3CCVP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ccvP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ccvP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ccvP02
1N8RQ 3G4SP 1K8AQ 1VQ4P 1Q86Q 3CD6P 3CCRP 2OTJP 3CCQP 1VQNP 1VQMP 3CCJP 1YITP 1KC8Q 2QA4P 1VQ7P 3CCEP 2OTLP 1YHQP 1W2BO 3CMAP 3G6EP 3G71P 3I56P 1Q7YQ 3OW2O 1VQOP 1S72P 1VQ9P 3CC7P 3CPWO 3CCVP 1YIJP 1K73Q 1Q81Q 1KD1Q 1JJ2O 1VQKP 1YJWP 1NJIQ 3I55P 3CCLP 1QVFO 2QEXP 1YI2P 1VQPP 1VQLP 1K9MQ 3CC4P 1VQ5P 3CXCO 1Q82Q 1KQSO 1VQ6P 3CCMP 3CCSP 1QVGO 3CMEP 1YJ9P 3CCUP 1VQ8P 3CC2P 1YJNP 1M1KQ 1M90Q
chains in the Genus database with same CATH superfamily
4RJTA 1JNMA 2LKMA 3N7NA 1OVVA 3M9HA 1USEA 4WB4A 3CCQP 3QH9A 1JMBA 2JQ4A 1VPCA 4GKGA 3KPEA 4R0MA 3L72D 2KOPA 3E1RA 1SQXJ 2I1JA 2PFXA 2N50A 1SVFA 2QNWA 3F89A 2X2BA 4HKGA 2W83C 1VQ9P 1EXJA 1UIXA 2WSFH 3M91A 1DD3A 1P84I 3S4RA 3M06A 2LMLA 1PEUA 1IK7A 4O9BA 1GL2C 3DS5A 2C9LY 1LTJA 5AVUB 2AXCA 2W27A 3GMAA 2KNCA 2KGAA 2CG5B 1JY3P 1QRJA 1NU1J 1PEQA 4I2LC 1MV8A 1HVVA 2PEIA 2LTEA 3M0DA 1AJYA 2M3BA 1CI6B 1KILE 2OYIC 5HV8A 2GA1A 2ZYDA 2JB0A 1NH4A 1PIXA 2JBGA 2A45H 1DIPA 4RO0A 3AEDC 2FACA 3AE1C 2YIUB 1J1EC 1KYOI 4YTPC 3MP7B 1MZ8A 1KILD 1L0ND 2A06D 2Q6QA 5H2FH 1JTHA 2OTKE 2WMMA 2WZ7A 1YHQP 1H0TA 3NXSA 3C9IA 3W67A 1DX7A 1IFJA 1SQPG 1OIPA 5KLIB 1OW6A 1PV3A 3B5NB 1KV4A 1NAFA 1PFIA 5DJUB 3EQ2A 3JCUE 5B5EH 1BCCE 1LTJC 3NFQA 2MJZA 3DPHA 1E5WA 1NU1K 5CZDB 5C39A 5CCHA 2FHSC 5KP6B 1SQVE 1N73C 4BPHA 2V7QJ 1MFTA 4GR2A 3RL0C 1AFOA 3L73J 2YKPA 1YJ9P 4EOTA 3O6QB 2E42A 1FZAA 2B88A 2KR5A 1X9VA 3KXDA 1BSNA 4IFMA 1A02J 4U0FA 2JKVA 1GU5A 3L37A 3CMAP 2B87B 3A3YB 2GDXA 2R5DA 3H1JD 3RBZA 2ZVNB 2IZ1A 1QL2A 3CCUP 3V2RA 1KQLA 2Y0DA 1RE3C 5KAIH 5CJ4A 5KLVE 1URQC 2AFDA 2BEQD 4IL6X 1PEOA 3PJSK 1YTZT 1T8KA 2FQ2A 3RL0B 5AW2B 3S1KA 4KT0J 2HODA 1HY8A 3H1JE 4H0LC 4AUWA 2RKLA 3H25A 2I8DA 1PGPA 1UNKA 4PXHB 5AW9B 4PWVB 2VSQA 1N7SB 2YNYA 1LT9C 4IFFA 4D6TE 1EIAA 3H1LD 3GZLA 1S5LX 3KZIH 2NPSA 2KOGA 4EIJA 4U0AA 2VLOA 2PENA 3LIEA 1WMKA 1YI2P 1X8YA 3L74G 1ZLLA 2LF4A 1L0NG 2XNDH 3FWNA 2Q1KA 1G2CB 2Q5UA 1IMPA 4U3FE 3L71J 1L0HA 1MKMA 4DT0A 3PLNA 1XTGB 2CWOA 1Q81Q 2YO3A 1JTHB 1PP9E 3VMXA 1T6AA 2KYVA 1VF5D 3DTJA 5KTBA 3WBHA 3L72G 2Q7CA 2PP6A 1SFCB 1J2JB 1Q2NA 4BPGA 1IJDB 3L70D 4XE5B 3FGAD 5APQA 3MHVA 2D2CC 2QA4P 2H43A 1NTMK 1Y8AA 3BCCJ 3JSVC 1K9MQ 1SQBG 3CXHI 1FU1A 2Z46A 2AFEA 1NTZK 3AEFC 2PEOA 1FZFA 4U3FD 5HGLA 1KC8Q 1HTLC 3S9OA 3T97B 3AECC 3DS3A 2H89C 3HZQA 3G21A 2IYOA 1LWUB 3L75D 4OGQD 3SWFA 2XU6A 2M8NA 2L91A 2FYUE 1SQVK 1FZCB 2NO8A 4YXWH 2H7HA 3RG6C 3CXHH 3H1KJ 1NTMD 3H1IG 1Z6MA 2HLOA 4GT1A 1FBMA 1BGYE 1SQQE 2BEZF 5BS2A 3I55P 5TISE 1M7LA 1VQPP 4PD4H 1WRGA 2XXMA 3L70G 3G9RA 3GLMA 2E5TA 4COCA 3TK1A 2FKWB 1G2CA 4N78E 2YMYA 3RGUA 4NEOA 2OGUA 4C7RA 3CCJP 4L75A 1NGMB 1VQ7P 2OTLP 2FYUG 3RK2D 4H2XC 2AF8A 1BE3J 5M1BA 1P84E 2KNCB 3IN6A 3LMOA 2WTYA 2MKVA 2A45I 2IX7C 2QVAA 2BCCG 3RL0D 4HJGH 5KLVG 1FJPA 2JWDA 3IR9A 1L4AD 1SQVD 1BDCA 3L75J 1M90Q 4HYTB 1S9KE 2V7QH 1L0LD 3CCRP 1BCCD 3LW5J 3HE4B 4PH0A 2ZT9D 2HR3A 1VF5C 2JO0A 3CCVP 3FXEA 1L0NK 1QX8A 4ASVA 3V2NA 5K5GB 3B5NC 4L74A 1SQBE 2R3CA 2D2CB 2C0XA 4DJGA 1L0NE 4OH8B 2H8PD 2O01N 3AEEC 4H44D 3L70J 1DEBA 3L36A 1ZRTE 4WWIA 4DZOA 1LTBC 4DCKA 1M1JB 2FYNC 4H13C 1MUUA 1RO0A 1AQTA 1NWQA 2IFMA 3EJEA 5BU5A 1JEKA 3M9QA 1JCDA 2OYHC 3L71D 2YKQA 4WY4C 2FYUK 2O3JA 1SQBK 5HGOA 2LR2A 3PTZA 1SQXK 4PV1C 3TSIA 2IDBA 1A8OA 2P58A 1SQPD 1ZP0C 5L8RJ 1JM0A 1NTKK 5KAFE 1NTZE 5CBOA 3H1KG 1HBWA 2E5YA 2JP3A 3CPWO 3HTKA 3AE4C 3EWKA 3WMM0 1LTGC 2QG4A 1LTTC 4JPZB 1S3JA 2WPQA 1X79B 4HB1A 5AVQB 2N9BA 3FX0A 3H1JG 3B8EB 1S5LH 2KGEA 2KP8A 1JY3O 1VQ4P 1X0TA 1FDOA 1KB9E 2ZYAA 1CI6A 2KLVA 5B5EE 3V4QA 5AW3B 1MFZA 3SWYA 3SSUA 3VTPC 5GTIH 1LWUC 3MUDA 2YXRB 1SQPK 3L72E 2KWLA 4F37A 4OGQB 2E74B 1AUMA 5APXA 1HH0A 2QJPC 4BWNA 2BCCE 7CEIA 3Q5RA 1SQQD 1NOHA 3T97A 3WUVA 4BXLA 3G1IA 1FZCC 2EIAA 1L4AA 1NTME 5AW5B 2MVVA 3L73D 3L35A 3P8CD 2K9JB 2XDJA 3NMDA 2BUOA 1FR2A 2VLPA 1JO5A 1IUQA 4GOEA 1GK6A 4I7ZB 1ZN5A 2C0WA 2N1TB 1GL2A 5F2KA 3VRLC 2E74D 1NO4A 1GZLA 1TU3F 1RO2A 1RY3A 4K35A 4PV1D 3H6PA 3VMAA 1E0HA 1BGYG 2W6BA 4ZNCA 3AE6C 2KOSA 3CWBE 2NRGA 2XV5A 1KYOE 3RK3C 3HD7C 3AEAC 4H13D 3D6ZA 1OZHA 2DNWA 2KIKA 1VHNA 3D6YA 1SP4A 1YBKA 5HGMA 2MR7A 1RQVA 2RMZA 2CNRA 3HD7B 2YO2A 2DW3A 4PD4I 3G3ZA 1M1JC 2FYNB 3CL3D 2N1TC 5GTHH 4I7ZC 1QL1A 4N6JA 2KGCA 1L0LE 4XROA 3BASA 1SQXG 1T3JA 2K92A 2K3RA 2LIWA 1IFPA 3DS4A 2KOQA 3NTEA 3H1LE 1GK4A 2V4HA 2KG8A 5AW4B 5KKZB 2KG6A 4UB8H 1JMMA 1ZV8A 2HODB 2XZ1C 3U43A 1KORA 3H1HJ 4H2WC 2JGPA 2OTJP 2OARA 1GU4A 2K93A 2PEMA 4IOIH 1VQKP 3WUTA 1JOCA 5CCGD 4QNBA 3H32B 5JPAA 2ZT9C 1ZXGA 1EDKA 5CCGA 4UB6E 1SQXD 4JF7A 2W6AA 3RL0g 3M0DC 3G29A 2VRSA 4K3AA 2LPKA 1KILA 1URQA 2I1KA 2PEQA 1SQXE 2E43A 4YXDC 2KZJA 3WUUA 1CSBA 5AVTB 4WBAA 1SQQG 1NTKJ 3MZWB 1E6JP 1ZMBA 5KLVK 3OW2O 1GXGA 1YIJP 2M8RA 3TGUD 2GDYA 2L6EA 4D6TG 1FE6A 1KFNA 3RK2C 4OGQC 5CBNA 1W2EA 3H1IJ 1QLED 2MVUA 2FY8A 4TLFA 2ZT9B 3A5TA 2N5IA 1KLPA 2K9YA 2GDWA 1JY2O 2LOLA 4PH1A 1BSHA 3Q20A 3EFFK 2KLUA 1N73A 3L74D 4H44C 4ASWA 3L73G 4NPFX 2LL8A 4Y99B 1J1DC 1VQMP 1PP9D 1GL2B 1L4AC 4L76A 3CCEP 1AQ5A 4GIFA 2FVAA 1YQ4C 4OVNF 1PP9J 4Z1MH 1VQOP 1GTWA 3AE2C 3PP5A 1HQBA 1DEEG 2XKMA 1R5SA 1VQLP 1RE3A 2XZ0D 3FXDA 1IFMA 3MD0A 1JY2P 1A43A 3CX5E 3M9BA 3CWBD 2WPTA 2KG9A 3L71G 4ZKUA 2N5HA 4EDFA 4M0IA 3H0DA 1NU1G 1JJ2O 1NJIQ 3LIDA 1GDTA 5KP7B 4AQRD 2PAJA 2R44A 4WY4A 1FDMA 2AVAA 1N7SC 5I4TG 1NTKG 5KJ7A 1Y47A 3TNUB 2CPBA 2MY5A 3OJAB 2CK3H 1OW7A 4OWFA 1NTKD 2FBWC 2FYUJ 1U57A 1IMQA 1BE3G 3A0BH 3AE7C 2O1JA 1KB9I 2RH0A 2K0XA 3D71A 2Y9ZA 4HKZH 5BS1A 2Y9YA 3L4FA 2P7JA 2EG5A 4KJMA 3O6QA 2K37A 2OYHA 2QEXP 1N7SA 5EFWB 3BVHA 1OWAA 2QM8A 3GG2A 1EOQA 3CC2P 4ZKPA 2VLQA 2WSCJ 1R8EA 2MR8A 2G8YA 4IPYA 1URQB 3B4SA 2K88A 1M56D 5E79E 4ZMDA 4U0BA 1KB9H 1BE3E 2P1JA 2GZGA 4WYMA 3H1HD 3GKLC 2YIUC 3H32A 5CMZA 2L22A 3V2QA 1M1KQ 1LTJB 4D6TJ 2FXPA 1S1CX 1KYOH 2NPSD 3CE7A 2WQYC 1LJ2A 1N73B 2EHSA 1VKUA 3DS1A 2WPSA 5KP8B 3F5HA 1EDJA 1IZNB 2YXQB 3L75E 1L0LG 2AXTH 2A06E 3CX5D 1EZVG 1H89A 3H47A 3L71E 1NAYA 4PV1B 1BXIA 2CPSA 2JU1A 3UIAA 2D2CD 2RN0A 3HE5A 1M8OB 5CHXA 1RF1B 2NPSC 3WU2H 1KMIZ 4Y28J 4I6MC 2POHA 1YQ3C 2R3SA 3B5NA 4H13B 2WWWA 2IBZI 3CI9A 3ITKA 2E1MA 1GW4A 3PH0A 1NVOA 3AEGC 4U3FG 1U7JA 1YYCA 3L70E 2P9XA 2GZFA 3KYQA 2FQ0A 2N1TD 3HUSA 4UB8E 2OYHB 5TJHA 3TNUA 2AXTE 3W68A 2KGDA 5APUA 2XZRA 2QSIA 2K2QA 2H88C 1J1DB 2QE7H 4W7ZA 3RK3E 1X22A 2PGDA 1ZNVA 2K1AA 1RF0C 3NY7B 4M3LA 5EJDA 4GODA 5CJ0A 1NTZJ 1N7LA 1N86A 1BGYJ 1SQQJ 4JYBA 3TYYA 2Y0CA 2BHVA 1N7SD 2E74C 1AA0A 1RH5B 2B9BA 1G1JA 2QIWA 1P84D 1FZEA 2ZAEB 2WSFJ 3VYIA 3CX5I 1OXZA 3ABVC 3BRTB 2IZ0A 4LC1A 2UWJE 5TISH 3K5BA 3H1LG 1T3UA 4XA4A 3Q5PA 1KN7A 4XRQA 4U7JA 1BDDA 2P2UA 1K05A 1YJWP 1U7MA 1EDLA 2J5UA 1FDIA 1HGVA 3A0HE 2LIUA 5KKZC 2FADA 5KJ7D 2BCCJ 1GMJA 2WT7B 1K30A 2IPPA 3CX5H 4MRTC 4WVZA 2KS1B 1ACPA 4XFZA 5AW0B 2XV6A 5AVWB 1NU1E 1SQPJ 1PGOA 3TF5A 1OFCX 3O8ZA 1PPJD 2EHTA 1M74A 3B5IA 4XFJA 2EFJA 3JC22 3KDPB 1HJBA 2KI7B 1S2EA 3CC7P 3AEBC 3V2PA 1HGZA 3KQGA 1S5LE 3CLQA 1KFMA 1IFDA 2GM4A 1SQBJ 3U1CA 1HUCA 3L74E 3IF4A 3A2AA 2Z5IA 4CPGA 1OVUA 2WVRA 2GYKA 3VMZA 2R5BA 1T2KC 3HUSC 3VOPA 2JO1A 3AE3C 3OA7A 1AVYA 1M1JA 1KZUB 3AE9C 3MTUE 3LW5H 3RG2A 4HH2A 3TGUE 3H1HG 4GOFA 2P10A 2A06G 1OX3A 3RK2B 1BCCJ 2KUBA 1LTAC 1L0LJ 4U0EA 2SPZA 2CGQA 2OYOA 1SQVJ 2L4BA 2M8PA 2JYLA 1AV1A 2QJYC 5GTHE 3EJBA 2N1TA 1UIIA 1DH3A 5AVRB 1USDA 3GZMA 1Q7YQ 3QWOC 1Q90D 2FFDB 2NPSB 4GR6A 1FJKA 4BRYA 3R4YA 2K9JA 5EW5E 5APTA 3HE5B 1FAVA 1H0TB 4H2YC 4IZ6A 1YJNP 1FZGA 2L9FA 1BE3D 2PRRA 3TDKA 2ZYGA 2LXCB 2KXPB 2QRXA 3Q5SA 1KILC 5KLVD 1W5CE 3G6EP 5KLVJ 3G1GA 3HRNA 1PP9G 1FZBA 5AW7B 2KS1A 2FVFA 2FQ1A 3CXCO 5CCHD 5AVZB 3HD7A 1Z56A 1RF1A 2BQ1E 2ONTA 2E75B 4WY4D 4UB6H 1SLQA 2GZEA 2KSJA 4PD4E 4EI2A 2Q3EA 2ZXEB 1NTMJ 2FYZA 2IYPA 3H1KD 5BVZA 1XTCC 3N4XA 2KW2A 2Q9IA 2Z44A 3G0VA 1F80D 3GF7A 1KQSO 3CCMP 2E76B 2ITAA 1NTZG 1T2KD 2B87A 1EXIA 2FVEA 3RK3D 1AYIA 1ZMEC 2WPRA 1NTKE 1ZW0A 3GJNA 2GZIA 4PJ0E 2XT1A 1RF0A 1PGJA 2B89A 2KZIA 1LT1A 4U3FJ 2HPCB 3DS0A 1RF1C 1P84H 3E2DA 5DJTB 2QJKC 2IBZG 1NYHA 5H2FE 1AF8A 4N3YB 3C1LA 1RE4A 3NTNA 2AEJA 1JCCA 3HE4A 3H1IE 2C9NY 2Z45A 3A7OA 1QGKB 2YMKA 4I1LA 1N2DC 1JY2N 3BCCD 2LKIA 1HJ0A 4LLHA 2K94A 4IL6H 2A45G 1DV5A 1URQD 3USSA 2G3AA 5AW1B 1L4AB 3M1MA 1SFCD 3RK3B 4IFDK 2AEMA 2JAZA 2J59M 2HPCA 1SQBD 2IFNA 4PJ0H 5F2OA 1GW3A 4BPFA 2GUVA 5AW6B 2VLNA 5AVSB 1JB0J 3C8VA 3HTKB 2W90A 1K73Q 2WSEH 4JBZA 2Y0EA 2L0QA 3GF3A 2PY8A 1BCCG 1DD4A 3Q2YA 3VP9A 2PEJA 1OW8A 3V4WA 5GTIE 3G26A 4NPDA 1N8RQ 1CZQA 1ZR2A 3L73E 1SQVG 4JYCA 1IC2A 5B66E 1YTZI 4A7PA 2M5RA 3GHGC 3H1LJ 1KTMA 1W2BO 1NTMG 3VMYA 4PD4D 5B66H 2BCCD 4W7YA 5F2NA 4C7NA 5AW8B 3H1HE 3L75G 2M3EA 1FS0E 5BU8B 1RE4C 1RQUA 1S4XA 1LP1B 4DG9A 4CA3A 1D1DA 3SFEC 1NKNA 3B4QA 2HFED 2ZJSE 1JY3N 3G71P 1A02F 2FXMA 4DOJA 1KB9D 3GW6A 1K04A 2PNGA 1VQ5P 1EZVD 1RNIA 2QJPB 1RHZB 2R32A 1VQNP 3H1JJ 1IFNA 2W6JH 3Q3DA 3PRJA 4EYYQ 1HWTC 3V6IA 1BGYD 1GXHA 2IBZE 1L0LK 1NTZD 5APWA 3ZDMA 1GD2E 1EZVI 1AVOA 1M6NA 1FC2C 4B86A 1PZQA 3CMEP 1SS1A 3VN0A 3P8MC 5DCKA 3CD6P 4U0DA 1LGHB 5APVA 1SQQK 2MD9A 2WSCH 2JDIH 4R4LA 1LTSC 2OQQA 3BCCG 5HGNA 1NHLA 2JEEA 5KLIC 2NZ2A 3B5ND 5KJ7C 3JCUH 3CCSP 1L2PA 2HG5D 4H44B 2WITA 2N6ZA 2K0DX 2J58A 1ZRTD 3GHGB 3MGEA 3GHGA 2W8ZA 5CCHC 1PGQA 5APYA 1FOSE 2FXOA 3CXHD 2JJLA 2E76C 1KD1Q 4MN4C 1L0NJ 1J1EB 3BCCE 4XFXA 2Z5HA 1Q82Q 1M6EX 2OYIA 3PHLA 2KOOA 1LP1A 1CEIA 1ZR4A 1EQ7A 1LT9B 3G28A 1HF9A 5HVCA 2ERHA 2YKOA 2O1KA 2QM7A 2N9YB 2BASA 3IAOA 3MGNA 5KAFH 1S9KD 1OVRA 1QVGO 2OYIB 2M5AB 3HUSB 3A0BE 4JQ0D 1NU1D 2WSEJ 3H1KE 3V5BA 3A0HH 3BATA 2JWAA 4UHPB 3II6A 1SFCC 2WSSH 1D7MA 4D6TD 3BRVB 5AVYB 3CWBG 2FAEA 1E79H 3TGUG 2FFDC 4Y99C 2ZFCA 4W80A 1VF5B 5AVVB 2GZJA 1R5LA 4TT3H 2KORA 3HD7D 2XNXA 3AE8C 2O01H 2QJYB 2KK7A 1FZCA 1OR5A 1QVFO 1EDIA 1PL5A 4RESB 2JYGA 4N78D 3L72J 1SFCA 3FWLA 1K8AQ 1H8AA 1KQFB 3VP8A 3WU2E 2JU2A 2E75C 2Z4EA 4GDOA 3U1AA 1S72P 1X3OA 2CQ8A 4QKOA 1JUNA 2WT7A 1L0IA 1EZVE 4H0LB 4IL6E 3SWKA 4L73A 2E76D 3H4EA 3RBXA 3AE5C 2FYUD 4R4MA 3R2PA 2AEFA 4KHXA 2N98A 1BAJA 2K0YA 1YITP 1PEMA 4WY4B 2GUSA 1T8ZA 1LT9A 3P32A 2L5GB 2M8LA 2ROQA 1EC5A 1QEXA 1VL2A 5CCGC 1Q86Q 3P7KA 2PEKA 4C7NB 4BRYB 1FOSF 1GPJA 2KB7P 3EJDA 2Q3IA 4LGDE 4XFYA 4NPEA 1SQPE 2ZXXA 3IFMA 5KAIE 3I5CA 2JR8A 3CWBJ 2LXBA 4QMAA 1PPJG 3Q1MA 2N6YA 3D70A 4YPCA 1EMVA 1MZ9A 1ZOYC 1CW5A 2MF4A 2M5AA 1H88A 2E75D 2KODA 3CCLP 2FFDA 3M0AA 2O01J 3L74J 1NKZB 3KZIE 2QJKB 4H0LD 1KYOD 1PPJE 4RKUJ 3DS2A 1DNYA 3CXHE 4C46A 1UJZA 2KSEA 1IO4A 3MIWA 3H1ID 1G1IA 4AYCA 3CC4P 3P05A 2HYNA 2WPVB 1VQ6P 3OAKA 1IFIA 5APSA 2DGYA 1NQ4A 1M57D 3KHUA 1KQGB 1LNQA 3G4SP 1Y9BA 3TGUJ 1IK9A 1GL2D 2ZVOB 1LTIC 3E7KA 4COPA 4U0CA 3E1IA 3I56P 3U59A 3LRYA 1VDFA 5E79H 1WT6A 2K5XA 3P8CE 3EFGA 3HYBA 1KILB 2M0BA 1LWUA 2P67A 3MUDC 5AVXB 2IBZD 3B71A 1VQ8P 3SFDC 1OMIA
chains in the Genus database with same CATH topology
2Z45A 1AUMA 2M8PA 2JYLA 1Q86Q 1K30A 3RG6C 2PEKA 3CCQP 5BS1A 1EIAA 3DS4A 2E1MA 1YHQP 3NTEA 1Q7YQ 4XFYA 2EG5A 2P9XA 4U0AA 4XFZA 3G1IA 2EIAA 4GR6A 2PENA 5BS2A 3I55P 2XV6A 2QEXP 1YI2P 4PH1A 3M1MA 1VQPP 1M6NA 3Q20A 2XXMA 2LF4A 3CMEP 1EOQA 5F2OA 4COCA 2BUOA 1YJNP 3CC2P 1IUQA 1RO0A 1M74A 5DCKA 3CD6P 3B5IA 4IPYA 4U0DA 2OTJP 1VQMP 3CCJP 4U0BA 2EFJA 2OARA 1VQ7P 3CCEP 2OTLP 3DPHA 3CC7P 3G6EP 3G1GA 2PEMA 1VQOP 1VQ9P 5HGNA 1VQKP 1K73Q 2CWOA 5F2KA 1Q81Q 2KODA 4WYMA 3CCLP 1QVFO 4QNBA 3VRLC 1VQLP 5HGOA 5JPAA 4GR2A 3DTJA 1RO2A 2PY8A 3WBHA 3CXCO 2JYGA 1PEUA 2PEJA 3CCSP 1YJ9P 1A43A 1A8OA 3DS2A 1M1KQ 3G26A 3G29A 1N8RQ 2ONTA 1K8AQ 3DS5A 2BQ1E 3MGEA 2QA4P 4U0FA 1W2BO 1QRJA 3CMAP 2BHVA 1PEQA 4M0IA 1S72P 3DS1A 3H0DA 3CPWO 1KD1Q 1JJ2O 1NJIQ 2PEQA 5F2NA 1K9MQ 2Z44A 3G0VA 3CC4P 2PEIA 3P05A 4XFXA 1Q82Q 3H4EA 1KQSO 1VQ6P 3CCMP 1M6EX 2DGYA 3CCUP 1M90Q 3H47A 3G4SP 2Z46A 1VQ4P 3CCRP 5HGMA 3G28A 5I4TG 2XT1A 1D1DA 2PEOA 5HGLA 1VQNP 4COPA 4U0CA 1BAJA 1E6JP 1YITP 4XRQA 1KC8Q 1PEMA 1ZMBA 3G71P 4PH0A 3I56P 3OW2O 3DS0A 1PEOA 3DS3A 2JO0A 3LRYA 3CCVP 1YIJP 3E2DA 3HZQA 1YJWP 3G21A 4U0EA 3HYBA 2M8LA 1VQ5P 2L6EA 2M8NA 1RNIA 1QVGO 4XROA 1VQ8P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N8R Q;  3G4S P;  1K8A Q;  1VQ4 P;  1Q86 Q;  3CD6 P;  3CCR P;  2OTJ P;  3CCQ P;  1VQN P;  1VQM P;  3CCJ P;  1YIT P;  1KC8 Q;  2QA4 P;  1VQ7 P;  3CCE P;  2OTL P;  1YHQ P;  1W2B O;  3CMA P;  3G6E P;  3G71 P;  3I56 P;  1Q7Y Q;  3OW2 O;  1VQO P;  1S72 P;  1VQ9 P;  3CC7 P;  3CPW O;  3CCV P;  1YIJ P;  1K73 Q;  1Q81 Q;  1KD1 Q;  1JJ2 O;  1VQK P;  1YJW P;  1NJI Q;  3I55 P;  3CCL P;  1QVF O;  2QEX P;  1YI2 P;  1VQP P;  1VQL P;  1K9M Q;  3CC4 P;  1VQ5 P;  3CXC O;  1Q82 Q;  1KQS O;  1VQ6 P;  3CCM P;  3CCS P;  1QVG O;  3CME P;  1YJ9 P;  3CCU P;  1VQ8 P;  3CC2 P;  1YJN P;  1M1K Q;  1M90 Q; 
#chains in the Genus database with same CATH topology
 4RJT A;  1JNM A;  2LKM A;  3N7N A;  1OVV A;  3M9H A;  1USE A;  4WB4 A;  3CCQ P;  3QH9 A;  1JMB A;  2JQ4 A;  1VPC A;  4GKG A;  3KPE A;  4R0M A;  3L72 D;  2KOP A;  3E1R A;  1SQX J;  2I1J A;  2PFX A;  2N50 A;  1SVF A;  2QNW A;  3F89 A;  2X2B A;  4HKG A;  2W83 C;  1VQ9 P;  1EXJ A;  1UIX A;  2WSF H;  3M91 A;  1DD3 A;  1P84 I;  3S4R A;  3M06 A;  2LML A;  1PEU A;  1IK7 A;  4O9B A;  1GL2 C;  3DS5 A;  2C9L Y;  1LTJ A;  5AVU B;  2AXC A;  2W27 A;  3GMA A;  2KNC A;  2KGA A;  2CG5 B;  1JY3 P;  1QRJ A;  1NU1 J;  1PEQ A;  4I2L C;  1MV8 A;  1HVV A;  2PEI A;  2LTE A;  3M0D A;  1AJY A;  2M3B A;  1CI6 B;  1KIL E;  2OYI C;  5HV8 A;  2GA1 A;  2ZYD A;  2JB0 A;  1NH4 A;  1PIX A;  2JBG A;  2A45 H;  1DIP A;  4RO0 A;  3AED C;  2FAC A;  3AE1 C;  2YIU B;  1J1E C;  1KYO I;  4YTP C;  3MP7 B;  1MZ8 A;  1KIL D;  1L0N D;  2A06 D;  2Q6Q A;  5H2F H;  1JTH A;  2OTK E;  2WMM A;  2WZ7 A;  1YHQ P;  1H0T A;  3NXS A;  3C9I A;  3W67 A;  1DX7 A;  1IFJ A;  1SQP G;  1OIP A;  5KLI B;  1OW6 A;  1PV3 A;  3B5N B;  1KV4 A;  1NAF A;  1PFI A;  5DJU B;  3EQ2 A;  3JCU E;  5B5E H;  1BCC E;  1LTJ C;  3NFQ A;  2MJZ A;  3DPH A;  1E5W A;  1NU1 K;  5CZD B;  5C39 A;  5CCH A;  2FHS C;  5KP6 B;  1SQV E;  1N73 C;  4BPH A;  2V7Q J;  1MFT A;  4GR2 A;  3RL0 C;  1AFO A;  3L73 J;  2YKP A;  1YJ9 P;  4EOT A;  3O6Q B;  2E42 A;  1FZA A;  2B88 A;  2KR5 A;  1X9V A;  3KXD A;  1BSN A;  4IFM A;  1A02 J;  4U0F A;  2JKV A;  1GU5 A;  3L37 A;  3CMA P;  2B87 B;  3A3Y B;  2GDX A;  2R5D A;  3H1J D;  3RBZ A;  2ZVN B;  2IZ1 A;  1QL2 A;  3CCU P;  3V2R A;  1KQL A;  2Y0D A;  1RE3 C;  5KAI H;  5CJ4 A;  5KLV E;  1URQ C;  2AFD A;  2BEQ D;  4IL6 X;  1PEO A;  3PJS K;  1YTZ T;  1T8K A;  2FQ2 A;  3RL0 B;  5AW2 B;  3S1K A;  4KT0 J;  2HOD A;  1HY8 A;  3H1J E;  4H0L C;  4AUW A;  2RKL A;  3H25 A;  2I8D A;  1PGP A;  1UNK A;  4PXH B;  5AW9 B;  4PWV B;  2VSQ A;  1N7S B;  2YNY A;  1LT9 C;  4IFF A;  4D6T E;  1EIA A;  3H1L D;  3GZL A;  1S5L X;  3KZI H;  2NPS A;  2KOG A;  4EIJ A;  4U0A A;  2VLO A;  2PEN A;  3LIE A;  1WMK A;  1YI2 P;  1X8Y A;  3L74 G;  1ZLL A;  2LF4 A;  1L0N G;  2XND H;  3FWN A;  2Q1K A;  1G2C B;  2Q5U A;  1IMP A;  4U3F E;  3L71 J;  1L0H A;  1MKM A;  4DT0 A;  3PLN A;  1XTG B;  2CWO A;  1Q81 Q;  2YO3 A;  1JTH B;  1PP9 E;  3VMX A;  1T6A A;  2KYV A;  1VF5 D;  3DTJ A;  5KTB A;  3WBH A;  3L72 G;  2Q7C A;  2PP6 A;  1SFC B;  1J2J B;  1Q2N A;  4BPG A;  1IJD B;  3L70 D;  4XE5 B;  3FGA D;  5APQ A;  3MHV A;  2D2C C;  2QA4 P;  2H43 A;  1NTM K;  1Y8A A;  3BCC J;  3JSV C;  1K9M Q;  1SQB G;  3CXH I;  1FU1 A;  2Z46 A;  2AFE A;  1NTZ K;  3AEF C;  2PEO A;  1FZF A;  4U3F D;  5HGL A;  1KC8 Q;  1HTL C;  3S9O A;  3T97 B;  3AEC C;  3DS3 A;  2H89 C;  3HZQ A;  3G21 A;  2IYO A;  1LWU B;  3L75 D;  4OGQ D;  3SWF A;  2XU6 A;  2M8N A;  2L91 A;  2FYU E;  1SQV K;  1FZC B;  2NO8 A;  4YXW H;  2H7H A;  3RG6 C;  3CXH H;  3H1K J;  1NTM D;  3H1I G;  1Z6M A;  2HLO A;  4GT1 A;  1FBM A;  1BGY E;  1SQQ E;  2BEZ F;  5BS2 A;  3I55 P;  5TIS E;  1M7L A;  1VQP P;  4PD4 H;  1WRG A;  2XXM A;  3L70 G;  3G9R A;  3GLM A;  2E5T A;  4COC A;  3TK1 A;  2FKW B;  1G2C A;  4N78 E;  2YMY A;  3RGU A;  4NEO A;  2OGU A;  4C7R A;  3CCJ P;  4L75 A;  1NGM B;  1VQ7 P;  2OTL P;  2FYU G;  3RK2 D;  4H2X C;  2AF8 A;  1BE3 J;  5M1B A;  1P84 E;  2KNC B;  3IN6 A;  3LMO A;  2WTY A;  2MKV A;  2A45 I;  2IX7 C;  2QVA A;  2BCC G;  3RL0 D;  4HJG H;  5KLV G;  1FJP A;  2JWD A;  3IR9 A;  1L4A D;  1SQV D;  1BDC A;  3L75 J;  1M90 Q;  4HYT B;  1S9K E;  2V7Q H;  1L0L D;  3CCR P;  1BCC D;  3LW5 J;  3HE4 B;  4PH0 A;  2ZT9 D;  2HR3 A;  1VF5 C;  2JO0 A;  3CCV P;  3FXE A;  1L0N K;  1QX8 A;  4ASV A;  3V2N A;  5K5G B;  3B5N C;  4L74 A;  1SQB E;  2R3C A;  2D2C B;  2C0X A;  4DJG A;  1L0N E;  4OH8 B;  2H8P D;  2O01 N;  3AEE C;  4H44 D;  3L70 J;  1DEB A;  3L36 A;  1ZRT E;  4WWI A;  4DZO A;  1LTB C;  4DCK A;  1M1J B;  2FYN C;  4H13 C;  1MUU A;  1RO0 A;  1AQT A;  1NWQ A;  2IFM A;  3EJE A;  5BU5 A;  1JEK A;  3M9Q A;  1JCD A;  2OYH C;  3L71 D;  2YKQ A;  4WY4 C;  2FYU K;  2O3J A;  1SQB K;  5HGO A;  2LR2 A;  3PTZ A;  1SQX K;  4PV1 C;  3TSI A;  2IDB A;  1A8O A;  2P58 A;  1SQP D;  1ZP0 C;  5L8R J;  1JM0 A;  1NTK K;  5KAF E;  1NTZ E;  5CBO A;  3H1K G;  1HBW A;  2E5Y A;  2JP3 A;  3CPW O;  3HTK A;  3AE4 C;  3EWK A;  3WMM 0;  1LTG C;  2QG4 A;  1LTT C;  4JPZ B;  1S3J A;  2WPQ A;  1X79 B;  4HB1 A;  5AVQ B;  2N9B A;  3FX0 A;  3H1J G;  3B8E B;  1S5L H;  2KGE A;  2KP8 A;  1JY3 O;  1VQ4 P;  1X0T A;  1FDO A;  1KB9 E;  2ZYA A;  1CI6 A;  2KLV A;  5B5E E;  3V4Q A;  5AW3 B;  1MFZ A;  3SWY A;  3SSU A;  3VTP C;  5GTI H;  1LWU C;  3MUD A;  2YXR B;  1SQP K;  3L72 E;  2KWL A;  4F37 A;  4OGQ B;  2E74 B;  1AUM A;  5APX A;  1HH0 A;  2QJP C;  4BWN A;  2BCC E;  7CEI A;  3Q5R A;  1SQQ D;  1NOH A;  3T97 A;  3WUV A;  4BXL A;  3G1I A;  1FZC C;  2EIA A;  1L4A A;  1NTM E;  5AW5 B;  2MVV A;  3L73 D;  3L35 A;  3P8C D;  2K9J B;  2XDJ A;  3NMD A;  2BUO A;  1FR2 A;  2VLP A;  1JO5 A;  1IUQ A;  4GOE A;  1GK6 A;  4I7Z B;  1ZN5 A;  2C0W A;  2N1T B;  1GL2 A;  5F2K A;  3VRL C;  2E74 D;  1NO4 A;  1GZL A;  1TU3 F;  1RO2 A;  1RY3 A;  4K35 A;  4PV1 D;  3H6P A;  3VMA A;  1E0H A;  1BGY G;  2W6B A;  4ZNC A;  3AE6 C;  2KOS A;  3CWB E;  2NRG A;  2XV5 A;  1KYO E;  3RK3 C;  3HD7 C;  3AEA C;  4H13 D;  3D6Z A;  1OZH A;  2DNW A;  2KIK A;  1VHN A;  3D6Y A;  1SP4 A;  1YBK A;  5HGM A;  2MR7 A;  1RQV A;  2RMZ A;  2CNR A;  3HD7 B;  2YO2 A;  2DW3 A;  4PD4 I;  3G3Z A;  1M1J C;  2FYN B;  3CL3 D;  2N1T C;  5GTH H;  4I7Z C;  1QL1 A;  4N6J A;  2KGC A;  1L0L E;  4XRO A;  3BAS A;  1SQX G;  1T3J A;  2K92 A;  2K3R A;  2LIW A;  1IFP A;  3DS4 A;  2KOQ A;  3NTE A;  3H1L E;  1GK4 A;  2V4H A;  2KG8 A;  5AW4 B;  5KKZ B;  2KG6 A;  4UB8 H;  1JMM A;  1ZV8 A;  2HOD B;  2XZ1 C;  3U43 A;  1KOR A;  3H1H J;  4H2W C;  2JGP A;  2OTJ P;  2OAR A;  1GU4 A;  2K93 A;  2PEM A;  4IOI H;  1VQK P;  3WUT A;  1JOC A;  5CCG D;  4QNB A;  3H32 B;  5JPA A;  2ZT9 C;  1ZXG A;  1EDK A;  5CCG A;  4UB6 E;  1SQX D;  4JF7 A;  2W6A A;  3RL0 g;  3M0D C;  3G29 A;  2VRS A;  4K3A A;  2LPK A;  1KIL A;  1URQ A;  2I1K A;  2PEQ A;  1SQX E;  2E43 A;  4YXD C;  2KZJ A;  3WUU A;  1CSB A;  5AVT B;  4WBA A;  1SQQ G;  1NTK J;  3MZW B;  1E6J P;  1ZMB A;  5KLV K;  3OW2 O;  1GXG A;  1YIJ P;  2M8R A;  3TGU D;  2GDY A;  2L6E A;  4D6T G;  1FE6 A;  1KFN A;  3RK2 C;  4OGQ C;  5CBN A;  1W2E A;  3H1I J;  1QLE D;  2MVU A;  2FY8 A;  4TLF A;  2ZT9 B;  3A5T A;  2N5I A;  1KLP A;  2K9Y A;  2GDW A;  1JY2 O;  2LOL A;  4PH1 A;  1BSH A;  3Q20 A;  3EFF K;  2KLU A;  1N73 A;  3L74 D;  4H44 C;  4ASW A;  3L73 G;  4NPF X;  2LL8 A;  4Y99 B;  1J1D C;  1VQM P;  1PP9 D;  1GL2 B;  1L4A C;  4L76 A;  3CCE P;  1AQ5 A;  4GIF A;  2FVA A;  1YQ4 C;  4OVN F;  1PP9 J;  4Z1M H;  1VQO P;  1GTW A;  3AE2 C;  3PP5 A;  1HQB A;  1DEE G;  2XKM A;  1R5S A;  1VQL P;  1RE3 A;  2XZ0 D;  3FXD A;  1IFM A;  3MD0 A;  1JY2 P;  1A43 A;  3CX5 E;  3M9B A;  3CWB D;  2WPT A;  2KG9 A;  3L71 G;  4ZKU A;  2N5H A;  4EDF A;  4M0I A;  3H0D A;  1NU1 G;  1JJ2 O;  1NJI Q;  3LID A;  1GDT A;  5KP7 B;  4AQR D;  2PAJ A;  2R44 A;  4WY4 A;  1FDM A;  2AVA A;  1N7S C;  5I4T G;  1NTK G;  5KJ7 A;  1Y47 A;  3TNU B;  2CPB A;  2MY5 A;  3OJA B;  2CK3 H;  1OW7 A;  4OWF A;  1NTK D;  2FBW C;  2FYU J;  1U57 A;  1IMQ A;  1BE3 G;  3A0B H;  3AE7 C;  2O1J A;  1KB9 I;  2RH0 A;  2K0X A;  3D71 A;  2Y9Z A;  4HKZ H;  5BS1 A;  2Y9Y A;  3L4F A;  2P7J A;  2EG5 A;  4KJM A;  3O6Q A;  2K37 A;  2OYH A;  2QEX P;  1N7S A;  5EFW B;  3BVH A;  1OWA A;  2QM8 A;  3GG2 A;  1EOQ A;  3CC2 P;  4ZKP A;  2VLQ A;  2WSC J;  1R8E A;  2MR8 A;  2G8Y A;  4IPY A;  1URQ B;  3B4S A;  2K88 A;  1M56 D;  5E79 E;  4ZMD A;  4U0B A;  1KB9 H;  1BE3 E;  2P1J A;  2GZG A;  4WYM A;  3H1H D;  3GKL C;  2YIU C;  3H32 A;  5CMZ A;  2L22 A;  3V2Q A;  1M1K Q;  1LTJ B;  4D6T J;  2FXP A;  1S1C X;  1KYO H;  2NPS D;  3CE7 A;  2WQY C;  1LJ2 A;  1N73 B;  2EHS A;  1VKU A;  3DS1 A;  2WPS A;  5KP8 B;  3F5H A;  1EDJ A;  1IZN B;  2YXQ B;  3L75 E;  1L0L G;  2AXT H;  2A06 E;  3CX5 D;  1EZV G;  1H89 A;  3H47 A;  3L71 E;  1NAY A;  4PV1 B;  1BXI A;  2CPS A;  2JU1 A;  3UIA A;  2D2C D;  2RN0 A;  3HE5 A;  1M8O B;  5CHX A;  1RF1 B;  2NPS C;  3WU2 H;  1KMI Z;  4Y28 J;  4I6M C;  2POH A;  1YQ3 C;  2R3S A;  3B5N A;  4H13 B;  2WWW A;  2IBZ I;  3CI9 A;  3ITK A;  2E1M A;  1GW4 A;  3PH0 A;  1NVO A;  3AEG C;  4U3F G;  1U7J A;  1YYC A;  3L70 E;  2P9X A;  2GZF A;  3KYQ A;  2FQ0 A;  2N1T D;  3HUS A;  4UB8 E;  2OYH B;  5TJH A;  3TNU A;  2AXT E;  3W68 A;  2KGD A;  5APU A;  2XZR A;  2QSI A;  2K2Q A;  2H88 C;  1J1D B;  2QE7 H;  4W7Z A;  3RK3 E;  1X22 A;  2PGD A;  1ZNV A;  2K1A A;  1RF0 C;  3NY7 B;  4M3L A;  5EJD A;  4GOD A;  5CJ0 A;  1NTZ J;  1N7L A;  1N86 A;  1BGY J;  1SQQ J;  4JYB A;  3TYY A;  2Y0C A;  2BHV A;  1N7S D;  2E74 C;  1AA0 A;  1RH5 B;  2B9B A;  1G1J A;  2QIW A;  1P84 D;  1FZE A;  2ZAE B;  2WSF J;  3VYI A;  3CX5 I;  1OXZ A;  3ABV C;  3BRT B;  2IZ0 A;  4LC1 A;  2UWJ E;  5TIS H;  3K5B A;  3H1L G;  1T3U A;  4XA4 A;  3Q5P A;  1KN7 A;  4XRQ A;  4U7J A;  1BDD A;  2P2U A;  1K05 A;  1YJW P;  1U7M A;  1EDL A;  2J5U A;  1FDI A;  1HGV A;  3A0H E;  2LIU A;  5KKZ C;  2FAD A;  5KJ7 D;  2BCC J;  1GMJ A;  2WT7 B;  1K30 A;  2IPP A;  3CX5 H;  4MRT C;  4WVZ A;  2KS1 B;  1ACP A;  4XFZ A;  5AW0 B;  2XV6 A;  5AVW B;  1NU1 E;  1SQP J;  1PGO A;  3TF5 A;  1OFC X;  3O8Z A;  1PPJ D;  2EHT A;  1M74 A;  3B5I A;  4XFJ A;  2EFJ A;  3JC2 2;  3KDP B;  1HJB A;  2KI7 B;  1S2E A;  3CC7 P;  3AEB C;  3V2P A;  1HGZ A;  3KQG A;  1S5L E;  3CLQ A;  1KFM A;  1IFD A;  2GM4 A;  1SQB J;  3U1C A;  1HUC A;  3L74 E;  3IF4 A;  3A2A A;  2Z5I A;  4CPG A;  1OVU A;  2WVR A;  2GYK A;  3VMZ A;  2R5B A;  1T2K C;  3HUS C;  3VOP A;  2JO1 A;  3AE3 C;  3OA7 A;  1AVY A;  1M1J A;  1KZU B;  3AE9 C;  3MTU E;  3LW5 H;  3RG2 A;  4HH2 A;  3TGU E;  3H1H G;  4GOF A;  2P10 A;  2A06 G;  1OX3 A;  3RK2 B;  1BCC J;  2KUB A;  1LTA C;  1L0L J;  4U0E A;  2SPZ A;  2CGQ A;  2OYO A;  1SQV J;  2L4B A;  2M8P A;  2JYL A;  1AV1 A;  2QJY C;  5GTH E;  3EJB A;  2N1T A;  1UII A;  1DH3 A;  5AVR B;  1USD A;  3GZM A;  1Q7Y Q;  3QWO C;  1Q90 D;  2FFD B;  2NPS B;  4GR6 A;  1FJK A;  4BRY A;  3R4Y A;  2K9J A;  5EW5 E;  5APT A;  3HE5 B;  1FAV A;  1H0T B;  4H2Y C;  4IZ6 A;  1YJN P;  1FZG A;  2L9F A;  1BE3 D;  2PRR A;  3TDK A;  2ZYG A;  2LXC B;  2KXP B;  2QRX A;  3Q5S A;  1KIL C;  5KLV D;  1W5C E;  3G6E P;  5KLV J;  3G1G A;  3HRN A;  1PP9 G;  1FZB A;  5AW7 B;  2KS1 A;  2FVF A;  2FQ1 A;  3CXC O;  5CCH D;  5AVZ B;  3HD7 A;  1Z56 A;  1RF1 A;  2BQ1 E;  2ONT A;  2E75 B;  4WY4 D;  4UB6 H;  1SLQ A;  2GZE A;  2KSJ A;  4PD4 E;  4EI2 A;  2Q3E A;  2ZXE B;  1NTM J;  2FYZ A;  2IYP A;  3H1K D;  5BVZ A;  1XTC C;  3N4X A;  2KW2 A;  2Q9I A;  2Z44 A;  3G0V A;  1F80 D;  3GF7 A;  1KQS O;  3CCM P;  2E76 B;  2ITA A;  1NTZ G;  1T2K D;  2B87 A;  1EXI A;  2FVE A;  3RK3 D;  1AYI A;  1ZME C;  2WPR A;  1NTK E;  1ZW0 A;  3GJN A;  2GZI A;  4PJ0 E;  2XT1 A;  1RF0 A;  1PGJ A;  2B89 A;  2KZI A;  1LT1 A;  4U3F J;  2HPC B;  3DS0 A;  1RF1 C;  1P84 H;  3E2D A;  5DJT B;  2QJK C;  2IBZ G;  1NYH A;  5H2F E;  1AF8 A;  4N3Y B;  3C1L A;  1RE4 A;  3NTN A;  2AEJ A;  1JCC A;  3HE4 A;  3H1I E;  2C9N Y;  2Z45 A;  3A7O A;  1QGK B;  2YMK A;  4I1L A;  1N2D C;  1JY2 N;  3BCC D;  2LKI A;  1HJ0 A;  4LLH A;  2K94 A;  4IL6 H;  2A45 G;  1DV5 A;  1URQ D;  3USS A;  2G3A A;  5AW1 B;  1L4A B;  3M1M A;  1SFC D;  3RK3 B;  4IFD K;  2AEM A;  2JAZ A;  2J59 M;  2HPC A;  1SQB D;  2IFN A;  4PJ0 H;  5F2O A;  1GW3 A;  4BPF A;  2GUV A;  5AW6 B;  2VLN A;  5AVS B;  1JB0 J;  3C8V A;  3HTK B;  2W90 A;  1K73 Q;  2WSE H;  4JBZ A;  2Y0E A;  2L0Q A;  3GF3 A;  2PY8 A;  1BCC G;  1DD4 A;  3Q2Y A;  3VP9 A;  2PEJ A;  1OW8 A;  3V4W A;  5GTI E;  3G26 A;  4NPD A;  1N8R Q;  1CZQ A;  1ZR2 A;  3L73 E;  1SQV G;  4JYC A;  1IC2 A;  5B66 E;  1YTZ I;  4A7P A;  2M5R A;  3GHG C;  3H1L J;  1KTM A;  1W2B O;  1NTM G;  3VMY A;  4PD4 D;  5B66 H;  2BCC D;  4W7Y A;  5F2N A;  4C7N A;  5AW8 B;  3H1H E;  3L75 G;  2M3E A;  1FS0 E;  5BU8 B;  1RE4 C;  1RQU A;  1S4X A;  1LP1 B;  4DG9 A;  4CA3 A;  1D1D A;  3SFE C;  1NKN A;  3B4Q A;  2HFE D;  2ZJS E;  1JY3 N;  3G71 P;  1A02 F;  2FXM A;  4DOJ A;  1KB9 D;  3GW6 A;  1K04 A;  2PNG A;  1VQ5 P;  1EZV D;  1RNI A;  2QJP B;  1RHZ B;  2R32 A;  1VQN P;  3H1J J;  1IFN A;  2W6J H;  3Q3D A;  3PRJ A;  4EYY Q;  1HWT C;  3V6I A;  1BGY D;  1GXH A;  2IBZ E;  1L0L K;  1NTZ D;  5APW A;  3ZDM A;  1GD2 E;  1EZV I;  1AVO A;  1M6N A;  1FC2 C;  4B86 A;  1PZQ A;  3CME P;  1SS1 A;  3VN0 A;  3P8M C;  5DCK A;  3CD6 P;  4U0D A;  1LGH B;  5APV A;  1SQQ K;  2MD9 A;  2WSC H;  2JDI H;  4R4L A;  1LTS C;  2OQQ A;  3BCC G;  5HGN A;  1NHL A;  2JEE A;  5KLI C;  2NZ2 A;  3B5N D;  5KJ7 C;  3JCU H;  3CCS P;  1L2P A;  2HG5 D;  4H44 B;  2WIT A;  2N6Z A;  2K0D X;  2J58 A;  1ZRT D;  3GHG B;  3MGE A;  3GHG A;  2W8Z A;  5CCH C;  1PGQ A;  5APY A;  1FOS E;  2FXO A;  3CXH D;  2JJL A;  2E76 C;  1KD1 Q;  4MN4 C;  1L0N J;  1J1E B;  3BCC E;  4XFX A;  2Z5H A;  1Q82 Q;  1M6E X;  2OYI A;  3PHL A;  2KOO A;  1LP1 A;  1CEI A;  1ZR4 A;  1EQ7 A;  1LT9 B;  3G28 A;  1HF9 A;  5HVC A;  2ERH A;  2YKO A;  2O1K A;  2QM7 A;  2N9Y B;  2BAS A;  3IAO A;  3MGN A;  5KAF H;  1S9K D;  1OVR A;  1QVG O;  2OYI B;  2M5A B;  3HUS B;  3A0B E;  4JQ0 D;  1NU1 D;  2WSE J;  3H1K E;  3V5B A;  3A0H H;  3BAT A;  2JWA A;  4UHP B;  3II6 A;  1SFC C;  2WSS H;  1D7M A;  4D6T D;  3BRV B;  5AVY B;  3CWB G;  2FAE A;  1E79 H;  3TGU G;  2FFD C;  4Y99 C;  2ZFC A;  4W80 A;  1VF5 B;  5AVV B;  2GZJ A;  1R5L A;  4TT3 H;  2KOR A;  3HD7 D;  2XNX A;  3AE8 C;  2O01 H;  2QJY B;  2KK7 A;  1FZC A;  1OR5 A;  1QVF O;  1EDI A;  1PL5 A;  4RES B;  2JYG A;  4N78 D;  3L72 J;  1SFC A;  3FWL A;  1K8A Q;  1H8A A;  1KQF B;  3VP8 A;  3WU2 E;  2JU2 A;  2E75 C;  2Z4E A;  4GDO A;  3U1A A;  1S72 P;  1X3O A;  2CQ8 A;  4QKO A;  1JUN A;  2WT7 A;  1L0I A;  1EZV E;  4H0L B;  4IL6 E;  3SWK A;  4L73 A;  2E76 D;  3H4E A;  3RBX A;  3AE5 C;  2FYU D;  4R4M A;  3R2P A;  2AEF A;  4KHX A;  2N98 A;  1BAJ A;  2K0Y A;  1YIT P;  1PEM A;  4WY4 B;  2GUS A;  1T8Z A;  1LT9 A;  3P32 A;  2L5G B;  2M8L A;  2ROQ A;  1EC5 A;  1QEX A;  1VL2 A;  5CCG C;  1Q86 Q;  3P7K A;  2PEK A;  4C7N B;  4BRY B;  1FOS F;  1GPJ A;  2KB7 P;  3EJD A;  2Q3I A;  4LGD E;  4XFY A;  4NPE A;  1SQP E;  2ZXX A;  3IFM A;  5KAI E;  3I5C A;  2JR8 A;  3CWB J;  2LXB A;  4QMA A;  1PPJ G;  3Q1M A;  2N6Y A;  3D70 A;  4YPC A;  1EMV A;  1MZ9 A;  1ZOY C;  1CW5 A;  2MF4 A;  2M5A A;  1H88 A;  2E75 D;  2KOD A;  3CCL P;  2FFD A;  3M0A A;  2O01 J;  3L74 J;  1NKZ B;  3KZI E;  2QJK B;  4H0L D;  1KYO D;  1PPJ E;  4RKU J;  3DS2 A;  1DNY A;  3CXH E;  4C46 A;  1UJZ A;  2KSE A;  1IO4 A;  3MIW A;  3H1I D;  1G1I A;  4AYC A;  3CC4 P;  3P05 A;  2HYN A;  2WPV B;  1VQ6 P;  3OAK A;  1IFI A;  5APS A;  2DGY A;  1NQ4 A;  1M57 D;  3KHU A;  1KQG B;  1LNQ A;  3G4S P;  1Y9B A;  3TGU J;  1IK9 A;  1GL2 D;  2ZVO B;  1LTI C;  3E7K A;  4COP A;  4U0C A;  3E1I A;  3I56 P;  3U59 A;  3LRY A;  1VDF A;  5E79 H;  1WT6 A;  2K5X A;  3P8C E;  3EFG A;  3HYB A;  1KIL B;  2M0B A;  1LWU A;  2P67 A;  3MUD C;  5AVX B;  2IBZ D;  3B71 A;  1VQ8 P;  3SFD C;  1OMI A; 
#chains in the Genus database with same CATH homology
 2Z45 A;  1AUM A;  2M8P A;  2JYL A;  1Q86 Q;  1K30 A;  3RG6 C;  2PEK A;  3CCQ P;  5BS1 A;  1EIA A;  3DS4 A;  2E1M A;  1YHQ P;  3NTE A;  1Q7Y Q;  4XFY A;  2EG5 A;  2P9X A;  4U0A A;  4XFZ A;  3G1I A;  2EIA A;  4GR6 A;  2PEN A;  5BS2 A;  3I55 P;  2XV6 A;  2QEX P;  1YI2 P;  4PH1 A;  3M1M A;  1VQP P;  1M6N A;  3Q20 A;  2XXM A;  2LF4 A;  3CME P;  1EOQ A;  5F2O A;  4COC A;  2BUO A;  1YJN P;  3CC2 P;  1IUQ A;  1RO0 A;  1M74 A;  5DCK A;  3CD6 P;  3B5I A;  4IPY A;  4U0D A;  2OTJ P;  1VQM P;  3CCJ P;  4U0B A;  2EFJ A;  2OAR A;  1VQ7 P;  3CCE P;  2OTL P;  3DPH A;  3CC7 P;  3G6E P;  3G1G A;  2PEM A;  1VQO P;  1VQ9 P;  5HGN A;  1VQK P;  1K73 Q;  2CWO A;  5F2K A;  1Q81 Q;  2KOD A;  4WYM A;  3CCL P;  1QVF O;  4QNB A;  3VRL C;  1VQL P;  5HGO A;  5JPA A;  4GR2 A;  3DTJ A;  1RO2 A;  2PY8 A;  3WBH A;  3CXC O;  2JYG A;  1PEU A;  2PEJ A;  3CCS P;  1YJ9 P;  1A43 A;  1A8O A;  3DS2 A;  1M1K Q;  3G26 A;  3G29 A;  1N8R Q;  2ONT A;  1K8A Q;  3DS5 A;  2BQ1 E;  3MGE A;  2QA4 P;  4U0F A;  1W2B O;  1QRJ A;  3CMA P;  2BHV A;  1PEQ A;  4M0I A;  1S72 P;  3DS1 A;  3H0D A;  3CPW O;  1KD1 Q;  1JJ2 O;  1NJI Q;  2PEQ A;  5F2N A;  1K9M Q;  2Z44 A;  3G0V A;  3CC4 P;  2PEI A;  3P05 A;  4XFX A;  1Q82 Q;  3H4E A;  1KQS O;  1VQ6 P;  3CCM P;  1M6E X;  2DGY A;  3CCU P;  1M90 Q;  3H47 A;  3G4S P;  2Z46 A;  1VQ4 P;  3CCR P;  5HGM A;  3G28 A;  5I4T G;  2XT1 A;  1D1D A;  2PEO A;  5HGL A;  1VQN P;  4COP A;  4U0C A;  1BAJ A;  1E6J P;  1YIT P;  4XRQ A;  1KC8 Q;  1PEM A;  1ZMB A;  3G71 P;  4PH0 A;  3I56 P;  3OW2 O;  3DS0 A;  1PEO A;  3DS3 A;  2JO0 A;  3LRY A;  3CCV P;  1YIJ P;  3E2D A;  3HZQ A;  1YJW P;  3G21 A;  4U0E A;  3HYB A;  2M8L A;  1VQ5 P;  2L6E A;  2M8N A;  1RNI A;  1QVG O;  4XRO A;  1VQ8 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...