXIA 1N86A 1YQ4C 5GTIH 3MGEA 5EW5E 2W6BA 2CGQA 4WVZA 2JDIH 2H89C 1L0NG 1HF9A 4OWFA 2OYHA 3L75G 3KDPB 4UB8E 1PEQA 4U0DA 4EI2A 2GZJA 2GDXA 3GMAA 1KB9D 4M3LA 1KFNA 1ZR4A 2LXBA 4HKGA 3ZDMA 3O8ZA 3A0BH 2XXMA 1PFIA 1SQQD 1KV4A 5KP8B 3CCMP 1FZCB 1L0LD 1CW5A 4L74A 3V5BA 1PEOA 1SQVE 3TYYA 1VHNA 1M6NA 2WSFJ 4I6MC 4OGQC 3CPWO 4WYMA 3L71E 4W7ZA 2Q3IA 3EFFK 3A0HH 2WITA 2BCCD 2JBGA 2RMZA 1JCDA 1ZMEC 2MD9A 5L8RJ 1W5CE 2N50A 5AVTB 2FYUE 2E1MA 3H1HE 1DD4A 3AEEC 2DNWA 4PH0A 1XTCC 1P84D 1SQBK 5JPAA 2XT1A 2EFJA 3RL0C 2K94A 2GDWA 4BPHA 3OA7A 1QVGO 1PGJA 4RESB 3TK1A 3SFDC 4TT3H 2W83C 2KYVA 2CNRA 1NTKK 4I7ZC 2FQ1A 2CK3H 2AF8A 2K1AA 3HD7B 2OTJP 1EDLA 2YIUB 1UJZA 1IK9A 1JCCA 4HKZH 2MR8A 3G21A 2CPBA 2FXMA 2YXQB 3Q5RA 4K3AA 3H1KE 1ZMBA 1LT9A 5AW3B 3CD6P 5APUA 2WPQA 1IFMA 1NTZE 1Y47A 5KAFH 2OARA 2YXRB 2ZYDA 3IN6A 3H0DA 2B9BA 2X2BA 1L0LJ 2XZ1C 4K35A 3H1JJ 1EXJA 4N78D 1PGOA 1VF5D 2E5YA 1A02F 5CMZA 2NPSA 2PEQA 3NXSA 2EIAA 1FR2A 4BRYB 1EZVD 2KR5A 2ZT9D 3R2PA 3B4QA 1NAYA 2KG9A 1QX8A 2K37A 5C39A 2JU2A 1LTJA 1SQPE 4XFXA 3I5CA 2FXPA 1KORA 1LTJB 4QNBA 1SQXK 1NKZB 3WUUA 5KLIB 2L91A 2L6EA 3EQ2A 3CC2P 1LWUC 1L2PA 3P8CD 2GZEA 3EJEA 2UWJE 5BVZA 1LJ2A 2FVEA 2K2QA 4DZOA 3G3ZA 2WMMA 3A5TA 1L0NJ 2A06G 2E75D 1U57A 3L75J 3EJBA 2AXCA 4GIFA 3C1LA 4W80A 1M57D 1Q90D 2Y0CA 2P67A 1JY2P 1JNMA 2E74D 1QRJA 2KP8A 4HB1A 3FX0A 3Q3DA 1BDDA 1HY8A 4ASWA 1G2CA 1VQNP 4IFFA 3RK3D 5TJHA 2M8LA 2J58A 5CCGD 3FWNA 1AQTA 1RF1A 2KS1A 3VMXA 1VF5C 2K9JA 2JKVA 1S5LX 1AV1A 3H1LG 3LRYA 1NTKG 4BPGA 2Z45A 2QG4A 2W6JH 2JU1A 5KLVE 3CWBD 5HGOA 2QEXP 2ZT9C 4JQ0D 3E1RA 1YI2P 3A3YB 1HGVA 3CL3D 2O1KA 4H13B 3K5BA 5GTHE 2B87A 3HE5A 2AXTH 2B87B 3HE5B 4Y99C 1FDIA 2KZJA 4D6TD 1GL2D 2WVRA 3VMYA 1T8ZA 2YKQA 4PV1D 3H1IG 2KNCA 4U3FE 2KNCB 5E79H 1T8KA 2HYNA 2E76D 4XA4A 1ZLLA 2KGCA 1Q81Q 1G1JA 3AEFC 3GJNA 1EDIA 3P32A 3CLQA 1BCCE 1HJ0A 4PXHB 1RH5B 3M0DC 2HLOA 5AW9B 3A2AA 3PTZA 1IJDB 5BS2A 1LTSC 3CCVP 1GU5A 1SQBD 3CC7P 1RE3C 3V6IA 2FQ0A 5AVXB 5H2FE 2K3RA 2M8RA 2WSCJ 4LGDE 3SWYA 3H47A 2FXOA 2FVFA 1SQXG 4GKGA 2ZVNB 1PPJE 5APQA 3RK3C 3VMZA 5CCGC 1NO4A 3MZWB 2FQ2A 2Y9YA 3OAKA 3JSVC 5HVCA 1S4XA 2K0XA 1KQFB 3HUSC 5B5EE 2QJKC 1N73A 3L74E 4I1LA 1LWUB 2E43A 2K92A 1N73B 3P05A 3CWBJ 4JYBA 4XE5B 3O6QA 4GDOA 5AVSB 1EDKA 2JQ4A 3CX5H 1U7MA 1S3JA 2L9FA 1FZBA 1NAFA 3CE7A 4O9BA 3L72E 2JO0A 1JEKA 1OIPA 2Q3EA 2VLQA 1BGYG 3L4FA 1NU1D 3H1ID 1XTGB 4QKOA 1OZHA 3VYIA 4H2YC 1GL2C 2FFDA 1JY2N 2M3BA 4PV1C 4ZKUA 3HE4B 3SWKA 3L70G 1GK6A 1KILA 1X8YA 1BE3D 2E76C 1S5LH 2L22A 2BHVA 1OFCX 3MUDA 2PEIA 1HUCA 1EMVA 2C0WA 1N7SA 5M1BA 1HH0A 4H44D 5KKZC 1R5SA 3AE1C 3TNUB 2Q7CA 2QJPC 1AVOA 1KTMA 3AE4C 2SPZA 1M56D 2Z5HA 4JBZA 2N1TA 3H4EA 1SQBJ 1JTHB 4KJMA 1S9KE 5APTA 3V4WA 4IFDK 2O3JA 4U7JA 4C46A 2NPSD 1WT6A 3W67A 3M9QA 1RF0A 3CC4P 3G0VA 4COPA 2KORA 1OX3A 2O01H 3USSA 1NTKJ 1YTZI 2VLNA 4WY4B 3CCEP 1NTMK 2BEQD 3GG2A 3VRLC 3U43A 2AEFA 2P7JA 3G1IA 2GDYA 5DJTB 3S1KA 2WZ7A 2KK7A 4XFZA 1N2DC 2FYUK 4I2LC 2EHSA 2M5AB 1USEA 2JAZA 5AW2B 3AE2C 5APVA 1P84I 4EDFA 1J1EB 4IZ6A 1GW4A 2YKPA 5KAIH 1DV5A 3V4QA 1SFCA 4RJTA 4M0IA 1SFCB 1PP9G 1M6EX 1H88A 3L73G 3GF7A 3DPHA 3H1IJ 1KB9E 1JM0A 3L70D 3AEAC 2LXCB 4OH8B 5AW7B 1OVUA 1D1DA 5CCHD 3GHGA 2WSSH 1L4AD 1SQQE 3GHGB 2JWAA 1KC8Q 5KJ7A 1H8AA 1BE3J 3WU2E 3R4YA 1WRGA 3PJSK 1VQ7P 1LT1A 4DJGA 2Z4EA 1PL5A 3PLNA 3NMDA 2XNXA 2BCCE 1SQXJ 1AF8A 3DS1A 1T3UA 2LL8A 1E6JP 1USDA 3Q20A 3CXHD 1M1JA 1EZVI 3PH0A 2LF4A 1M1JB 2WQYC 1P84E 4OVNF 1KYOH 1RY3A 2PNGA 3IF4A 3BRVB 2A45G 2H43A 2P9XA 1KFMA 2PRRA 4KHXA 2POHA 4L73A 5B66E 1FZCA 2KW2A 3RBXA 2KOGA 1PP9D 1BGYJ 3KPEA 4JYCA 3H1JD 3CCJP 1AVYA 5AVZB 2EHTA 3JCUH 3MP7B 2OYIA 1SQVG 1IFJA 3Q5SA 2OYIB 4EOTA 2PEJA 4PD4H 3L70J 3GZLA 2FY8A 4EYYQ 1J1DB 5HV8A 1F80D 3L71G 1DIPA 3MIWA 3RG2A 2WPTA 3GW6A 5CCHC 5AVWB 1QL1A 2C9NY 1L4AC 1BAJA 1YQ3C 2KB7P 3NTNA 1NTMG 2DW3A 4N78E 1U7JA 2BEZF 5AVYB 3TGUD 2GA1A 3P8MC 2FYUG 2JB0A 3OJAB 3H1HG 1AA0A 1GU4A 1VQ9P 5EFWB 2FYNB 1EZVE 2HODA 2GYKA 1IC2A 1K05A 2JP3A 2HODB 1EDJA 3BCCD 2G8YA 2KLVA 4UB8H 2FAEA 2V7QJ 2MR7A 2A45H 1FDMA 5AW4B 2EG5A 3KZIE 2R5BA 1DEBA 2LMLA 1RF1C 1R8EA 1HJBA 1L0ND 3H32B 3AECC 3HD7A 2KGDA 3L75D 2ZAEB 2ZFCA 3GZMA 4F37A 3V2NA 2H8PD 2B89A 4GR6A 4H0LD 3VTPC 4AQRD 3P8CE 5EJDA 2QJYC 3H1KG 2FADA 1Y8AA 2JYGA 4GT1A 1KQGB 2KWLA 1PP9J 3JC22 1GK4A 1DEEG 2IX7C 3NFQA 3GF3A 1X79B 2Q5UA 2I1KA 2LTEA
chains in the Genus database with same CATH topology
2Z44A 3G28A 3I56P 1K9MQ 2E1MA 1M6EX 2M8PA 2BQ1E 3DPHA 1AUMA 3RG6C 4XFXA 3CXCO 1EOQA 2PEJA 3B5IA 4PH0A 5HGMA 4IPYA 1YHQP 4QNBA 1Q86Q 1JJ2O 2L6EA 5JPAA 2XT1A 2EFJA 2PEKA 1YIJP 3CC2P 3CMEP 1D1DA 3DS2A 4U0AA 1YJ9P 1M74A 1A43A 4PH1A 1RO0A 1N8RQ 2CWOA 1BAJA 1QVGO 1VQ8P 2QA4P 4XFYA 1KC8Q 2JYLA 1PEMA 2Z46A 1YJWP 1VQKP 5F2OA 3DS4A 1K30A 1VQLP 2BHVA 1Q81Q 2PEIA 1PEUA 1NJIQ 3G26A 3CCRP 1VQ7P 1VQ9P 3MGEA 2OTJP 1VQPP 3DS5A 4COCA 3WBHA 3CCUP 1QVFO 2XV6A 2OTLP 5HGNA 5BS2A 5I4TG 1S72P 3CCVP 1PEQA 3G21A 3H4EA 4U0DA 3DS1A 1VQ5P 3CC7P 4U0EA 1Q82Q 3G4SP 1QRJA 2EG5A 1E6JP 2PEOA 1ZMBA 4U0FA 1VQ6P 1K73Q 3CD6P 3G1GA 3HZQA 2KODA 3Q20A 2XXMA 5BS1A 2PENA 3H47A 3G71P 3CCSP 2OARA 4U0CA 2BUOA 3CC4P 2LF4A 1RNIA 2DGYA 3CCMP 3I55P 3G0VA 4COPA 3OW2O 1YITP 3H0DA 5F2KA 1VQNP 1VQOP 2M8LA 3CCEP 4GR6A 1IUQA 1M1KQ 1PEOA 1VQMP 3CMAP 3CCLP 4XRQA 3VRLC 3G1IA 1KD1Q 1M6NA 2PEQA 2P9XA 1M90Q 2EIAA 5HGLA 5F2NA 3CCQP 3LRYA 3CPWO 4WYMA 3HYBA 1KQSO 4XFZA 5DCKA 3G29A 4GR2A 2JYGA 1A8OA 4U0BA 2Z45A 3E2DA 2ONTA 3P05A 3M1MA 2PEMA 1VQ4P 5HGOA 2M8NA 2QEXP 3G6EP 1W2BO 2PY8A 1YI2P 4XROA 3DS3A 3CCJP 1EIAA 1RO2A 3NTEA 1K8AQ 1Q7YQ 1YJNP 3DTJA 3DS0A 4M0IA 2JO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M90 Q;  3I56 P;  1K9M Q;  3CCQ P;  1VQL P;  3CPW O;  1VQ6 P;  1K73 Q;  3CD6 P;  1KQS O;  1Q81 Q;  3CXC O;  1NJI Q;  1YHQ P;  3G71 P;  3CCR P;  3CCS P;  1VQ7 P;  1Q86 Q;  1VQ9 P;  1JJ2 O;  3CC4 P;  3CCM P;  1VQ4 P;  2OTJ P;  3I55 P;  3OW2 O;  1VQP P;  1YIJ P;  1YIT P;  3CC2 P;  3CME P;  2QEX P;  3G6E P;  1VQN P;  1W2B O;  1YJ9 P;  3CCU P;  1YI2 P;  1QVF O;  1VQO P;  1N8R Q;  2OTL P;  3CCE P;  1QVG O;  1VQ8 P;  2QA4 P;  1S72 P;  1M1K Q;  1KC8 Q;  3CCJ P;  3CCV P;  1VQM P;  3CMA P;  3CCL P;  1K8A Q;  1YJW P;  1VQ5 P;  1Q7Y Q;  1YJN P;  1VQK P;  3CC7 P;  1Q82 Q;  3G4S P;  1KD1 Q; 
#chains in the Genus database with same CATH topology
 2BQ1 E;  4BRY A;  2GM4 A;  1KIL D;  1IO4 A;  4ZNC A;  5AVV B;  1RQU A;  2KOS A;  1NTM D;  3RK2 B;  4KT0 J;  1N7S D;  3T97 B;  3VP8 A;  1URQ B;  5CJ4 A;  2QA4 P;  2K0D X;  1E79 H;  3RK3 E;  1JB0 J;  2H7H A;  3TGU J;  3DS4 A;  2N1T D;  1RHZ B;  5CJ0 A;  2PFX A;  2JO1 A;  2LPK A;  1SQP G;  2IFN A;  3L37 A;  1LTI C;  1ZRT D;  2CQ8 A;  1HVV A;  1FZA A;  2KSJ A;  4BWN A;  2VRS A;  5AW5 B;  1QVF O;  5I4T G;  3CWB E;  3BCC J;  1TU3 F;  1JY2 O;  2PEO A;  4U0F A;  1QL2 A;  1MFT A;  2MJZ A;  2FHS C;  2VLP A;  3IFM A;  1UIX A;  5BS1 A;  3B5N D;  2JWD A;  5F2K A;  1LTA C;  4D6T E;  3AE5 C;  3PRJ A;  4H0L C;  4OGQ B;  3D6Z A;  1KD1 Q;  1Z56 A;  2R44 A;  1AFO A;  1S2E A;  3M0A A;  3AE8 C;  1IK7 A;  2P10 A;  3S9O A;  3M1M A;  1VKU A;  1VQ4 P;  1SQV J;  3LIE A;  4GOD A;  2P2U A;  2PY8 A;  2XZR A;  1KZU B;  2MVU A;  2WSE H;  1H0T A;  2FFD C;  1CI6 A;  4WBA A;  3L71 J;  1H0T B;  2GZI A;  1CI6 B;  3I56 P;  1K9M Q;  3FXD A;  5KJ7 D;  3Q2Y A;  1AUM A;  1SQB E;  4JPZ B;  1KIL C;  1OW6 A;  3RL0 B;  1NTM J;  1GXG A;  4GOE A;  3MUD C;  1VL2 A;  1HBW A;  2QVA A;  3D70 A;  2FYU J;  3H1H J;  4PJ0 E;  1PEM A;  2W27 A;  5TIS E;  4I7Z B;  3HTK B;  2N1T C;  2D2C D;  3IR9 A;  2YMY A;  4COC A;  2LKI A;  2GUV A;  2ITA A;  2G3A A;  2A06 D;  3M9H A;  4EIJ A;  2VSQ A;  3EFG A;  1K73 Q;  1LGH B;  1J2J B;  3SFE C;  2R3S A;  2PEN A;  3G71 P;  2E75 C;  7CEI A;  4U0C A;  3EJD A;  2DGY A;  1NU1 E;  3H1I E;  1BCC G;  1E5W A;  3B5N C;  2XDJ A;  3H1K J;  2OYO A;  3CMA P;  1HTL C;  5DJU B;  1GPJ A;  1FAV A;  2E74 C;  1FJP A;  1BE3 E;  1OW7 A;  2IBZ G;  1JOC A;  4UB6 E;  1AJY A;  1PPJ G;  3H1L D;  1NTK D;  1SQQ K;  2WPS A;  2LKM A;  2P1J A;  1IFI A;  3TF5 A;  1GZL A;  3G28 A;  5GTH H;  1EC5 A;  4JF7 A;  1LWU A;  2WSE J;  3L74 G;  1L0I A;  1A43 A;  1K04 A;  1QEX A;  1VQK P;  4IL6 E;  3L72 G;  2AFD A;  1LTG C;  4ZMD A;  3CCR P;  2MF4 A;  3CXH I;  3CX5 D;  3AE9 C;  1CEI A;  4WB4 A;  3HD7 D;  3HE4 A;  3MHV A;  4HYT B;  1LP1 A;  4H2W C;  4LLH A;  3G9R A;  2Q6Q A;  1LP1 B;  3N7N A;  3U59 A;  1QGK B;  1CZQ A;  2OYH C;  5H2F H;  2O1J A;  2KOD A;  3WMM 0;  1SS1 A;  2J5U A;  3TNU A;  1FE6 A;  3L70 E;  1FOS F;  1VF5 B;  1FZC C;  1IUQ A;  4YXD C;  1JTH A;  1SP4 A;  3L35 A;  2IBZ D;  1SQX D;  2N5H A;  1SQV K;  2QNW A;  2M3E A;  1MV8 A;  3PHL A;  2QM8 A;  4UHP B;  5DCK A;  5B5E H;  3G29 A;  1IMP A;  2ZT9 B;  2PEM A;  1BXI A;  4WY4 A;  1W2B O;  3H1L J;  1KQL A;  1BSH A;  2ZVO B;  1T3J A;  2NO8 A;  2QRX A;  4PD4 I;  2WPV B;  4Y99 B;  2IDB A;  2M5A A;  1Z6M A;  2AEJ A;  3B5I A;  1BDC A;  2ZXE B;  2IFM A;  2FVA A;  4YTP C;  2ZJS E;  4RO0 A;  5AVQ B;  3D71 A;  3CXH E;  2Q9I A;  4U0A A;  1YJ9 P;  1M7L A;  2C0X A;  4Y28 J;  2HR3 A;  1N8R Q;  2P58 A;  1BGY D;  4XFY A;  2KGE A;  2KXP B;  1RE4 A;  3AE6 C;  3B4S A;  2I1J A;  2HFE D;  2E75 B;  3A7O A;  1GDT A;  2K88 A;  3LW5 H;  3M0D A;  2WPR A;  5GTI E;  3G26 A;  2H88 C;  3M9B A;  1S1C X;  4YPC A;  1RE3 A;  1FS0 E;  3HD7 C;  1FU1 A;  2OTL P;  2YIU C;  1SQQ G;  2E74 B;  1PP9 E;  1L0L E;  1FDO A;  3WUT A;  4BPF A;  1BCC J;  3H1J E;  1OMI A;  1NYH A;  2V4H A;  1A02 J;  3A0B E;  3UIA A;  2AFE A;  1JUN A;  1LT9 C;  1NTZ K;  3RK3 B;  3AED C;  1YIT P;  4H44 C;  2KOO A;  1NHL A;  1PGQ A;  1M1K Q;  3VP9 A;  3MTU E;  4XRQ A;  1OXZ A;  4L76 A;  3HUS B;  1QLE D;  2BCC G;  3EWK A;  2QJK B;  4MRT C;  2OTK E;  2NPS C;  3TGU E;  3E2D A;  3A0H E;  5KP7 B;  2ROQ A;  2PP6 A;  2E42 A;  1ACP A;  4XRO A;  2W90 A;  4NPE A;  3PP5 A;  3L74 J;  4H2X C;  1GL2 A;  4H13 D;  5CHX A;  3BCC E;  1ZXG A;  4W7Y A;  2O01 J;  1GL2 B;  1KB9 H;  3BAT A;  1YTZ T;  1SQP K;  1Q86 Q;  2LR2 A;  1KYO D;  1JJ2 O;  4PV1 B;  1LTJ C;  3CME P;  1L0N E;  3FWL A;  3L72 J;  4GOF A;  1IFN A;  2KZI A;  5KLI C;  2I8D A;  3L75 E;  3L73 D;  3VMA A;  2E76 B;  4HH2 A;  2OYH B;  1UNK A;  1T6A A;  5F2O A;  3WU2 H;  4DT0 A;  1HGZ A;  2IYP A;  3P7K A;  2JEE A;  1GTW A;  5KKZ B;  4PWV B;  2XZ0 D;  2VLO A;  1ZN5 A;  2QJP B;  3AE3 C;  1FOS E;  2FAC A;  1UII A;  1CSB A;  1VQP P;  3LW5 J;  1EQ7 A;  3TSI A;  4PD4 D;  3F5H A;  2KG6 A;  2PAJ A;  1R5L A;  3E1I A;  4IOI H;  5KAF E;  3WUV A;  1NOH A;  1KIL E;  2K9Y A;  2FKW B;  1NQ4 A;  2ERH A;  3U1A A;  1MZ9 A;  1GXH A;  3U1C A;  1EZV G;  1NTM E;  1P84 H;  3TDK A;  1VQM P;  1LTB C;  1OVV A;  5BU5 A;  2JR8 A;  2QM7 A;  1M90 Q;  3H32 A;  2FBW C;  1DNY A;  4U0B A;  3QWO C;  2Y9Z A;  2XND H;  4IFM A;  5B66 H;  1KN7 A;  1GW3 A;  4A7P A;  5KLV K;  1DH3 A;  1ZRT E;  1JO5 A;  3MGN A;  4ASV A;  2ZXX A;  3DS0 A;  3KHU A;  1ZNV A;  2M8P A;  3C8V A;  4H13 C;  3RBZ A;  1BSN A;  5HGM A;  1OWA A;  4QMA A;  1FJK A;  1NTZ G;  2PEK A;  2OGU A;  1SQV D;  3L73 J;  4DOJ A;  4R0M A;  3L71 D;  2Z5I A;  3SSU A;  1LT9 B;  3GKL C;  5CBN A;  4H44 B;  1SQQ J;  3RGU A;  2KG8 A;  1Q2N A;  3T97 A;  1URQ A;  1NU1 K;  5K5G B;  5AW8 B;  2GZF A;  1MFZ A;  2FYU D;  3H1H D;  1JY3 O;  3IAO A;  3G4S P;  1KMI Z;  2NPS B;  3KZI H;  3AE7 C;  2O01 N;  2XU6 A;  3CCS P;  2BCC J;  1AYI A;  2LOL A;  2N6Y A;  5AW6 B;  1PV3 A;  2IYO A;  3W68 A;  1VQO P;  1DX7 A;  1JY3 P;  1HWT C;  3ABV C;  2CPS A;  4WY4 D;  3CWB G;  4TLF A;  4YXW H;  4DCK A;  3FXE A;  1M8O B;  3L36 A;  1D7M A;  1KQS O;  1L0H A;  2N6Z A;  1LNQ A;  2AVA A;  4C7R A;  1PIX A;  3G6E P;  1N73 C;  3SWF A;  2N9Y B;  3H1K D;  4D6T G;  1ZP0 C;  1FC2 C;  5APS A;  1K8A Q;  1HQB A;  3MD0 A;  1PZQ A;  3DTJ A;  2BUO A;  4RKU J;  1OVR A;  1ZV8 A;  1NTZ D;  3QH9 A;  2A06 E;  4NEO A;  1SFC D;  2AXT E;  1EOQ A;  5CCH A;  4IPY A;  1W2E A;  3KYQ A;  1L4A A;  3KXD A;  4N6J A;  1JMB A;  1L4A B;  3CX5 I;  1GD2 E;  2WSC H;  1M74 A;  2QIW A;  1VQ8 P;  2E5T A;  2JYL A;  1Y9B A;  5E79 E;  2Z46 A;  1PGP A;  1K30 A;  3H25 A;  2OQQ A;  4L75 A;  2NZ2 A;  1SQB G;  1X22 A;  2RKL A;  5KLV G;  3CCU P;  3Q1M A;  1SVF A;  1G2C B;  5HGN A;  1N7S C;  4AYC A;  1S72 P;  1SQP D;  3HTK A;  1VQ5 P;  3H1L E;  1H89 A;  1NVO A;  1RF1 B;  2KS1 B;  1NTK E;  2IBZ I;  2K9J B;  3GLM A;  3B71 A;  2L5G B;  3OW2 O;  2GUS A;  2L0Q A;  1RF0 C;  4CA3 A;  3CCL P;  2Y0D A;  4WY4 C;  4U3F G;  4IL6 X;  2QJY B;  2FYZ A;  3CI9 A;  2XKM A;  5HGL A;  2Q1K A;  2WWW A;  1ZOY C;  2KOP A;  1A8O A;  2ONT A;  1IZN B;  1NU1 G;  4B86 A;  1IMQ A;  3V2R A;  3CX5 E;  5APX A;  3RL0 g;  2LIU A;  1EIA A;  4LC1 A;  3D6Y A;  2MVV A;  3NTE A;  1MZ8 A;  1J1E C;  4NPF X;  1YJN P;  1NTZ J;  2KI7 B;  3C9I A;  4N3Y B;  2YNY A;  1WMK A;  1RE4 C;  3CXC O;  3VN0 A;  1SFC C;  1YHQ P;  1RQV A;  1E0H A;  5AW1 B;  1BE3 G;  3HRN A;  1FZE A;  2Y0E A;  3II6 A;  1GMJ A;  4PH1 A;  2JGP A;  1YYC A;  1RO0 A;  2KUB A;  5AVU B;  2R32 A;  1FZF A;  4PJ0 H;  2N5I A;  3GHG C;  5TIS H;  3BAS A;  1S5L E;  1ZW0 A;  1L0L K;  1NGM B;  5KLV D;  3V2Q A;  1FBM A;  2BAS A;  2IBZ E;  5KJ7 C;  1SQX E;  2B88 A;  1G1I A;  1JY3 N;  4AUW A;  3DS5 A;  2KIK A;  1SQP J;  1KLP A;  2W6A A;  3ITK A;  1T2K D;  1Q82 Q;  4WWI A;  5APY A;  5KP6 B;  5AVR B;  3LMO A;  2D2C C;  2K93 A;  4U3F D;  2L4B A;  3I55 P;  3AEB C;  1OR5 A;  4H0L B;  2M0B A;  1M1J C;  2J59 M;  3O6Q B;  2KLU A;  2YO2 A;  3V2P A;  4CPG A;  4R4M A;  2AEM A;  2ZYA A;  1NWQ A;  1BGY E;  3CCQ P;  3HYB A;  1BCC D;  1X9V A;  4D6T J;  2IPP A;  4GR2 A;  3M91 A;  3H6P A;  2WT7 A;  1LTT C;  1KYO I;  1N7L A;  2YMK A;  4UB6 H;  2WT7 B;  2FFD B;  1L0N K;  5BU8 B;  5KAI E;  3DS3 A;  1RO2 A;  3N4X A;  4DG9 A;  1Q7Y Q;  2WTY A;  1KB9 I;  1KIL B;  3RG6 C;  3AEG C;  1PPJ D;  4NPD A;  2OYI C;  2YKO A;  1IFP A;  1N7S B;  2IZ1 A;  3E7K A;  3M06 A;  2CG5 B;  1YIJ P;  1J1D C;  2NRG A;  5AW0 B;  3RK2 D;  2KGA A;  1ZR2 A;  2IZ0 A;  1JMM A;  1AQ5 A;  1URQ D;  3LID A;  2HG5 D;  3NY7 B;  2N1T B;  3L74 D;  4IL6 H;  2N98 A;  5KLV J;  2R3C A;  1X0T A;  1PEU A;  1OW8 A;  1YBK A;  2K5X A;  2XV5 A;  3BRT B;  2N9B A;  2C9L Y;  4C7N A;  3WBH A;  2FYN C;  2XV6 A;  3L72 D;  3Q5P A;  4C7N B;  2HPC A;  3B8E B;  4U0E A;  1T2K C;  2HPC B;  3S4R A;  3F89 A;  2RH0 A;  2W8Z A;  1VQ6 P;  3G1G A;  3HZQ A;  2R5D A;  3B5N A;  2K0Y A;  5KTB A;  3B5N B;  4U3F J;  2KOQ A;  2YO3 A;  1DD3 A;  1RNI A;  2WSF H;  4ZKP A;  1NH4 A;  1KYO E;  2A45 I;  1MKM A;  2MKV A;  1VPC A;  5CBO A;  1SLQ A;  4OGQ D;  3L73 E;  1L0L G;  1NU1 J;  5F2N A;  1NKN A;  3H1J G;  5CCG A;  2LIW A;  2M8N A;  2M5R A;  2ZYG A;  1S9K D;  3VOP A;  2MY5 A;  2GZG A;  1X3O A;  3HUS A;  5CZD B;  2PGD A;  2RN0 A;  3JCU E;  2Z44 A;  4R4L A;  4PD4 E;  2V7Q H;  5APW A;  3RL0 D;  3TGU G;  1FZG A;  1VDF A;  4MN4 C;  3DS2 A;  2QSI A;  3CXH H;  4Z1M H;  3RK2 C;  2CWO A;  3KQG A;  3FGA D;  1URQ C;  3BVH A;  2JJL A;  2KSE A;  1YJW P;  2QE7 H;  1MUU A;  4HJG H;  2D2C B;  1VQL P;  4BXL A;  1NJI Q;  3BCC G;  1IFD A;  4XFJ A;  1EXI A;  1N86 A;  1YQ4 C;  5GTI H;  3MGE A;  5EW5 E;  2W6B A;  2CGQ A;  4WVZ A;  2JDI H;  2H89 C;  1L0N G;  1HF9 A;  4OWF A;  2OYH A;  3L75 G;  3KDP B;  4UB8 E;  1PEQ A;  4U0D A;  4EI2 A;  2GZJ A;  2GDX A;  3GMA A;  1KB9 D;  4M3L A;  1KFN A;  1ZR4 A;  2LXB A;  4HKG A;  3ZDM A;  3O8Z A;  3A0B H;  2XXM A;  1PFI A;  1SQQ D;  1KV4 A;  5KP8 B;  3CCM P;  1FZC B;  1L0L D;  1CW5 A;  4L74 A;  3V5B A;  1PEO A;  1SQV E;  3TYY A;  1VHN A;  1M6N A;  2WSF J;  4I6M C;  4OGQ C;  3CPW O;  4WYM A;  3L71 E;  4W7Z A;  2Q3I A;  3EFF K;  3A0H H;  2WIT A;  2BCC D;  2JBG A;  2RMZ A;  1JCD A;  1ZME C;  2MD9 A;  5L8R J;  1W5C E;  2N50 A;  5AVT B;  2FYU E;  2E1M A;  3H1H E;  1DD4 A;  3AEE C;  2DNW A;  4PH0 A;  1XTC C;  1P84 D;  1SQB K;  5JPA A;  2XT1 A;  2EFJ A;  3RL0 C;  2K94 A;  2GDW A;  4BPH A;  3OA7 A;  1QVG O;  1PGJ A;  4RES B;  3TK1 A;  3SFD C;  4TT3 H;  2W83 C;  2KYV A;  2CNR A;  1NTK K;  4I7Z C;  2FQ1 A;  2CK3 H;  2AF8 A;  2K1A A;  3HD7 B;  2OTJ P;  1EDL A;  2YIU B;  1UJZ A;  1IK9 A;  1JCC A;  4HKZ H;  2MR8 A;  3G21 A;  2CPB A;  2FXM A;  2YXQ B;  3Q5R A;  4K3A A;  3H1K E;  1ZMB A;  1LT9 A;  5AW3 B;  3CD6 P;  5APU A;  2WPQ A;  1IFM A;  1NTZ E;  1Y47 A;  5KAF H;  2OAR A;  2YXR B;  2ZYD A;  3IN6 A;  3H0D A;  2B9B A;  2X2B A;  1L0L J;  2XZ1 C;  4K35 A;  3H1J J;  1EXJ A;  4N78 D;  1PGO A;  1VF5 D;  2E5Y A;  1A02 F;  5CMZ A;  2NPS A;  2PEQ A;  3NXS A;  2EIA A;  1FR2 A;  4BRY B;  1EZV D;  2KR5 A;  2ZT9 D;  3R2P A;  3B4Q A;  1NAY A;  2KG9 A;  1QX8 A;  2K37 A;  5C39 A;  2JU2 A;  1LTJ A;  1SQP E;  4XFX A;  3I5C A;  2FXP A;  1KOR A;  1LTJ B;  4QNB A;  1SQX K;  1NKZ B;  3WUU A;  5KLI B;  2L91 A;  2L6E A;  3EQ2 A;  3CC2 P;  1LWU C;  1L2P A;  3P8C D;  2GZE A;  3EJE A;  2UWJ E;  5BVZ A;  1LJ2 A;  2FVE A;  2K2Q A;  4DZO A;  3G3Z A;  2WMM A;  3A5T A;  1L0N J;  2A06 G;  2E75 D;  1U57 A;  3L75 J;  3EJB A;  2AXC A;  4GIF A;  3C1L A;  4W80 A;  1M57 D;  1Q90 D;  2Y0C A;  2P67 A;  1JY2 P;  1JNM A;  2E74 D;  1QRJ A;  2KP8 A;  4HB1 A;  3FX0 A;  3Q3D A;  1BDD A;  1HY8 A;  4ASW A;  1G2C A;  1VQN P;  4IFF A;  3RK3 D;  5TJH A;  2M8L A;  2J58 A;  5CCG D;  3FWN A;  1AQT A;  1RF1 A;  2KS1 A;  3VMX A;  1VF5 C;  2K9J A;  2JKV A;  1S5L X;  1AV1 A;  3H1L G;  3LRY A;  1NTK G;  4BPG A;  2Z45 A;  2QG4 A;  2W6J H;  2JU1 A;  5KLV E;  3CWB D;  5HGO A;  2QEX P;  2ZT9 C;  4JQ0 D;  3E1R A;  1YI2 P;  3A3Y B;  1HGV A;  3CL3 D;  2O1K A;  4H13 B;  3K5B A;  5GTH E;  2B87 A;  3HE5 A;  2AXT H;  2B87 B;  3HE5 B;  4Y99 C;  1FDI A;  2KZJ A;  4D6T D;  1GL2 D;  2WVR A;  3VMY A;  1T8Z A;  2YKQ A;  4PV1 D;  3H1I G;  2KNC A;  4U3F E;  2KNC B;  5E79 H;  1T8K A;  2HYN A;  2E76 D;  4XA4 A;  1ZLL A;  2KGC A;  1Q81 Q;  1G1J A;  3AEF C;  3GJN A;  1EDI A;  3P32 A;  3CLQ A;  1BCC E;  1HJ0 A;  4PXH B;  1RH5 B;  3M0D C;  2HLO A;  5AW9 B;  3A2A A;  3PTZ A;  1IJD B;  5BS2 A;  1LTS C;  3CCV P;  1GU5 A;  1SQB D;  3CC7 P;  1RE3 C;  3V6I A;  2FQ0 A;  5AVX B;  5H2F E;  2K3R A;  2M8R A;  2WSC J;  4LGD E;  3SWY A;  3H47 A;  2FXO A;  2FVF A;  1SQX G;  4GKG A;  2ZVN B;  1PPJ E;  5APQ A;  3RK3 C;  3VMZ A;  5CCG C;  1NO4 A;  3MZW B;  2FQ2 A;  2Y9Y A;  3OAK A;  3JSV C;  5HVC A;  1S4X A;  2K0X A;  1KQF B;  3HUS C;  5B5E E;  2QJK C;  1N73 A;  3L74 E;  4I1L A;  1LWU B;  2E43 A;  2K92 A;  1N73 B;  3P05 A;  3CWB J;  4JYB A;  4XE5 B;  3O6Q A;  4GDO A;  5AVS B;  1EDK A;  2JQ4 A;  3CX5 H;  1U7M A;  1S3J A;  2L9F A;  1FZB A;  1NAF A;  3CE7 A;  4O9B A;  3L72 E;  2JO0 A;  1JEK A;  1OIP A;  2Q3E A;  2VLQ A;  1BGY G;  3L4F A;  1NU1 D;  3H1I D;  1XTG B;  4QKO A;  1OZH A;  3VYI A;  4H2Y C;  1GL2 C;  2FFD A;  1JY2 N;  2M3B A;  4PV1 C;  4ZKU A;  3HE4 B;  3SWK A;  3L70 G;  1GK6 A;  1KIL A;  1X8Y A;  1BE3 D;  2E76 C;  1S5L H;  2L22 A;  2BHV A;  1OFC X;  3MUD A;  2PEI A;  1HUC A;  1EMV A;  2C0W A;  1N7S A;  5M1B A;  1HH0 A;  4H44 D;  5KKZ C;  1R5S A;  3AE1 C;  3TNU B;  2Q7C A;  2QJP C;  1AVO A;  1KTM A;  3AE4 C;  2SPZ A;  1M56 D;  2Z5H A;  4JBZ A;  2N1T A;  3H4E A;  1SQB J;  1JTH B;  4KJM A;  1S9K E;  5APT A;  3V4W A;  4IFD K;  2O3J A;  4U7J A;  4C46 A;  2NPS D;  1WT6 A;  3W67 A;  3M9Q A;  1RF0 A;  3CC4 P;  3G0V A;  4COP A;  2KOR A;  1OX3 A;  2O01 H;  3USS A;  1NTK J;  1YTZ I;  2VLN A;  4WY4 B;  3CCE P;  1NTM K;  2BEQ D;  3GG2 A;  3VRL C;  3U43 A;  2AEF A;  2P7J A;  3G1I A;  2GDY A;  5DJT B;  3S1K A;  2WZ7 A;  2KK7 A;  4XFZ A;  1N2D C;  2FYU K;  4I2L C;  2EHS A;  2M5A B;  1USE A;  2JAZ A;  5AW2 B;  3AE2 C;  5APV A;  1P84 I;  4EDF A;  1J1E B;  4IZ6 A;  1GW4 A;  2YKP A;  5KAI H;  1DV5 A;  3V4Q A;  1SFC A;  4RJT A;  4M0I A;  1SFC B;  1PP9 G;  1M6E X;  1H88 A;  3L73 G;  3GF7 A;  3DPH A;  3H1I J;  1KB9 E;  1JM0 A;  3L70 D;  3AEA C;  2LXC B;  4OH8 B;  5AW7 B;  1OVU A;  1D1D A;  5CCH D;  3GHG A;  2WSS H;  1L4A D;  1SQQ E;  3GHG B;  2JWA A;  1KC8 Q;  5KJ7 A;  1H8A A;  1BE3 J;  3WU2 E;  3R4Y A;  1WRG A;  3PJS K;  1VQ7 P;  1LT1 A;  4DJG A;  2Z4E A;  1PL5 A;  3PLN A;  3NMD A;  2XNX A;  2BCC E;  1SQX J;  1AF8 A;  3DS1 A;  1T3U A;  2LL8 A;  1E6J P;  1USD A;  3Q20 A;  3CXH D;  1M1J A;  1EZV I;  3PH0 A;  2LF4 A;  1M1J B;  2WQY C;  1P84 E;  4OVN F;  1KYO H;  1RY3 A;  2PNG A;  3IF4 A;  3BRV B;  2A45 G;  2H43 A;  2P9X A;  1KFM A;  2PRR A;  4KHX A;  2POH A;  4L73 A;  5B66 E;  1FZC A;  2KW2 A;  3RBX A;  2KOG A;  1PP9 D;  1BGY J;  3KPE A;  4JYC A;  3H1J D;  3CCJ P;  1AVY A;  5AVZ B;  2EHT A;  3JCU H;  3MP7 B;  2OYI A;  1SQV G;  1IFJ A;  3Q5S A;  2OYI B;  4EOT A;  2PEJ A;  4PD4 H;  3L70 J;  3GZL A;  2FY8 A;  4EYY Q;  1J1D B;  5HV8 A;  1F80 D;  3L71 G;  1DIP A;  3MIW A;  3RG2 A;  2WPT A;  3GW6 A;  5CCH C;  5AVW B;  1QL1 A;  2C9N Y;  1L4A C;  1BAJ A;  1YQ3 C;  2KB7 P;  3NTN A;  1NTM G;  2DW3 A;  4N78 E;  1U7J A;  2BEZ F;  5AVY B;  3TGU D;  2GA1 A;  3P8M C;  2FYU G;  2JB0 A;  3OJA B;  3H1H G;  1AA0 A;  1GU4 A;  1VQ9 P;  5EFW B;  2FYN B;  1EZV E;  2HOD A;  2GYK A;  1IC2 A;  1K05 A;  2JP3 A;  2HOD B;  1EDJ A;  3BCC D;  2G8Y A;  2KLV A;  4UB8 H;  2FAE A;  2V7Q J;  2MR7 A;  2A45 H;  1FDM A;  5AW4 B;  2EG5 A;  3KZI E;  2R5B A;  1DEB A;  2LML A;  1RF1 C;  1R8E A;  1HJB A;  1L0N D;  3H32 B;  3AEC C;  3HD7 A;  2KGD A;  3L75 D;  2ZAE B;  2ZFC A;  3GZM A;  4F37 A;  3V2N A;  2H8P D;  2B89 A;  4GR6 A;  4H0L D;  3VTP C;  4AQR D;  3P8C E;  5EJD A;  2QJY C;  3H1K G;  2FAD A;  1Y8A A;  2JYG A;  4GT1 A;  1KQG B;  2KWL A;  1PP9 J;  3JC2 2;  1GK4 A;  1DEE G;  2IX7 C;  3NFQ A;  3GF3 A;  1X79 B;  2Q5U A;  2I1K A;  2LTE A; 
#chains in the Genus database with same CATH homology
 2Z44 A;  3G28 A;  3I56 P;  1K9M Q;  2E1M A;  1M6E X;  2M8P A;  2BQ1 E;  3DPH A;  1AUM A;  3RG6 C;  4XFX A;  3CXC O;  1EOQ A;  2PEJ A;  3B5I A;  4PH0 A;  5HGM A;  4IPY A;  1YHQ P;  4QNB A;  1Q86 Q;  1JJ2 O;  2L6E A;  5JPA A;  2XT1 A;  2EFJ A;  2PEK A;  1YIJ P;  3CC2 P;  3CME P;  1D1D A;  3DS2 A;  4U0A A;  1YJ9 P;  1M74 A;  1A43 A;  4PH1 A;  1RO0 A;  1N8R Q;  2CWO A;  1BAJ A;  1QVG O;  1VQ8 P;  2QA4 P;  4XFY A;  1KC8 Q;  2JYL A;  1PEM A;  2Z46 A;  1YJW P;  1VQK P;  5F2O A;  3DS4 A;  1K30 A;  1VQL P;  2BHV A;  1Q81 Q;  2PEI A;  1PEU A;  1NJI Q;  3G26 A;  3CCR P;  1VQ7 P;  1VQ9 P;  3MGE A;  2OTJ P;  1VQP P;  3DS5 A;  4COC A;  3WBH A;  3CCU P;  1QVF O;  2XV6 A;  2OTL P;  5HGN A;  5BS2 A;  5I4T G;  1S72 P;  3CCV P;  1PEQ A;  3G21 A;  3H4E A;  4U0D A;  3DS1 A;  1VQ5 P;  3CC7 P;  4U0E A;  1Q82 Q;  3G4S P;  1QRJ A;  2EG5 A;  1E6J P;  2PEO A;  1ZMB A;  4U0F A;  1VQ6 P;  1K73 Q;  3CD6 P;  3G1G A;  3HZQ A;  2KOD A;  3Q20 A;  2XXM A;  5BS1 A;  2PEN A;  3H47 A;  3G71 P;  3CCS P;  2OAR A;  4U0C A;  2BUO A;  3CC4 P;  2LF4 A;  1RNI A;  2DGY A;  3CCM P;  3I55 P;  3G0V A;  4COP A;  3OW2 O;  1YIT P;  3H0D A;  5F2K A;  1VQN P;  1VQO P;  2M8L A;  3CCE P;  4GR6 A;  1IUQ A;  1M1K Q;  1PEO A;  1VQM P;  3CMA P;  3CCL P;  4XRQ A;  3VRL C;  3G1I A;  1KD1 Q;  1M6N A;  2PEQ A;  2P9X A;  1M90 Q;  2EIA A;  5HGL A;  5F2N A;  3CCQ P;  3LRY A;  3CPW O;  4WYM A;  3HYB A;  1KQS O;  4XFZ A;  5DCK A;  3G29 A;  4GR2 A;  2JYG A;  1A8O A;  4U0B A;  2Z45 A;  3E2D A;  2ONT A;  3P05 A;  3M1M A;  2PEM A;  1VQ4 P;  5HGO A;  2M8N A;  2QEX P;  3G6E P;  1W2B O;  2PY8 A;  1YI2 P;  4XRO A;  3DS3 A;  3CCJ P;  1EIA A;  1RO2 A;  3NTE A;  1K8A Q;  1Q7Y Q;  1YJN P;  3DTJ A;  3DS0 A;  4M0I A;  2JO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...