3CCVP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ccvP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ccvP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ccvP02
3CCSP 2OTLP 1VQ9P 1VQNP 3CC7P 1KD1Q 1S72P 1Q81Q 1QVGO 3I55P 1VQMP 1QVFO 1VQPP 3CXCO 2OTJP 3OW2O 1K9MQ 1YJ9P 3CD6P 1YI2P 1M1KQ 3I56P 1JJ2O 1VQ4P 1N8RQ 3CCQP 3CC2P 3CMAP 1W2BO 3CMEP 1VQ8P 1YHQP 1KC8Q 1K73Q 1K8AQ 1VQ7P 3CPWO 1YIJP 3CCEP 3CCJP 1VQ5P 1KQSO 1Q86Q 3CCMP 1VQOP 1Q82Q 3CCRP 1NJIQ 1VQKP 1VQ6P 3G6EP 3G4SP 1YJNP 1M90Q 1YJWP 1VQLP 2QEXP 2QA4P 1YITP 3G71P 3CCLP 1Q7YQ 3CCVP 3CCUP 3CC4P
chains in the Genus database with same CATH superfamily
1PZQA 2GZGA 2PEQA 1NTMJ 2QJPC 1N7SB 1VF5D 3G0VA 3IF4A 3L74D 1RE3A 2JBGA 2KR5A 1KB9D 1NO4A 5KAFH 4GT1A 2WPQA 4BPHA 2K0XA 3L75G 3VP9A 2ZFCA 1NTZD 1BGYG 1U57A 2E42A 1NQ4A 4YTPC 1IK7A 2JWDA 2E75B 3MTUE 1AQ5A 2O1KA 2JO0A 4Y99B 5KAFE 1JEKA 2IYOA 5HGLA 1GW3A 2L6EA 3H1LG 3O6QA 2H88C 4DOJA 1RF1C 1NGMB 1FDMA 1BE3D 2FFDA 4JPZB 1ZRTD 2KS1A 4MRTC 2AEJA 1P84D 1ZXGA 3HD7D 2C0WA 1OVVA 4IFMA 2FVAA 3S4RA 2WVRA 1HTLC 3RK2B 2KW2A 1KORA 4XE5B 1EDLA 2KXPB 1VQNP 1FDOA 3RK3C 2M8RA 1MZ8A 2ONTA 3L75E 1URQB 1WT6A 2XU6A 3H6PA 2AFEA 1N8RQ 4JF7A 1KILD 3BCCD 1DNYA 5KLIB 4H2WC 3TYYA 3G4SP 1D1DA 2IZ1A 3HUSC 3G71P 3GKLC 1M6NA 1KQLA 2E75C 5APQA 2B87A 1HVVA 1FOSF 4PJ0H 1M1KQ 1NTZG 3EFFK 1W2BO 3LMOA 2FYUK 4NEOA 4PWVB 5HGMA 4UB6H 1IMQA 3L73D 1LT9C 2ZYGA 3G3ZA 2XV6A 1PPJD 1PFIA 3CWBD 2L9FA 1BE3G 3H1IG 5H2FH 1JY3O 4W7YA 2FHSC 3BATA 5CMZA 1HGVA 5CCHD 1K73Q 4C7NA 2PFXA 4OGQD 4EDFA 2KSJA 3UIAA 2CWOA 1D7MA 1N86A 1XTGB 2LMLA 3CCLP 1BCCJ 3U43A 1RQVA 3L71E 2GDYA 3RK3B 3LW5H 3TNUA 3EJEA 3EWKA 1HWTC 3H1LJ 2NPSD 4NPFX 1S9KE 3ITKA 1SQQE 3G26A 2IYPA 2E5YA 1W5CE 2QJKB 1J1EC 1R5SA 1GPJA 1YQ4C 1OW8A 1E0HA 1S72P 1IK9A 2WSFH 2KNCA 1R8EA 3CX5I 4ZKPA 3CWBJ 1X9VA 1CI6B 1SS1A 5KAIE 1JCDA 3QWOC 2KOSA 4XFYA 1Y47A 1URQA 1L0LK 1S5LH 1L0NE 3ZDMA 3DTJA 4EOTA 1ZNVA 2K3RA 2KYVA 3CX5H 1PV3A 2K37A 3GZMA 1KN7A 4UHPB 2HG5D 1L0NK 2KG9A 3S9OA 5AVQB 1EQ7A 3H1KJ 1H89A 2R3SA 3SWKA 2P7JA 1NTMD 4D6TJ 1NVOA 1NAFA 4H0LC 3TSIA 1EDKA 1KYOI 5AVRB 4U3FD 4H2XC 2Z46A 1L0LJ 1VQMP 2MY5A 1SQBE 3CD6P 4JYCA 4Z1MH 2AEMA 3CWBE 2B89A 1PEQA 3NTEA 1RO0A 3H1ID 2ZVOB 3G1GA 1KFNA 2XZ1C 2VLPA 1L0NJ 2YKPA 2CPBA 5HGNA 2J5UA 3A7OA 2WSCJ 4OGQB 1VL2A 3HRNA 1DD3A 1A02J 1AVYA 2XKMA 1FC2C 1G2CA 1PP9E 2K93A 2Q7CA 4C7RA 1ZMEC 1N7SA 2Q3IA 5EFWB 4F37A 4GDOA 1QX8A 2KOQA 3GMAA 1NAYA 3CXHE 1Q81Q 2OYIA 3VTPC 1FBMA 4N78D 3KZIE 1VDFA 2Z4EA 1X8YA 2W83C 1M8OB 4U0DA 2WSFJ 3JSVC 4OGQC 3TGUG 2O01H 3WUUA 3A2AA 2QJYB 1EIAA 2GM4A 1CI6A 4H13D 1FZCC 2DGYA 1YJ9P 1JY3N 1RQUA 2YIUC 2N9YB 2Q1KA 2NPSA 1JY3P 1M74A 2CGQA 1YI2P 2KSEA 2LTEA 1K8AQ 4PH0A 2ITAA 1OR5A 1VQ6P 3WBHA 1NH4A 3BCCE 2H8PD 1HJBA 1P84E 3OAKA 1FAVA 2B9BA 2BCCJ 2KOOA 2MR7A 4R0MA 3P7KA 3SWFA 2PEOA 3RGUA 1SFCC 2K9JB 3AEDC 1EDIA 2IBZI 3MZWB 5M1BA 4TLFA 2EIAA 1UJZA 3H1HJ 3H1HD 5KP7B 2WMMA 2Y0DA 1SQXK 3IAOA 3L75D 2XXMA 3Q5PA 3A0HH 2M3BA 2FVFA 2K92A 3LIDA 3TGUE 1GU4A 1GD2E 2VRSA 3U1CA 3V4QA 1URQD 2QM8A 4UB8E 4M0IA 2LR2A 3H1KD 1HJ0A 4XFXA 1M57D 4PV1B 3KDPB 1LTGC 2EFJA 3V6IA 2YKQA 1LP1A 1Q7YQ 1PEMA 1S1CX 4COCA 4EYYQ 1KB9I 4HKZH 3V2NA 3H1JJ 5AW6B 1RO2A 3B4SA 1JMMA 1KQFB 3G9RA 1ZMBA 1URQC 1MKMA 1LWUB 1GK6A 2IBZG 5KJ7D 2BASA 4RJTA 2OYIC 4K3AA 1FZBA 3H1KE 2A06E 4IL6E 3BASA 2B88A 4WY4B 3KYQA 3RL0B 1BGYE 4I6MC 3CPWO 2PEMA 4BWNA 1FJKA 3C9IA 2XV5A 3PHLA 3H1KG 2AEFA 3OA7A 1YJWP 1EDJA 1LT1A 2QEXP 4H0LB 1IFMA 5BU5A 2R5BA 2L91A 1PPJG 3P8MC 5AW9B 3KPEA 3WU2H 3DS0A 1IFDA 1K04A 1L2PA 2QSIA 2NRGA 1DEEG 1N7SD 1VF5B 4GOFA 5CHXA 5AW3B 3MUDC 2N1TD 5AW7B 2FQ0A 1L4AA 1VQ5P 1Q86Q 3H1IE 2W27A 2R3CA 4MN4C 3H1HE 3OJAB 1YHQP 5KKZB 2Z5IA 4IL6X 4XFZA 1DX7A 4L74A 2BEQD 4BRYA 3NFQA 3SFEC 2M5AA 1KYOD 2FY8A 2KS1B 3N4XA 2GZJA 1SQQG 1DV5A 1JY2N 1NU1D 3BVHA 2W90A 1EZVE 2OTJP 3HTKA 5TISH 5DCKA 1JJ2O 2YXQB 3D70A 5KKZC 3RBXA 4PD4D 1RF1B 2JEEA 2MF4A 3MHVA 4L75A 3U1AA 1SP4A 4DJGA 3GHGC 1GK4A 1YTZI 1JTHA 3NXSA 2E76B 2EHTA 3T97B 1FS0E 1N73A 1AV1A 2KIKA 3DS2A 2RH0A 4WWIA 3ABVC 3L75J 1JMBA 2OYHA 3VN0A 1VF5C 4A7PA 3DS4A 3PJSK 2I8DA 5KJ7C 4H13B 3HZQA 3H32A 3A0BH 3MIWA 2Y0EA 2JU1A 2JKVA 4U3FG 2NPSC 5B5EH 2LIUA 2ZXXA 3L71D 3HUSB 1KILA 2KG8A 2AFDA 3AE4C 1Q82Q 1VQKP 2KGAA 1K30A 3VMAA 3H0DA 1KFMA 1PGQA 2WT7A 2K94A 1SQXJ 3O6QB 1SQBD 1Y9BA 3M9HA 3Q20A 3AEFC 2HR3A 2K9JA 2E76D 2IFMA 2ZT9C 3L71J 4PXHB 3LIEA 4CA3A 1MUUA 1BDCA 3RG6C 3FXEA 4WY4C 5APVA 1FE6A 2L5GB 1XTCC 1L0ND 2DW3A 5CBNA 2Z5HA 1AFOA 3F5HA 3M06A 2MR8A 5B66H 2JU2A 2QM7A 1G2CB 5AVWB 5AW8B 3VOPA 1PP9D 2L4BA 1L0LD 4H0LD 2CG5B 3PP5A 1P84H 4U3FJ 1Y8AA 1G1IA 5KLVG 1F80D 2A45H 5KTBA 1RE4C 1J1DC 1WMKA 2HODB 1QVGO 2N1TA 4D6TG 1ZW0A 4WBAA 4QNBA 1UIXA 1BXIA 1S3JA 3GLMA 2H89C 2CPSA 3CI9A 2AF8A 3E1IA 5AW2B 2N5HA 2JYLA 2RKLA 1IFNA 3V2PA 4LLHA 3VMZA 4WYMA 3NY7B 1NTME 2MVVA 4RKUJ 1H0TA 3L71G 3VMYA 2C9NY 1CW5A 1ZLLA 1SQPE 2LF4A 3C1LA 5GTIH 1SQBG 2E43A 1ZOYC 2JDIH 2XDJA 3WU2E 1UIIA 5H2FE 1OWAA 1UNKA 3MGNA 3AE2C 1SQPK 2Q9IA 2O3JA 2K5XA 4L73A 4W80A 3RL0D 5KLVE 2WT7B 4XRQA 2WTYA 1PPJE 4HH2A 1KILC 1LTTC 1IFJA 3H1LD 4I2LC 3EFGA 4IFFA 2JB0A 1KYOH 1J1DB 2R32A 3TGUD 1PIXA 1N7LA 5F2OA 2Y0CA 3HTKB 2GZFA 4H2YC 1GXGA 1FZGA 3FGAD 1L0HA 4PH1A 2I1KA 2BCCG 3C8VA 1HH0A 2JWAA 2CQ8A 1PGOA 2FKWB 2XNXA 3G1IA 5GTHH 2AVAA 3GHGB 3L35A 2O01N 2OYIB 1HY8A 2PAJA 3L37A 2QA4P 2E74C 2FAEA 3L70J 1EXJA 1BCCD 3G21A 4HYTB 3I55P 1SFCD 1VQPP 1HUCA 3RG2A 5F2NA 2N5IA 3E2DA 1T2KD 5KLVJ 1FJPA 1YIJP 1HQBA 4BPFA 3CCMP 4EI2A 3G6EP 3GJNA 1T3UA 1QLED 1OW6A 1N73C 2KODA 1BDDA 1JNMA 2HPCA 2E74D 1RH5B 2FADA 2MD9A 2Q3EA 3CXHH 1JOCA 1LGHB 1QGKB 4IFDK 1T2KC 2E1MA 1NTZE 1SQPJ 5AVTB 3B5NB 2IDBA 5I4TG 1YQ3C 1K9MQ 3PH0A 3CXHI 2WWWA 1M56D 3L74E 2NO8A 1SQVD 1N73B 1X79B 3M9BA 2HFED 1NHLA 3P8CE 2WZ7A 2M5RA 3L74G 1GL2B 2O01J 1JO5A 1LTAC 1EMVA 1RF1A 5EW5E 3NTNA 1AUMA 3I5CA 2HPCB 2BUOA 2JYGA 2KZJA 2AXCA 3AE3C 1S4XA 3JCUE 1SQVJ 2OYHC 2D2CC 3JC22 2WSSH 1NTKJ 1GDTA 2HODA 4YXWH 1N7SC 4WVZA 3RL0C 4IL6H 1JUNA 2ERHA 2LXCB 2GDWA 3GZLA 1AA0A 4TT3H 3TNUB 3EJDA 2X2BA 1S5LX 4ASWA 4COPA 2P58A 2IPPA 2KUBA 4Y28J 2A45G 1EC5A 4AQRD 1SQXE 2FYNC 4UB8H 4WY4A 5JPAA 3CC7P 1MFTA 1S2EA 3MGEA 3B5IA 3D6YA 1DIPA 2KGEA 3CC2P 1NTKK 3L72D 1SQVG 4AUWA 3RL0g 2PENA 5DJUB 2G3AA 4OH8B 5AVZB 2NZ2A 1RE4A 1LTBC 3IFMA 2YO2A 3FWNA 2VLOA 3Q5RA 3H1JE 3U59A 1LTSC 3H1HG 2W6BA 2LXBA 2POHA 2GUSA 1BCCG 1NKZB 2FQ2A 2YIUB 3G29A 2YMKA 1EZVD 1R5LA 2OQQA 2FFDB 1YJNP 1AQTA 1IO4A 2QE7H 1SFCA 3WUVA 1WRGA 2PEKA 2YMYA 5TISE 3CCQP 4BPGA 2GUVA 3CMEP 1SQVK 2XZRA 1L4AD 2KG6A 1HF9A 1IMPA 3G28A 2N9BA 3H1JD 4U0AA 1FR2A 4PD4E 1SQVE 2FFDC 2FXOA 1H8AA 1Q2NA 1IFIA 3L73E 1T6AA 2KORA 2K0YA 2GZEA 4DG9A 1GXHA 3DPHA 2QG4A 3RK3D 1EOQA 1IFPA 1LNQA 4NPEA 3CCVP 2WSEH 4JYBA 2N1TB 1GTWA 2IZ0A 3MP7B 2FACA 1CEIA 2I1JA 2V7QJ 5KJ7A 2QJPB 3SFDC 1GZLA 3LW5J 3A3YB 1VQ8P 1PGPA 2UWJE 4JBZA 5CCGA 1OIPA 1RNIA 1S9KD 1A43A 1RE3C 3AE6C 4ZKUA 1QEXA 3BCCJ 3DS3A 1PL5A 4N3YB 3GHGA 1EZVI 2M8PA 3EQ2A 2NPSB 2IBZE 2SPZA 5AVSB 5CCHA 4QKOA 2IX7C 2FYUG 1YITP 2N6ZA 3H4EA 2RMZA 5KP6B 2ZYDA 5KLIC 4RESB 2GZIA 1K05A 4OVNF 3A0BE 5KLVD 3RBZA 4IPYA 5B5EE 1BE3E 1YTZT 4QMAA 3VYIA 1M1JA 2FQ1A 1EXIA 3CXHD 1IC2A 1SVFA 2BEZF 1FZCB 1LT9B 1MZ9A 4UB6E 2PY8A 5AW4B 4GR2A 1NTZJ 1OMIA 1USEA 3TGUJ 2XZ0D 1BCCE 3L74J 1AF8A 2R5DA 1QRJA 5E79H 1KV4A 1LP1B 1LJ2A 2P2UA 2WSCH 3CMAP 3T97A 2Z44A 3CCJP 1FZEA 3RK2D 1VKUA 4U7JA 1M7LA 5BS2A 3B5ND 2OGUA 3KHUA 1NKNA 2A45I 1JM0A 1SQXG 4PJ0E 2OTKE 1KC8Q 3VMXA 1KZUB 5F2KA 1CSBA 1RHZB 2E76C 4BRYB 1KQSO 1USDA 1E79H 2YXRB 2AXTE 3H1IJ 1KMIZ 4XROA 5APYA 1KB9H 4PV1C 2QIWA 4M3LA 3V2QA 1Z6MA 4OWFA 3I56P 3H1LE 4W7ZA 1NYHA 1S5LE 1MFZA 2WPVB 2N1TC 2KNCB 2K0DX 4D6TE 2D2CD 3QH9A 2PRRA 3WMM0 2BQ1E 2Z45A 3M0DC 3VP8A 3E1RA 3L70G 1L4AB 4R4MA 3TK1A 3DS1A 3AE1C 3V5BA 2GDXA 2KOPA 3FXDA 3MUDA 2JGPA 1DEBA 3P32A 3TDKA 2HLOA 4WB4A 2Y9ZA 3B8EB 4YXDC 4LC1A 2KZIA 1KD1Q 1LTJC 2FYNB 3AE5C 1NTKG 2JJLA 3D6ZA 1SQQJ 1RF0C 2B87B 3N7NA 2CNRA 4C7NB 2N6YA 1QL2A 4U0FA 1SQXD 2A06G 2QNWA 3LRYA 3IN6A 2KK7A 3SSUA 2KP8A 3CC4P 1FZCA 1BAJA 3M91A 1YBKA 3CX5E 1LTJA 3OW2O 1Z56A 1L0LE 1VQ4P 5CCHC 2FYUD 1H88A 4KHXA 3R4YA 4U3FE 3L72G 2H43A 1GL2D 5KLVK 1T3JA 1NU1E 4NPDA 2Q5UA 2VLQA 3AE8C 2N50A 3PTZA 2N98A 3FX0A 2HYNA 5CBOA 1VQ9P 4H44D 3TF5A 1JCCA 5HV8A 2L22A 2L0QA 4GOEA 1NU1K 1LT9A 2OYOA 2JP3A 4ASVA 3Q3DA 3MD0A 1U7JA 1GU5A 2E5TA 2VSQA 3JCUH 2O1JA 3CLQA 2JQ4A 1IZNB 1KYOE 2V4HA 4R4LA 3H25A 1ZV8A 3H47A 5AVYB 2FYUE 2KGCA 3M1MA 1OXZA 3L70D 3P8CD 1VPCA 1AVOA 1J2JB 1NU1J 1NTZK 2OTLP 2MJZA 1FZFA 3L4FA 1KILB 4O9BA 2QVAA 1PP9J 3KZIH 1LTIC 1JY2P 3GG2A 3RK2C 1NTKD 2FBWC 5APWA 3PRJA 4Y99C 1NJIQ 2W6AA 3R2PA 5TJHA 2Q6QA 1KLPA 1FOSE 2WPRA 3L72E 3HD7B 2C9LY 2XT1A 4XFJA 2A06D 2ROQA 3AE7C 1CZQA 2FYUJ 2E74B 3B4QA 4K35A 3DS5A 1NTMK 3Q2YA 2KOGA 5AW5B 3CCSP 4GIFA 1PEOA 3GF3A 2C0XA 1NWQA 3WUTA 3BCCG 3L36A 3B71A 2FYZA 4XA4A 1BGYJ 1ACPA 1SQQD 5APTA 1LWUC 1SQQK 5CJ0A 3A5TA 3CCEP 3HD7C 5C39A 3PLNA 1FDIA 1P84I 4H44C 2ZJSE 5CZDB 2PGDA 1VQLP 2K88A 2YNYA 5AVUB 3CL3D 4PD4H 3H32B 4HJGH 2H7HA 1VQ7P 1GL2A 3HYBA 1ZR4A 2LKIA 4GR6A 2LL8A 3AEEC 3F89A 4C46A 1FU1A 4H13C 3K5BA 2WPSA 2D2CB 2XNDH 1G1JA 2FVEA 1SQBK 3HE4A 3AE9C 3L73J 4WY4D 2E75D 5KP8B 1VHNA 2J58A 5GTHE 2G8YA 3AECC 5AVVB 3HE5B 3CCRP 2ZYAA 3O8ZA 2GA1A 1X0TA 5APSA 2P67A 1JTHB 5GTIE 1E5WA 5CJ4A 1KB9E 4U0EA 4DT0A 1SQPG 2JAZA 2BHVA 4D6TD 2J59M 1A02F 2WITA 1PGJA 3RK3E 2MKVA 1Q90D 3M9QA 3Q1MA 3P05A 4L76A 1ZP0C 2LPKA 3M0AA 4LGDE 1A8OA 4PV1D 1OVUA 1PP9G 2M8LA 3HE4B 5HVCA 4DCKA 1KQGB 1OZHA 2DNWA 3BRVB 4PD4I 3BRTB 2IBZD 5APXA 1IUQA 4BXLA 2P1JA 4I7ZB 2WSEJ 1FZAA 3E7KA 1ZRTE 3L73G 1DH3A 1SLQA 2YO3A 2EHSA 2M3EA 2LKMA 1MV8A 3CCUP 1JY2O 2KLUA 5DJTB 5AW0B 1ZN5A 5BU8B 2Y9YA 1GW4A 2V7QH 3L70E 3CE7A 3H1JG 1LTJB 4GODA 4IOIH 2M0BA 3VRLC 2KGDA 3Q5SA 3CWBG 1T8KA 2QRXA 1PEUA 1QL1A 2KWLA 1SQPD 4N6JA 2KLVA 5CCGC 1M1JC 2PEJA 2PNGA 5E79E 2IFNA 1TU3F 1OW7A 2RN0A 2OARA 1OX3A 5BVZA 3L72J 1J1EB 2FXMA 2ZAEB 3AEAC 2P10A 2KI7B 2ZT9B 1L0IA 2YKOA 4CPGA 5K5GB 2ZVNB 2FXPA 1X22A 3NMDA 1LWUA 1GL2C 4KT0J 1X3OA 4JQ0D 4N78E 2WQYC 4EIJA 1NTKE 1M90Q 3SWYA 1OFCX 5CCGD 1DD4A 2W8ZA 1W2EA 2ZXEB 4IZ6A 4B86A 1SQBJ 3HE5A 3AEBC 4ZMDA 3II6A 2PEIA 4ZNCA 3V4WA 2EG5A 5AW1B 2PP6A 4H44B 3V2RA 2LIWA 3GW6A 2LOLA 1NTMG 2BCCD 2M5AB 1VQOP 3B5NA 2P9XA 1L4AC 5HGOA 1BE3J 1QVFO 1NU1G 1M1JB 2VLNA 4GKGA 1OVRA 2ZT9D 2JR8A 1IJDB 3HD7A 2CK3H 5KAIH 1HBWA 1BSNA 1EZVG 5AVXB 1NOHA 1N2DC 1RF0A 1YYCA 3W67A 1GMJA 1KTMA 5BS1A 2AXTH 1T8ZA 4I1LA 4YPCA 1SFCB 3S1KA 5B66E 4AYCA 1RY3A 4U0BA 2MVUA 2K2QA 3D71A 3IR9A 3A0HE 3FWLA 4KJMA 2W6JH 1JB0J 2KB7P 3B5NC 2K9YA 4I7ZC 5L8RJ 1M6EX 3CXCO 1L0NG 2WPTA 5EJDA 3USSA 4RO0A 3KXDA 1U7MA 1HGZA 2QJYC 3AEGC 3GF7A 2QJKC 1L0LG 3KQGA 2BCCE 1H0TB 2GYKA 3M0DA 1KILE 5APUA 4HKGA 3EJBA 3W68A 1E6JP 2JO1A 1BSHA 2K1AA 2M8NA 1AYIA 2R44A 4U0CA 1ZR2A 1AJYA 7CEIA 1BGYD 3HUSA 4HB1A 2OYHB 3CX5D 4DZOA
chains in the Genus database with same CATH topology
5HGOA 2PEQA 1M6NA 1M74A 1QVGO 3G21A 3DS2A 3I55P 3H47A 1QVFO 1VQPP 3DS1A 3G0VA 5F2NA 1YI2P 1M1KQ 3E2DA 4QNBA 1W2BO 3M1MA 2PY8A 3DS4A 1K8AQ 3CPWO 3HYBA 1YIJP 1VQ7P 2PEMA 4GR2A 4PH0A 4GR6A 4COPA 5HGMA 3CCMP 1VQ6P 3DPHA 3G6EP 3WBHA 3HZQA 1YJWP 1EOQA 2JYLA 3VRLC 2QEXP 2XV6A 3CCVP 2OTLP 5JPAA 3CC7P 1KD1Q 2KODA 1PEUA 2PEOA 2Z46A 3MGEA 3B5IA 1VQMP 1QRJA 5BS1A 4WYMA 3CD6P 3DS0A 2PEJA 3CC2P 3CMAP 1VQ8P 1K73Q 2EIAA 1PEQA 2JO0A 3NTEA 1RO0A 2PENA 2Z44A 3CCJP 1VQ5P 4U0BA 1Q86Q 2LF4A 4U0FA 3G1GA 3CCRP 1Q82Q 1NJIQ 2CWOA 2OARA 5HGLA 1RNIA 1VQKP 2E1MA 1K30A 3G71P 3LRYA 3H0DA 2L6EA 2XXMA 5BS2A 1A43A 3CCLP 1YHQP 5HGNA 3CC4P 1BAJA 4U0EA 5I4TG 3DS3A 1M6EX 4XFZA 3CXCO 2XT1A 3OW2O 1K9MQ 2BHVA 1YJ9P 3Q20A 1VQ4P 4M0IA 2M8PA 4XRQA 1KC8Q 3DS5A 4XFXA 5F2KA 3P05A 3G26A 3G29A 1KQSO 2EFJA 1YJNP 3RG6C 1M90Q 1A8OA 1YITP 1Q7YQ 1PEMA 4XROA 3CCSP 2PEKA 3H4EA 1PEOA 1VQ9P 2M8LA 1VQNP 4COCA 1S72P 5F2OA 1Q81Q 1AUMA 2ONTA 2OTJP 2BUOA 2JYGA 5DCKA 3I56P 1JJ2O 4PH1A 1IUQA 1E6JP 3CCQP 1N8RQ 3CMEP 2PEIA 4U0DA 1RO2A 4IPYA 2EG5A 2M8NA 3CCEP 3G1IA 1ZMBA 4XFYA 3CCUP 4U0CA 3G4SP 3G28A 3DTJA 1VQLP 1EIAA 2QA4P 1D1DA 2BQ1E 4U0AA 2Z45A 1VQOP 2DGYA 2P9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS P;  2OTL P;  1VQ9 P;  1VQN P;  3CC7 P;  1KD1 Q;  1S72 P;  1Q81 Q;  1QVG O;  3I55 P;  1VQM P;  1QVF O;  1VQP P;  3CXC O;  2OTJ P;  3OW2 O;  1K9M Q;  1YJ9 P;  3CD6 P;  1YI2 P;  1M1K Q;  3I56 P;  1JJ2 O;  1VQ4 P;  1N8R Q;  3CCQ P;  3CC2 P;  3CMA P;  1W2B O;  3CME P;  1VQ8 P;  1YHQ P;  1KC8 Q;  1K73 Q;  1K8A Q;  1VQ7 P;  3CPW O;  1YIJ P;  3CCE P;  3CCJ P;  1VQ5 P;  1KQS O;  1Q86 Q;  3CCM P;  1VQO P;  1Q82 Q;  3CCR P;  1NJI Q;  1VQK P;  1VQ6 P;  3G6E P;  3G4S P;  1YJN P;  1M90 Q;  1YJW P;  1VQL P;  2QEX P;  2QA4 P;  1YIT P;  3G71 P;  3CCL P;  1Q7Y Q;  3CCV P;  3CCU P;  3CC4 P; 
#chains in the Genus database with same CATH topology
 1PZQ A;  2GZG A;  2PEQ A;  1NTM J;  2QJP C;  1N7S B;  1VF5 D;  3G0V A;  3IF4 A;  3L74 D;  1RE3 A;  2JBG A;  2KR5 A;  1KB9 D;  1NO4 A;  5KAF H;  4GT1 A;  2WPQ A;  4BPH A;  2K0X A;  3L75 G;  3VP9 A;  2ZFC A;  1NTZ D;  1BGY G;  1U57 A;  2E42 A;  1NQ4 A;  4YTP C;  1IK7 A;  2JWD A;  2E75 B;  3MTU E;  1AQ5 A;  2O1K A;  2JO0 A;  4Y99 B;  5KAF E;  1JEK A;  2IYO A;  5HGL A;  1GW3 A;  2L6E A;  3H1L G;  3O6Q A;  2H88 C;  4DOJ A;  1RF1 C;  1NGM B;  1FDM A;  1BE3 D;  2FFD A;  4JPZ B;  1ZRT D;  2KS1 A;  4MRT C;  2AEJ A;  1P84 D;  1ZXG A;  3HD7 D;  2C0W A;  1OVV A;  4IFM A;  2FVA A;  3S4R A;  2WVR A;  1HTL C;  3RK2 B;  2KW2 A;  1KOR A;  4XE5 B;  1EDL A;  2KXP B;  1VQN P;  1FDO A;  3RK3 C;  2M8R A;  1MZ8 A;  2ONT A;  3L75 E;  1URQ B;  1WT6 A;  2XU6 A;  3H6P A;  2AFE A;  1N8R Q;  4JF7 A;  1KIL D;  3BCC D;  1DNY A;  5KLI B;  4H2W C;  3TYY A;  3G4S P;  1D1D A;  2IZ1 A;  3HUS C;  3G71 P;  3GKL C;  1M6N A;  1KQL A;  2E75 C;  5APQ A;  2B87 A;  1HVV A;  1FOS F;  4PJ0 H;  1M1K Q;  1NTZ G;  3EFF K;  1W2B O;  3LMO A;  2FYU K;  4NEO A;  4PWV B;  5HGM A;  4UB6 H;  1IMQ A;  3L73 D;  1LT9 C;  2ZYG A;  3G3Z A;  2XV6 A;  1PPJ D;  1PFI A;  3CWB D;  2L9F A;  1BE3 G;  3H1I G;  5H2F H;  1JY3 O;  4W7Y A;  2FHS C;  3BAT A;  5CMZ A;  1HGV A;  5CCH D;  1K73 Q;  4C7N A;  2PFX A;  4OGQ D;  4EDF A;  2KSJ A;  3UIA A;  2CWO A;  1D7M A;  1N86 A;  1XTG B;  2LML A;  3CCL P;  1BCC J;  3U43 A;  1RQV A;  3L71 E;  2GDY A;  3RK3 B;  3LW5 H;  3TNU A;  3EJE A;  3EWK A;  1HWT C;  3H1L J;  2NPS D;  4NPF X;  1S9K E;  3ITK A;  1SQQ E;  3G26 A;  2IYP A;  2E5Y A;  1W5C E;  2QJK B;  1J1E C;  1R5S A;  1GPJ A;  1YQ4 C;  1OW8 A;  1E0H A;  1S72 P;  1IK9 A;  2WSF H;  2KNC A;  1R8E A;  3CX5 I;  4ZKP A;  3CWB J;  1X9V A;  1CI6 B;  1SS1 A;  5KAI E;  1JCD A;  3QWO C;  2KOS A;  4XFY A;  1Y47 A;  1URQ A;  1L0L K;  1S5L H;  1L0N E;  3ZDM A;  3DTJ A;  4EOT A;  1ZNV A;  2K3R A;  2KYV A;  3CX5 H;  1PV3 A;  2K37 A;  3GZM A;  1KN7 A;  4UHP B;  2HG5 D;  1L0N K;  2KG9 A;  3S9O A;  5AVQ B;  1EQ7 A;  3H1K J;  1H89 A;  2R3S A;  3SWK A;  2P7J A;  1NTM D;  4D6T J;  1NVO A;  1NAF A;  4H0L C;  3TSI A;  1EDK A;  1KYO I;  5AVR B;  4U3F D;  4H2X C;  2Z46 A;  1L0L J;  1VQM P;  2MY5 A;  1SQB E;  3CD6 P;  4JYC A;  4Z1M H;  2AEM A;  3CWB E;  2B89 A;  1PEQ A;  3NTE A;  1RO0 A;  3H1I D;  2ZVO B;  3G1G A;  1KFN A;  2XZ1 C;  2VLP A;  1L0N J;  2YKP A;  2CPB A;  5HGN A;  2J5U A;  3A7O A;  2WSC J;  4OGQ B;  1VL2 A;  3HRN A;  1DD3 A;  1A02 J;  1AVY A;  2XKM A;  1FC2 C;  1G2C A;  1PP9 E;  2K93 A;  2Q7C A;  4C7R A;  1ZME C;  1N7S A;  2Q3I A;  5EFW B;  4F37 A;  4GDO A;  1QX8 A;  2KOQ A;  3GMA A;  1NAY A;  3CXH E;  1Q81 Q;  2OYI A;  3VTP C;  1FBM A;  4N78 D;  3KZI E;  1VDF A;  2Z4E A;  1X8Y A;  2W83 C;  1M8O B;  4U0D A;  2WSF J;  3JSV C;  4OGQ C;  3TGU G;  2O01 H;  3WUU A;  3A2A A;  2QJY B;  1EIA A;  2GM4 A;  1CI6 A;  4H13 D;  1FZC C;  2DGY A;  1YJ9 P;  1JY3 N;  1RQU A;  2YIU C;  2N9Y B;  2Q1K A;  2NPS A;  1JY3 P;  1M74 A;  2CGQ A;  1YI2 P;  2KSE A;  2LTE A;  1K8A Q;  4PH0 A;  2ITA A;  1OR5 A;  1VQ6 P;  3WBH A;  1NH4 A;  3BCC E;  2H8P D;  1HJB A;  1P84 E;  3OAK A;  1FAV A;  2B9B A;  2BCC J;  2KOO A;  2MR7 A;  4R0M A;  3P7K A;  3SWF A;  2PEO A;  3RGU A;  1SFC C;  2K9J B;  3AED C;  1EDI A;  2IBZ I;  3MZW B;  5M1B A;  4TLF A;  2EIA A;  1UJZ A;  3H1H J;  3H1H D;  5KP7 B;  2WMM A;  2Y0D A;  1SQX K;  3IAO A;  3L75 D;  2XXM A;  3Q5P A;  3A0H H;  2M3B A;  2FVF A;  2K92 A;  3LID A;  3TGU E;  1GU4 A;  1GD2 E;  2VRS A;  3U1C A;  3V4Q A;  1URQ D;  2QM8 A;  4UB8 E;  4M0I A;  2LR2 A;  3H1K D;  1HJ0 A;  4XFX A;  1M57 D;  4PV1 B;  3KDP B;  1LTG C;  2EFJ A;  3V6I A;  2YKQ A;  1LP1 A;  1Q7Y Q;  1PEM A;  1S1C X;  4COC A;  4EYY Q;  1KB9 I;  4HKZ H;  3V2N A;  3H1J J;  5AW6 B;  1RO2 A;  3B4S A;  1JMM A;  1KQF B;  3G9R A;  1ZMB A;  1URQ C;  1MKM A;  1LWU B;  1GK6 A;  2IBZ G;  5KJ7 D;  2BAS A;  4RJT A;  2OYI C;  4K3A A;  1FZB A;  3H1K E;  2A06 E;  4IL6 E;  3BAS A;  2B88 A;  4WY4 B;  3KYQ A;  3RL0 B;  1BGY E;  4I6M C;  3CPW O;  2PEM A;  4BWN A;  1FJK A;  3C9I A;  2XV5 A;  3PHL A;  3H1K G;  2AEF A;  3OA7 A;  1YJW P;  1EDJ A;  1LT1 A;  2QEX P;  4H0L B;  1IFM A;  5BU5 A;  2R5B A;  2L91 A;  1PPJ G;  3P8M C;  5AW9 B;  3KPE A;  3WU2 H;  3DS0 A;  1IFD A;  1K04 A;  1L2P A;  2QSI A;  2NRG A;  1DEE G;  1N7S D;  1VF5 B;  4GOF A;  5CHX A;  5AW3 B;  3MUD C;  2N1T D;  5AW7 B;  2FQ0 A;  1L4A A;  1VQ5 P;  1Q86 Q;  3H1I E;  2W27 A;  2R3C A;  4MN4 C;  3H1H E;  3OJA B;  1YHQ P;  5KKZ B;  2Z5I A;  4IL6 X;  4XFZ A;  1DX7 A;  4L74 A;  2BEQ D;  4BRY A;  3NFQ A;  3SFE C;  2M5A A;  1KYO D;  2FY8 A;  2KS1 B;  3N4X A;  2GZJ A;  1SQQ G;  1DV5 A;  1JY2 N;  1NU1 D;  3BVH A;  2W90 A;  1EZV E;  2OTJ P;  3HTK A;  5TIS H;  5DCK A;  1JJ2 O;  2YXQ B;  3D70 A;  5KKZ C;  3RBX A;  4PD4 D;  1RF1 B;  2JEE A;  2MF4 A;  3MHV A;  4L75 A;  3U1A A;  1SP4 A;  4DJG A;  3GHG C;  1GK4 A;  1YTZ I;  1JTH A;  3NXS A;  2E76 B;  2EHT A;  3T97 B;  1FS0 E;  1N73 A;  1AV1 A;  2KIK A;  3DS2 A;  2RH0 A;  4WWI A;  3ABV C;  3L75 J;  1JMB A;  2OYH A;  3VN0 A;  1VF5 C;  4A7P A;  3DS4 A;  3PJS K;  2I8D A;  5KJ7 C;  4H13 B;  3HZQ A;  3H32 A;  3A0B H;  3MIW A;  2Y0E A;  2JU1 A;  2JKV A;  4U3F G;  2NPS C;  5B5E H;  2LIU A;  2ZXX A;  3L71 D;  3HUS B;  1KIL A;  2KG8 A;  2AFD A;  3AE4 C;  1Q82 Q;  1VQK P;  2KGA A;  1K30 A;  3VMA A;  3H0D A;  1KFM A;  1PGQ A;  2WT7 A;  2K94 A;  1SQX J;  3O6Q B;  1SQB D;  1Y9B A;  3M9H A;  3Q20 A;  3AEF C;  2HR3 A;  2K9J A;  2E76 D;  2IFM A;  2ZT9 C;  3L71 J;  4PXH B;  3LIE A;  4CA3 A;  1MUU A;  1BDC A;  3RG6 C;  3FXE A;  4WY4 C;  5APV A;  1FE6 A;  2L5G B;  1XTC C;  1L0N D;  2DW3 A;  5CBN A;  2Z5H A;  1AFO A;  3F5H A;  3M06 A;  2MR8 A;  5B66 H;  2JU2 A;  2QM7 A;  1G2C B;  5AVW B;  5AW8 B;  3VOP A;  1PP9 D;  2L4B A;  1L0L D;  4H0L D;  2CG5 B;  3PP5 A;  1P84 H;  4U3F J;  1Y8A A;  1G1I A;  5KLV G;  1F80 D;  2A45 H;  5KTB A;  1RE4 C;  1J1D C;  1WMK A;  2HOD B;  1QVG O;  2N1T A;  4D6T G;  1ZW0 A;  4WBA A;  4QNB A;  1UIX A;  1BXI A;  1S3J A;  3GLM A;  2H89 C;  2CPS A;  3CI9 A;  2AF8 A;  3E1I A;  5AW2 B;  2N5H A;  2JYL A;  2RKL A;  1IFN A;  3V2P A;  4LLH A;  3VMZ A;  4WYM A;  3NY7 B;  1NTM E;  2MVV A;  4RKU J;  1H0T A;  3L71 G;  3VMY A;  2C9N Y;  1CW5 A;  1ZLL A;  1SQP E;  2LF4 A;  3C1L A;  5GTI H;  1SQB G;  2E43 A;  1ZOY C;  2JDI H;  2XDJ A;  3WU2 E;  1UII A;  5H2F E;  1OWA A;  1UNK A;  3MGN A;  3AE2 C;  1SQP K;  2Q9I A;  2O3J A;  2K5X A;  4L73 A;  4W80 A;  3RL0 D;  5KLV E;  2WT7 B;  4XRQ A;  2WTY A;  1PPJ E;  4HH2 A;  1KIL C;  1LTT C;  1IFJ A;  3H1L D;  4I2L C;  3EFG A;  4IFF A;  2JB0 A;  1KYO H;  1J1D B;  2R32 A;  3TGU D;  1PIX A;  1N7L A;  5F2O A;  2Y0C A;  3HTK B;  2GZF A;  4H2Y C;  1GXG A;  1FZG A;  3FGA D;  1L0H A;  4PH1 A;  2I1K A;  2BCC G;  3C8V A;  1HH0 A;  2JWA A;  2CQ8 A;  1PGO A;  2FKW B;  2XNX A;  3G1I A;  5GTH H;  2AVA A;  3GHG B;  3L35 A;  2O01 N;  2OYI B;  1HY8 A;  2PAJ A;  3L37 A;  2QA4 P;  2E74 C;  2FAE A;  3L70 J;  1EXJ A;  1BCC D;  3G21 A;  4HYT B;  3I55 P;  1SFC D;  1VQP P;  1HUC A;  3RG2 A;  5F2N A;  2N5I A;  3E2D A;  1T2K D;  5KLV J;  1FJP A;  1YIJ P;  1HQB A;  4BPF A;  3CCM P;  4EI2 A;  3G6E P;  3GJN A;  1T3U A;  1QLE D;  1OW6 A;  1N73 C;  2KOD A;  1BDD A;  1JNM A;  2HPC A;  2E74 D;  1RH5 B;  2FAD A;  2MD9 A;  2Q3E A;  3CXH H;  1JOC A;  1LGH B;  1QGK B;  4IFD K;  1T2K C;  2E1M A;  1NTZ E;  1SQP J;  5AVT B;  3B5N B;  2IDB A;  5I4T G;  1YQ3 C;  1K9M Q;  3PH0 A;  3CXH I;  2WWW A;  1M56 D;  3L74 E;  2NO8 A;  1SQV D;  1N73 B;  1X79 B;  3M9B A;  2HFE D;  1NHL A;  3P8C E;  2WZ7 A;  2M5R A;  3L74 G;  1GL2 B;  2O01 J;  1JO5 A;  1LTA C;  1EMV A;  1RF1 A;  5EW5 E;  3NTN A;  1AUM A;  3I5C A;  2HPC B;  2BUO A;  2JYG A;  2KZJ A;  2AXC A;  3AE3 C;  1S4X A;  3JCU E;  1SQV J;  2OYH C;  2D2C C;  3JC2 2;  2WSS H;  1NTK J;  1GDT A;  2HOD A;  4YXW H;  1N7S C;  4WVZ A;  3RL0 C;  4IL6 H;  1JUN A;  2ERH A;  2LXC B;  2GDW A;  3GZL A;  1AA0 A;  4TT3 H;  3TNU B;  3EJD A;  2X2B A;  1S5L X;  4ASW A;  4COP A;  2P58 A;  2IPP A;  2KUB A;  4Y28 J;  2A45 G;  1EC5 A;  4AQR D;  1SQX E;  2FYN C;  4UB8 H;  4WY4 A;  5JPA A;  3CC7 P;  1MFT A;  1S2E A;  3MGE A;  3B5I A;  3D6Y A;  1DIP A;  2KGE A;  3CC2 P;  1NTK K;  3L72 D;  1SQV G;  4AUW A;  3RL0 g;  2PEN A;  5DJU B;  2G3A A;  4OH8 B;  5AVZ B;  2NZ2 A;  1RE4 A;  1LTB C;  3IFM A;  2YO2 A;  3FWN A;  2VLO A;  3Q5R A;  3H1J E;  3U59 A;  1LTS C;  3H1H G;  2W6B A;  2LXB A;  2POH A;  2GUS A;  1BCC G;  1NKZ B;  2FQ2 A;  2YIU B;  3G29 A;  2YMK A;  1EZV D;  1R5L A;  2OQQ A;  2FFD B;  1YJN P;  1AQT A;  1IO4 A;  2QE7 H;  1SFC A;  3WUV A;  1WRG A;  2PEK A;  2YMY A;  5TIS E;  3CCQ P;  4BPG A;  2GUV A;  3CME P;  1SQV K;  2XZR A;  1L4A D;  2KG6 A;  1HF9 A;  1IMP A;  3G28 A;  2N9B A;  3H1J D;  4U0A A;  1FR2 A;  4PD4 E;  1SQV E;  2FFD C;  2FXO A;  1H8A A;  1Q2N A;  1IFI A;  3L73 E;  1T6A A;  2KOR A;  2K0Y A;  2GZE A;  4DG9 A;  1GXH A;  3DPH A;  2QG4 A;  3RK3 D;  1EOQ A;  1IFP A;  1LNQ A;  4NPE A;  3CCV P;  2WSE H;  4JYB A;  2N1T B;  1GTW A;  2IZ0 A;  3MP7 B;  2FAC A;  1CEI A;  2I1J A;  2V7Q J;  5KJ7 A;  2QJP B;  3SFD C;  1GZL A;  3LW5 J;  3A3Y B;  1VQ8 P;  1PGP A;  2UWJ E;  4JBZ A;  5CCG A;  1OIP A;  1RNI A;  1S9K D;  1A43 A;  1RE3 C;  3AE6 C;  4ZKU A;  1QEX A;  3BCC J;  3DS3 A;  1PL5 A;  4N3Y B;  3GHG A;  1EZV I;  2M8P A;  3EQ2 A;  2NPS B;  2IBZ E;  2SPZ A;  5AVS B;  5CCH A;  4QKO A;  2IX7 C;  2FYU G;  1YIT P;  2N6Z A;  3H4E A;  2RMZ A;  5KP6 B;  2ZYD A;  5KLI C;  4RES B;  2GZI A;  1K05 A;  4OVN F;  3A0B E;  5KLV D;  3RBZ A;  4IPY A;  5B5E E;  1BE3 E;  1YTZ T;  4QMA A;  3VYI A;  1M1J A;  2FQ1 A;  1EXI A;  3CXH D;  1IC2 A;  1SVF A;  2BEZ F;  1FZC B;  1LT9 B;  1MZ9 A;  4UB6 E;  2PY8 A;  5AW4 B;  4GR2 A;  1NTZ J;  1OMI A;  1USE A;  3TGU J;  2XZ0 D;  1BCC E;  3L74 J;  1AF8 A;  2R5D A;  1QRJ A;  5E79 H;  1KV4 A;  1LP1 B;  1LJ2 A;  2P2U A;  2WSC H;  3CMA P;  3T97 A;  2Z44 A;  3CCJ P;  1FZE A;  3RK2 D;  1VKU A;  4U7J A;  1M7L A;  5BS2 A;  3B5N D;  2OGU A;  3KHU A;  1NKN A;  2A45 I;  1JM0 A;  1SQX G;  4PJ0 E;  2OTK E;  1KC8 Q;  3VMX A;  1KZU B;  5F2K A;  1CSB A;  1RHZ B;  2E76 C;  4BRY B;  1KQS O;  1USD A;  1E79 H;  2YXR B;  2AXT E;  3H1I J;  1KMI Z;  4XRO A;  5APY A;  1KB9 H;  4PV1 C;  2QIW A;  4M3L A;  3V2Q A;  1Z6M A;  4OWF A;  3I56 P;  3H1L E;  4W7Z A;  1NYH A;  1S5L E;  1MFZ A;  2WPV B;  2N1T C;  2KNC B;  2K0D X;  4D6T E;  2D2C D;  3QH9 A;  2PRR A;  3WMM 0;  2BQ1 E;  2Z45 A;  3M0D C;  3VP8 A;  3E1R A;  3L70 G;  1L4A B;  4R4M A;  3TK1 A;  3DS1 A;  3AE1 C;  3V5B A;  2GDX A;  2KOP A;  3FXD A;  3MUD A;  2JGP A;  1DEB A;  3P32 A;  3TDK A;  2HLO A;  4WB4 A;  2Y9Z A;  3B8E B;  4YXD C;  4LC1 A;  2KZI A;  1KD1 Q;  1LTJ C;  2FYN B;  3AE5 C;  1NTK G;  2JJL A;  3D6Z A;  1SQQ J;  1RF0 C;  2B87 B;  3N7N A;  2CNR A;  4C7N B;  2N6Y A;  1QL2 A;  4U0F A;  1SQX D;  2A06 G;  2QNW A;  3LRY A;  3IN6 A;  2KK7 A;  3SSU A;  2KP8 A;  3CC4 P;  1FZC A;  1BAJ A;  3M91 A;  1YBK A;  3CX5 E;  1LTJ A;  3OW2 O;  1Z56 A;  1L0L E;  1VQ4 P;  5CCH C;  2FYU D;  1H88 A;  4KHX A;  3R4Y A;  4U3F E;  3L72 G;  2H43 A;  1GL2 D;  5KLV K;  1T3J A;  1NU1 E;  4NPD A;  2Q5U A;  2VLQ A;  3AE8 C;  2N50 A;  3PTZ A;  2N98 A;  3FX0 A;  2HYN A;  5CBO A;  1VQ9 P;  4H44 D;  3TF5 A;  1JCC A;  5HV8 A;  2L22 A;  2L0Q A;  4GOE A;  1NU1 K;  1LT9 A;  2OYO A;  2JP3 A;  4ASV A;  3Q3D A;  3MD0 A;  1U7J A;  1GU5 A;  2E5T A;  2VSQ A;  3JCU H;  2O1J A;  3CLQ A;  2JQ4 A;  1IZN B;  1KYO E;  2V4H A;  4R4L A;  3H25 A;  1ZV8 A;  3H47 A;  5AVY B;  2FYU E;  2KGC A;  3M1M A;  1OXZ A;  3L70 D;  3P8C D;  1VPC A;  1AVO A;  1J2J B;  1NU1 J;  1NTZ K;  2OTL P;  2MJZ A;  1FZF A;  3L4F A;  1KIL B;  4O9B A;  2QVA A;  1PP9 J;  3KZI H;  1LTI C;  1JY2 P;  3GG2 A;  3RK2 C;  1NTK D;  2FBW C;  5APW A;  3PRJ A;  4Y99 C;  1NJI Q;  2W6A A;  3R2P A;  5TJH A;  2Q6Q A;  1KLP A;  1FOS E;  2WPR A;  3L72 E;  3HD7 B;  2C9L Y;  2XT1 A;  4XFJ A;  2A06 D;  2ROQ A;  3AE7 C;  1CZQ A;  2FYU J;  2E74 B;  3B4Q A;  4K35 A;  3DS5 A;  1NTM K;  3Q2Y A;  2KOG A;  5AW5 B;  3CCS P;  4GIF A;  1PEO A;  3GF3 A;  2C0X A;  1NWQ A;  3WUT A;  3BCC G;  3L36 A;  3B71 A;  2FYZ A;  4XA4 A;  1BGY J;  1ACP A;  1SQQ D;  5APT A;  1LWU C;  1SQQ K;  5CJ0 A;  3A5T A;  3CCE P;  3HD7 C;  5C39 A;  3PLN A;  1FDI A;  1P84 I;  4H44 C;  2ZJS E;  5CZD B;  2PGD A;  1VQL P;  2K88 A;  2YNY A;  5AVU B;  3CL3 D;  4PD4 H;  3H32 B;  4HJG H;  2H7H A;  1VQ7 P;  1GL2 A;  3HYB A;  1ZR4 A;  2LKI A;  4GR6 A;  2LL8 A;  3AEE C;  3F89 A;  4C46 A;  1FU1 A;  4H13 C;  3K5B A;  2WPS A;  2D2C B;  2XND H;  1G1J A;  2FVE A;  1SQB K;  3HE4 A;  3AE9 C;  3L73 J;  4WY4 D;  2E75 D;  5KP8 B;  1VHN A;  2J58 A;  5GTH E;  2G8Y A;  3AEC C;  5AVV B;  3HE5 B;  3CCR P;  2ZYA A;  3O8Z A;  2GA1 A;  1X0T A;  5APS A;  2P67 A;  1JTH B;  5GTI E;  1E5W A;  5CJ4 A;  1KB9 E;  4U0E A;  4DT0 A;  1SQP G;  2JAZ A;  2BHV A;  4D6T D;  2J59 M;  1A02 F;  2WIT A;  1PGJ A;  3RK3 E;  2MKV A;  1Q90 D;  3M9Q A;  3Q1M A;  3P05 A;  4L76 A;  1ZP0 C;  2LPK A;  3M0A A;  4LGD E;  1A8O A;  4PV1 D;  1OVU A;  1PP9 G;  2M8L A;  3HE4 B;  5HVC A;  4DCK A;  1KQG B;  1OZH A;  2DNW A;  3BRV B;  4PD4 I;  3BRT B;  2IBZ D;  5APX A;  1IUQ A;  4BXL A;  2P1J A;  4I7Z B;  2WSE J;  1FZA A;  3E7K A;  1ZRT E;  3L73 G;  1DH3 A;  1SLQ A;  2YO3 A;  2EHS A;  2M3E A;  2LKM A;  1MV8 A;  3CCU P;  1JY2 O;  2KLU A;  5DJT B;  5AW0 B;  1ZN5 A;  5BU8 B;  2Y9Y A;  1GW4 A;  2V7Q H;  3L70 E;  3CE7 A;  3H1J G;  1LTJ B;  4GOD A;  4IOI H;  2M0B A;  3VRL C;  2KGD A;  3Q5S A;  3CWB G;  1T8K A;  2QRX A;  1PEU A;  1QL1 A;  2KWL A;  1SQP D;  4N6J A;  2KLV A;  5CCG C;  1M1J C;  2PEJ A;  2PNG A;  5E79 E;  2IFN A;  1TU3 F;  1OW7 A;  2RN0 A;  2OAR A;  1OX3 A;  5BVZ A;  3L72 J;  1J1E B;  2FXM A;  2ZAE B;  3AEA C;  2P10 A;  2KI7 B;  2ZT9 B;  1L0I A;  2YKO A;  4CPG A;  5K5G B;  2ZVN B;  2FXP A;  1X22 A;  3NMD A;  1LWU A;  1GL2 C;  4KT0 J;  1X3O A;  4JQ0 D;  4N78 E;  2WQY C;  4EIJ A;  1NTK E;  1M90 Q;  3SWY A;  1OFC X;  5CCG D;  1DD4 A;  2W8Z A;  1W2E A;  2ZXE B;  4IZ6 A;  4B86 A;  1SQB J;  3HE5 A;  3AEB C;  4ZMD A;  3II6 A;  2PEI A;  4ZNC A;  3V4W A;  2EG5 A;  5AW1 B;  2PP6 A;  4H44 B;  3V2R A;  2LIW A;  3GW6 A;  2LOL A;  1NTM G;  2BCC D;  2M5A B;  1VQO P;  3B5N A;  2P9X A;  1L4A C;  5HGO A;  1BE3 J;  1QVF O;  1NU1 G;  1M1J B;  2VLN A;  4GKG A;  1OVR A;  2ZT9 D;  2JR8 A;  1IJD B;  3HD7 A;  2CK3 H;  5KAI H;  1HBW A;  1BSN A;  1EZV G;  5AVX B;  1NOH A;  1N2D C;  1RF0 A;  1YYC A;  3W67 A;  1GMJ A;  1KTM A;  5BS1 A;  2AXT H;  1T8Z A;  4I1L A;  4YPC A;  1SFC B;  3S1K A;  5B66 E;  4AYC A;  1RY3 A;  4U0B A;  2MVU A;  2K2Q A;  3D71 A;  3IR9 A;  3A0H E;  3FWL A;  4KJM A;  2W6J H;  1JB0 J;  2KB7 P;  3B5N C;  2K9Y A;  4I7Z C;  5L8R J;  1M6E X;  3CXC O;  1L0N G;  2WPT A;  5EJD A;  3USS A;  4RO0 A;  3KXD A;  1U7M A;  1HGZ A;  2QJY C;  3AEG C;  3GF7 A;  2QJK C;  1L0L G;  3KQG A;  2BCC E;  1H0T B;  2GYK A;  3M0D A;  1KIL E;  5APU A;  4HKG A;  3EJB A;  3W68 A;  1E6J P;  2JO1 A;  1BSH A;  2K1A A;  2M8N A;  1AYI A;  2R44 A;  4U0C A;  1ZR2 A;  1AJY A;  7CEI A;  1BGY D;  3HUS A;  4HB1 A;  2OYH B;  3CX5 D;  4DZO A; 
#chains in the Genus database with same CATH homology
 5HGO A;  2PEQ A;  1M6N A;  1M74 A;  1QVG O;  3G21 A;  3DS2 A;  3I55 P;  3H47 A;  1QVF O;  1VQP P;  3DS1 A;  3G0V A;  5F2N A;  1YI2 P;  1M1K Q;  3E2D A;  4QNB A;  1W2B O;  3M1M A;  2PY8 A;  3DS4 A;  1K8A Q;  3CPW O;  3HYB A;  1YIJ P;  1VQ7 P;  2PEM A;  4GR2 A;  4PH0 A;  4GR6 A;  4COP A;  5HGM A;  3CCM P;  1VQ6 P;  3DPH A;  3G6E P;  3WBH A;  3HZQ A;  1YJW P;  1EOQ A;  2JYL A;  3VRL C;  2QEX P;  2XV6 A;  3CCV P;  2OTL P;  5JPA A;  3CC7 P;  1KD1 Q;  2KOD A;  1PEU A;  2PEO A;  2Z46 A;  3MGE A;  3B5I A;  1VQM P;  1QRJ A;  5BS1 A;  4WYM A;  3CD6 P;  3DS0 A;  2PEJ A;  3CC2 P;  3CMA P;  1VQ8 P;  1K73 Q;  2EIA A;  1PEQ A;  2JO0 A;  3NTE A;  1RO0 A;  2PEN A;  2Z44 A;  3CCJ P;  1VQ5 P;  4U0B A;  1Q86 Q;  2LF4 A;  4U0F A;  3G1G A;  3CCR P;  1Q82 Q;  1NJI Q;  2CWO A;  2OAR A;  5HGL A;  1RNI A;  1VQK P;  2E1M A;  1K30 A;  3G71 P;  3LRY A;  3H0D A;  2L6E A;  2XXM A;  5BS2 A;  1A43 A;  3CCL P;  1YHQ P;  5HGN A;  3CC4 P;  1BAJ A;  4U0E A;  5I4T G;  3DS3 A;  1M6E X;  4XFZ A;  3CXC O;  2XT1 A;  3OW2 O;  1K9M Q;  2BHV A;  1YJ9 P;  3Q20 A;  1VQ4 P;  4M0I A;  2M8P A;  4XRQ A;  1KC8 Q;  3DS5 A;  4XFX A;  5F2K A;  3P05 A;  3G26 A;  3G29 A;  1KQS O;  2EFJ A;  1YJN P;  3RG6 C;  1M90 Q;  1A8O A;  1YIT P;  1Q7Y Q;  1PEM A;  4XRO A;  3CCS P;  2PEK A;  3H4E A;  1PEO A;  1VQ9 P;  2M8L A;  1VQN P;  4COC A;  1S72 P;  5F2O A;  1Q81 Q;  1AUM A;  2ONT A;  2OTJ P;  2BUO A;  2JYG A;  5DCK A;  3I56 P;  1JJ2 O;  4PH1 A;  1IUQ A;  1E6J P;  3CCQ P;  1N8R Q;  3CME P;  2PEI A;  4U0D A;  1RO2 A;  4IPY A;  2EG5 A;  2M8N A;  3CCE P;  3G1I A;  1ZMB A;  4XFY A;  3CCU P;  4U0C A;  3G4S P;  3G28 A;  3DTJ A;  1VQL P;  1EIA A;  2QA4 P;  1D1D A;  2BQ1 E;  4U0A A;  2Z45 A;  1VQO P;  2DGY A;  2P9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...