3CD6P

Co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 44
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cd6P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cd6P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cd6P02
3I56P 1YITP 1W2BO 3CCJP 1VQLP 3CC2P 1Q81Q 3CC7P 3G71P 3CCQP 3OW2O 3CD6P 2OTJP 1YJWP 1S72P 3CC4P 2QA4P 1VQ7P 1VQNP 3CCRP 1JJ2O 1VQ8P 3CMAP 1N8RQ 2OTLP 1VQ4P 1YJNP 1VQPP 3CCSP 1M1KQ 1KQSO 2QEXP 1YIJP 3CCVP 3CCUP 3CXCO 1QVGO 3I55P 1NJIQ 1K8AQ 3CMEP 3CCLP 1KD1Q 1VQ5P 1M90Q 3CPWO 1VQ9P 1YHQP 1Q7YQ 1YI2P 3G6EP 1YJ9P 1VQOP 3G4SP 1Q86Q 1VQ6P 1Q82Q 1VQKP 1K73Q 1K9MQ 3CCEP 1QVFO 1KC8Q 3CCMP 1VQMP
chains in the Genus database with same CATH superfamily
2FBWC 3IN6A 3M9QA 2M3EA 3EJDA 3CC7P 3G29A 2N6ZA 1M1JA 3L37A 1LP1B 2MR8A 5B5EE 3AEEC 4IL6E 3CCRP 2MJZA 3JCUH 2IYOA 4U0DA 1Q7YQ 1FZEA 4GR2A 5CCGD 1AJYA 3H1IE 5AW1B 3HYBA 1FZBA 2EIAA 2OGUA 1BGYJ 1OW6A 3VRLC 1IK9A 3PLNA 2GZJA 1N8RQ 1PZQA 2ZT9D 3E2DA 1SP4A 3EJBA 1L4AB 3GG2A 3BVHA 4PV1D 3L70E 2ZYDA 2KGEA 2FFDA 3TGUG 3TSIA 3CXHE 4COPA 1OW8A 3H1JG 1X22A 4NEOA 1BCCG 3B4SA 2OTLP 4TLFA 4U0EA 2P67A 2JBGA 3L75J 1SQQE 5AW4B 1QX8A 3MIWA 1SQBK 3GLMA 4O9BA 1M6EX 1YTZT 3UIAA 1LTIC 3WU2E 4IFMA 1FJPA 4ASWA 3BRVB 3M9HA 3OA7A 1OFCX 3CCLP 2PEOA 3P8CE 3V4WA 1BXIA 2D2CC 3NFQA 1M57D 1G2CB 3B5NA 1GL2A 3RG6C 1RF1C 2XKMA 1NTMJ 1GXGA 5AW5B 5KTBA 4L76A 1HJBA 2YXQB 3Q2YA 5KLVK 2IFNA 2KGAA 1HUCA 2KG6A 1NTKK 4HJGH 1URQC 1S5LX 1AFOA 5BU5A 1T3JA 2XDJA 4U7JA 1USEA 1A43A 1NVOA 5CHXA 2H7HA 2OTJP 2WSFH 3NXSA 3U59A 2JJLA 1PEOA 4ZKPA 2FVFA 2PY8A 4UHPB 4BRYB 3LIDA 3VOPA 1RF0A 2CNRA 2CG5B 2ZFCA 3EWKA 3B8EB 1EQ7A 1ZLLA 2PEMA 2P1JA 1JTHB 1T8KA 3NY7B 3RK3B 2N98A 1BGYE 3H6PA 2VSQA 3H47A 4RESB 1KILE 1HY8A 2HODA 1YJNP 4JYBA 2EG5A 3V2PA 4DG9A 5HV8A 3KXDA 3BCCG 3DS3A 2IBZI 2I1KA 3I56P 2KG8A 1LTGC 3IAOA 3TGUJ 2Z44A 3M06A 1JJ2O 3H1KG 3H1JJ 1L0LD 5KLVJ 1BCCJ 3RGUA 4PJ0H 1T8ZA 1FE6A 2W90A 3L75E 1H0TA 4M0IA 4UB6E 1K9MQ 4I2LC 2JU1A 1T6AA 2R3CA 2KNCA 1YIJP 5CMZA 2KI7B 2O01N 3A0HH 1QL1A 4YPCA 2WT7A 1SQXG 1VQ6P 1X0TA 1IMQA 4WY4B 1RQVA 2E75B 3E7KA 1NTME 3FX0A 3PTZA 1BSNA 2W6JH 3CWBG 2OYHA 2QJYB 3EJEA 2WSSH 3NTEA 2GUVA 3AEAC 3FXDA 2PAJA 2FQ0A 4B86A 2FQ2A 3AEDC 3HD7A 5K5GB 2W27A 4QNBA 1NKNA 1RE3C 1A8OA 2JO1A 2Z5IA 2M5AA 2BHVA 4GODA 1LTJB 3AEGC 2ZXXA 2N1TB 2Q7CA 2KGDA 2LXBA 1QGKB 1HVVA 3B5ND 1RO0A 1GMJA 1N7LA 2LF4A 2W83C 3TF5A 3IFMA 4OVNF 4H13B 1VKUA 3DS1A 2OTKE 4WWIA 1OWAA 2K37A 3L74J 3H32B 3OAKA 2J5UA 3KQGA 4U3FG 4IFDK 5EW5E 1NTZG 1MV8A 3TDKA 1K30A 2NPSD 3BCCJ 2PEQA 2WWWA 1UNKA 2WSFJ 4N78D 2E74B 3SFEC 1NU1G 2KWLA 2FHSC 3CCEP 3ABVC 4GOFA 3KYQA 3CCMP 1GK6A 1W2BO 2GZGA 2FYNB 3JCUE 2LIUA 3GKLC 3TGUE 2PRRA 3H1JE 2POHA 3H1KJ 1HGVA 2HYNA 5KKZB 1BCCE 3DTJA 1W5CE 1S9KD 1GW3A 1AQ5A 1K73Q 1EDIA 5I4TG 1Q90D 1XTCC 4U0BA 1XTGB 2K2QA 2BASA 2PGDA 2XU6A 2L9FA 2ZYGA 1EMVA 1QVGO 2IYPA 1NU1K 5EFWB 2E1MA 2E76B 1OVVA 1QVFO 1PP9G 2FYUG 1QLED 1SQXJ 2M8LA 5APUA 4RKUJ 2RMZA 2KXPB 4QKOA 1ZN5A 2L4BA 3GW6A 1IFDA 2AVAA 3RL0B 3ZDMA 2KSEA 2KG9A 1Z6MA 1NAFA 1N7SB 3V2RA 1GW4A 2IBZD 2H89C 3L36A 2JKVA 5BVZA 5AVRB 3EFGA 4HB1A 4IPYA 2H8PD 4JQ0D 1FDOA 2BCCG 1RO2A 1NKZB 1LTTC 3MGNA 4HKGA 1RE3A 5KP6B 5HVCA 2GA1A 5AW8B 2L22A 1HJ0A 1Y9BA 2WPQA 2B87B 1KLPA 2H88C 1LT9B 1MZ8A 5CBOA 4PD4D 5BU8B 3AEFC 4BPGA 2N5IA 2ZYAA 3CWBD 4WY4D 2E75D 1VPCA 3WMM0 3D6YA 3IR9A 4W80A 1NTZJ 3RK3E 2RH0A 1ZR4A 1KILB 1FOSE 3EFFK 3BCCE 1NOHA 2KZJA 2C0WA 3PP5A 5KLIB 2YMYA 1Y8AA 2JQ4A 1NU1J 3VMYA 1JY2P 1URQD 4PXHB 4I7ZB 3VTPC 1VQNP 2L91A 2FXOA 3AE4C 5L8RJ 1CW5A 3SWFA 3H0DA 3T97B 5H2FH 1DD4A 3JC22 3H1KE 2AXTH 2IPPA 2WSEH 2CQ8A 1L4AC 3BRTB 1KQLA 1KN7A 3P7KA 2KLUA 2KOQA 1SQPG 2N1TD 4NPFX 3FGAD 5BS1A 1SQVG 5GTIE 2KZIA 2M0BA 4YXWH 5APQA 4U3FD 3MUDC 3PHLA 4R0MA 2KS1B 2NO8A 1GDTA 3G6EP 2WPSA 2OQQA 3Q1MA 2Z4EA 3F89A 1SQXE 2FYUJ 1OMIA 2AFDA 3LW5H 4K3AA 1KV4A 3N7NA 2E74D 2P58A 3QH9A 3CWBE 2N5HA 3K5BA 2A45H 5AVYB 3KZIH 2PEKA 3D6ZA 2YO3A 2QM8A 1R8EA 2ZXEB 5DJUB 1UIXA 1USDA 1SQVK 3CXHD 4R4MA 2XZRA 2QM7A 2BUOA 2ROQA 5HGLA 2J58A 2BCCJ 3CCUP 1JY3N 3HE4A 3AE7C 5KAIH 1QL2A 3IF4A 1SFCB 1GZLA 1NO4A 3U1CA 3H1HG 1LTAC 5JPAA 3DS0A 2YXRB 1FZCB 3CC2P 1PP9D 2HG5D 1DEEG 1SLQA 2A45G 1FC2C 5AVWB 5GTHH 2G3AA 3E1RA 5AW7B 1HTLC 4U3FE 3P8CD 3L71G 2QJKB 2Q3IA 4QMAA 1NTZE 1LP1A 3LIEA 3CX5H 1LT1A 3LRYA 1X8YA 3RL0D 4C7NB 1D7MA 1NU1E 1SQBG 3RK3C 2K3RA 2OYOA 4A7PA 5E79H 2JR8A 3AEBC 3CX5I 4AQRD 4U0AA 2BCCD 1ZRTD 1QEXA 3U43A 3F5HA 3G4SP 2AEMA 4WB4A 3HE5B 3KDPB 2C0XA 4N6JA 3M91A 5APWA 1G1JA 1SQPJ 4ASVA 2AXCA 1L4AA 3JSVC 1SQVJ 5KLVG 3C1LA 1L0NG 2K88A 2B9BA 1NTKG 2I1JA 1AVYA 1PEMA 2KYVA 4JPZB 1PP9E 2X2BA 2FYUE 3MUDA 1BGYD 2WSEJ 2QA4P 4ZKUA 4XROA 1U7JA 1S5LE 1KILD 4HH2A 4I6MC 4GT1A 1DIPA 2FVEA 1NH4A 2YNYA 1KD1Q 3Q20A 3BATA 1QRJA 1ZMEC 2LL8A 2FKWB 1KC8Q 4PH1A 4OH8B 3PRJA 4WY4C 1OZHA 2E75C 5TISE 3HZQA 2PP6A 4K35A 1RE4C 2C9NY 1L0NK 1FR2A 1G2CA 1OVRA 2JWAA 1M1KQ 3EQ2A 3SFDC 2O3JA 3MP7B 2QJYC 2BCCE 2KLVA 3H1LJ 1ZRTE 4XFZA 2GYKA 2AFEA 4AYCA 2NPSA 3L75D 3LW5J 1M74A 1N86A 3AE9C 3H1HJ 4H2XC 1K05A 1SS1A 2QVAA 2M8RA 2K9JB 3NTNA 2YKOA 1LTJC 3RL0g 2N1TC 3CXCO 1R5SA 4WBAA 2KW2A 4PH0A 1PEQA 3WUUA 1KFNA 2R5DA 3O6QB 2A06G 2OYIB 1KYOH 3L71J 1GTWA 4H13C 2K93A 2YKQA 2ZJSE 3CL3D 1JM0A 3L74G 3Q3DA 1NTMD 4BRYA 3DPHA 4NPEA 1N73B 1SQBJ 1EIAA 4BPFA 1EXJA 3G0VA 3CI9A 2XNXA 1JB0J 2HODB 5M1BA 1YTZI 4RO0A 5AW0B 2E74C 2Q1KA 2QIWA 2NRGA 1JCDA 5HGMA 1N2DC 3USSA 2FYNC 1SQPE 2WSCH 4H0LB 2LKMA 1SQVE 3MGEA 5KKZC 1L0NJ 1KB9H 3G1GA 5AW3B 2K0YA 4UB8H 1NTKJ 4H44B 3V5BA 5AVSB 1FOSF 2LPKA 1L0IA 5KAFE 3G3ZA 2B88A 1KB9I 3AE8C 2DW3A 2IFMA 2XV5A 5H2FE 2AXTE 3RK2B 1KQGB 1GU5A 1KQSO 2KB7P 2R3SA 1FBMA 2VLQA 3CPWO 1YBKA 1HF9A 3L73G 3ITKA 1Q82Q 2E76C 1P84H 1IFMA 1KFMA 2Q6QA 3HTKB 3BASA 2N9YB 3PH0A 2LR2A 1L4AD 3TGUD 2W6BA 2QE7H 1JO5A 1RF1A 3FXEA 3H1JD 3RL0C 5KLVD 1A02J 2E5YA 1BCCD 4WY4A 3WUVA 3V4QA 2OYHB 3RBXA 5CCHC 1RE4A 2I8DA 2M3BA 1T2KC 1H89A 1N7SC 5APTA 1EC5A 3S9OA 1E0HA 2V7QH 1EZVI 3SWKA 4D6TJ 3H1HE 3HD7B 1URQA 3SWYA 1RQUA 2M5RA 3PJSK 1PGJA 2BQ1E 3KZIE 2LMLA 1RH5B 3I5CA 3LMOA 2GUSA 2HR3A 2RKLA 2O1JA 4Y28J 3L71E 3M0AA 2CGQA 1LTJA 3VMXA 1CSBA 1EZVG 2N1TA 3CCQP 1GPJA 1CZQA 4BPHA 1MFZA 1FZGA 1EXIA 3DS2A 1BE3G 2LKIA 1LT9C 1SQBE 3D71A 1OIPA 3G1IA 2H43A 2PENA 2LIWA 3TYYA 1KILC 3H32A 1LTSC 4H2WC 5KLIC 2O1KA 5GTHE 2FAEA 2EHTA 4IZ6A 1MKMA 3HUSB 4I7ZC 5AVVB 4LLHA 1VQ4P 2RN0A 2WMMA 4OGQB 3P05A 1CI6B 1M90Q 3CX5E 5KLVE 1IJDB 1L0NE 2XZ0D 1ZMBA 1NTKE 2XZ1C 1IFIA 5E79E 2ONTA 1G1IA 1FZFA 2B89A 3L74D 1M7LA 2JEEA 3P32A 2AEJA 4Y99B 3S4RA 5CJ0A 1VDFA 1L0HA 3GZMA 5BS2A 1S1CX 2GM4A 3RK3D 2MY5A 2K92A 2WSCJ 3HRNA 5APXA 3BCCD 5F2OA 3L73J 4KT0J 2KP8A 1T3UA 3CCJP 1WT6A 3M1MA 1AQTA 1H8AA 2FXPA 3L72J 4GOEA 2VLOA 2GDWA 3H1KD 3M0DC 3C8VA 2P10A 3C9IA 3CLQA 1PGQA 4ZNCA 4H0LD 4GKGA 2XXMA 3TNUA 5AVZB 5CCHA 1HH0A 1J2JB 4XRQA 3E1IA 4EDFA 4Z1MH 2ZT9B 3GHGB 1SFCC 2A06E 1SQXD 1FZCC 2IX7C 3MHVA 5KJ7D 4PV1B 2JP3A 3L74E 1SQQK 1RY3A 1DNYA 1BE3J 2AEFA 2GZFA 2B87A 3MTUE 2V7QJ 2KGCA 2KSJA 2FY8A 2QJKC 5AVUB 2ZVNB 1IK7A 1LT9A 5HGOA 1IUQA 1X9VA 3G71P 1NWQA 1PPJG 2FADA 2K5XA 2L5GB 2CWOA 2KOPA 1KILA 5AW2B 2JO0A 2MVVA 4GDOA 3H1IJ 4MN4C 2IZ0A 5CZDB 1EDJA 3KPEA 5F2NA 4JYCA 2YO2A 3T97A 1IMPA 3A0BH 3CC4P 3Q5RA 2KK7A 3FWNA 4H13D 2E5TA 2QJPB 1Q2NA 4LGDE 1E79H 4DZOA 1Y47A 1NTZD 4RJTA 2XT1A 3L73E 5CBNA 2YIUB 4LC1A 1NU1D 1E6JP 3OW2O 4PJ0E 1GU4A 1KB9E 2KS1A 4BWNA 3CMAP 4UB8E 1JCCA 2L0QA 2QSIA 2KUBA 3G21A 3GMAA 1SQQJ 2KORA 1D1DA 3G9RA 1IFNA 2R32A 3MZWB 4W7ZA 1JY2N 2WITA 2A45I 2IZ1A 3A0HE 1J1DB 4N3YB 2EHSA 1IFJA 3H1LG 1P84E 1YJ9P 2P2UA 5TJHA 2J59M 2JYLA 2Q3EA 2HPCB 1DX7A 4CA3A 2R5BA 2FYUD 1ZOYC 1EDKA 2JB0A 1LWUB 2O01H 1EOQA 1EZVE 1OX3A 3FWLA 3W68A 2WPTA 2E76D 3G28A 1M1JB 1SFCA 3DS5A 1BE3E 1BDCA 2K0DX 4JBZA 1FZCA 2OYIC 2SPZA 4KJMA 2ZVOB 2OARA 1RF0C 2N9BA 1PIXA 1LGHB 1L0LG 1N73C 1S4XA 5CCHD 1T2KD 2Q9IA 1N7SD 4NPDA 1KTMA 2ERHA 2PNGA 3U1AA 1VF5B 1NTMK 4C7NA 1OXZA 2MVUA 3Q5PA 4XFYA 2QG4A 1MUUA 1IC2A 3RG2A 1JNMA 2FFDB 2VRSA 2FYZA 4H0LC 2DGYA 4IL6X 1NJIQ 2YMKA 2LTEA 4C46A 2KODA 3HE5A 2K1AA 2PEIA 4H44C 1R5LA 1KZUB 1ZW0A 1X79B 2Y0CA 1AV1A 1YQ4C 1L0LK 4M3LA 2L6EA 1J1EB 3RK2C 1VQ8P 4DCKA 4L75A 4DJGA 5B66H 4EI2A 2QEXP 2KOOA 1PPJD 4WVZA 1YYCA 4WYMA 5KJ7C 4XFJA 1JUNA 3B71A 1Q86Q 4W7YA 1DEBA 3CE7A 3S1KA 3B5NB 1GL2B 1HWTC 2QNWA 1SQPD 2KOGA 5APSA 1FS0E 1SQVD 1K8AQ 2QRXA 3B4QA 2OYHC 2M8NA 2M8PA 1VQMP 2FACA 4D6TG 2NPSB 3WUTA 1U7MA 3HD7C 3DS4A 4YTPC 3VN0A 3I55P 2CK3H 5KP8B 2JDIH 1A02F 3AE2C 3AE1C 2K9JA 1YQ3C 4GIFA 1JMMA 4XE5B 2KIKA 1NAYA 5KP7B 2WTYA 1KYOI 1L0LJ 3O6QA 2OYIA 2YKPA 2HFED 2DNWA 1PPJE 1VQ9P 1JTHA 3H1LD 4L74A 4CPGA 2O01J 1N73A 2FVAA 1UJZA 4MRTC 1VHNA 1FJKA 1Q81Q 3H1HD 4JF7A 3HUSC 1VL2A 5EJDA 1KQFB 1ZP0C 5APYA 1SFCD 4OGQC 5GTIH 5DCKA 3GZLA 4XA4A 1AA0A 1AYIA 2P7JA 4HYTB 3L71D 4EYYQ 4TT3H 3WBHA 2WVRA 1H0TB 2K94A 1RNIA 1BAJA 1PFIA 2E43A 2JU2A 1SQBD 4Y99C 2KNCB 1M6NA 4PD4H 2IBZG 2XV6A 2C9LY 2XNDH 1PGPA 3A0BE 3A5TA 1JOCA 2BEQD 4L73A 1YITP 4PD4I 1IZNB 2WT7B 1OVUA 1WMKA 4EOTA 3II6A 5KJ7A 1VF5D 1VQ7P 3L72G 1EDLA 1P84I 3TK1A 4I1LA 3SSUA 2D2CB 3CX5D 1YHQP 1L0ND 3H1LE 3HTKA 1RF1B 2HLOA 1NTKD 4COCA 1VQKP 2JAZA 2WZ7A 1S3JA 1W2EA 4AUWA 1FDMA 5CCGC 1L2PA 1URQB 2M5AB 2E42A 2FXMA 5B5EH 5C39A 4IL6H 5AW9B 2V4HA 2ZT9C 3GHGC 3V2QA 3A2AA 3AE3C 1DV5A 1K04A 1IFPA 3Q5SA 4PV1C 7CEIA 2K9YA 2CPSA 1L0LE 4IOIH 3AECC 2Q5UA 1FDIA 5KAIE 1GL2D 1SQXK 2GZEA 4C7RA 4XFXA 5AVQB 1KORA 5DJTB 1JEKA 3VYIA 2ITAA 2W8ZA 4D6TD 3G26A 2KR5A 3AE6C 3CXHH 3KHUA 2GZIA 2VLPA 3CMEP 3H1IG 4YXDC 1M56D 4R4LA 3H25A 4KHXA 3HUSA 3CXHI 2KOSA 2A06D 4DT0A 1GK4A 1CI6A 1DD3A 2NZ2A 3W67A 3A7OA 1OW7A 2PEJA 3RBZA 2FQ1A 3O8ZA 1JY2O 5HGNA 1BDDA 1VQ5P 3L70G 1MFTA 1S5LH 3WU2H 1U57A 4OWFA 2QJPC 1NQ4A 2WPRA 1TU3F 1FZAA 1PEUA 3R4YA 5CJ4A 1JY3O 5F2KA 2YIUC 3N4XA 1AVOA 2G8YA 3NMDA 5TISH 1NTZK 1KYOD 1SQQG 2Z5HA 4BXLA 1S2EA 1BSHA 2ZAEB 2BEZF 2R44A 5B66E 2Z46A 2VLNA 4D6TE 3H4EA 1IO4A 1MZ9A 4H44D 3CWBJ 2N50A 1J1DC 1HBWA 1N7SA 3TNUB 2UWJE 1Z56A 3VMZA 4N78E 5CCGA 1FU1A 4EIJA 3RK2D 1DH3A 1M8OB 2GDYA 1LNQA 4U0CA 3A3YB 3L73D 4IFFA 1X3OA 1KMIZ 2Y9ZA 1KB9D 1JMBA 1LWUC 3GHGA 4PWVB 2WPVB 3L72D 1M1JC 2K0XA 3V6IA 2JWDA 1S9KE 1GXHA 4H2YC 2FYUK 2EFJA 2MD9A 1E5WA 1SVFA 2Y9YA 1PGOA 2D2CD 3R2PA 4U3FJ 1KYOE 2MKVA 3VP8A 2MF4A 1AF8A 4F37A 1P84D 2WQYC 1VF5C 3VMAA 3HD7D 2W6AA 4GR6A 1BGYG 3B5IA 4DOJA 1ZR2A 2JGPA 3D70A 4UB6H 5KAFH 1LTBC 1AUMA 1EZVD 2FFDC 1VQPP 1ZXGA 3CCSP 1JY3P 1F80D 1BE3D 2Y0EA 2LOLA 1PV3A 1ACPA 1HGZA 3L70J 5APVA 4U0FA 2IBZE 1RHZB 5AVXB 2MR7A 2IDBA 1UIIA 3MD0A 2PFXA 3CD6P 1NGMB 1J1EC 2LXCB 3GJNA 2P9XA 3L75G 3L72E 3GF7A 1FAVA 1VQOP 3H1ID 5AW6B 3OJAB 1ZNVA 1PP9J 4OGQD 3B5NC 1GL2C 3GF3A 3L35A 4HKZH 4PD4E 1WRGA 3M0DA 3P8MC 2N6YA 4ZMDA 1NYHA 1CEIA 1ZV8A 3L4FA 2Y0DA 3AE5C 3L70D 1NTMG 1SQPK 3HE4B 3VP9A 3V2NA 2JYGA 1HQBA 1VQLP 2NPSC 1H88A 1PL5A 1YJWP 1OR5A 1S72P 5AVTB 3M9BA 3CCVP 2AF8A 1LJ2A 1YI2P 2HPCA 1SQQD 2CPBA 1NHLA 2GDXA 2Z45A 1GD2E 3QWOC 1LWUA
chains in the Genus database with same CATH topology
2XT1A 5F2KA 1W2BO 2XXMA 5HGMA 3CC7P 3G29A 3CCQP 1E6JP 3OW2O 3CCMP 2BUOA 3DS2A 2QA4P 1AUMA 4XROA 3CCRP 3CMAP 5HGLA 1VQPP 3CCSP 3G21A 1YIJP 3CCUP 3MGEA 2DGYA 1NJIQ 4XRQA 3G1IA 1KD1Q 2KODA 3Q20A 3DTJA 3G1GA 1VQ9P 4U0DA 1Q7YQ 2PENA 4GR2A 1D1DA 1QRJA 2PEIA 4U0FA 1VQ6P 3HYBA 1K73Q 2EIAA 1A43A 5JPAA 4PH1A 1KC8Q 3DS0A 3CC2P 1Q81Q 2Z46A 3VRLC 3HZQA 5I4TG 3CD6P 4U0BA 2OTJP 2L6EA 3H4EA 1VQNP 1VQ8P 1N8RQ 1PEOA 1VQ4P 2PY8A 1M1KQ 2P9XA 3H0DA 2QEXP 3P05A 1KQSO 3NTEA 1QVGO 3E2DA 5DCKA 1M90Q 3CPWO 4XFZA 4WYMA 1ZMBA 1YJ9P 1VQOP 4XFXA 2E1MA 1Q86Q 1M74A 2PEMA 1Q82Q 1QVFO 2JYLA 2ONTA 5HGOA 4QNBA 3LRYA 3WBHA 1IUQA 2M8LA 1A8OA 4U0CA 4COPA 3G71P 2BHVA 1RNIA 5BS1A 3H47A 1EOQA 1BAJA 3G26A 2OTLP 2CWOA 1YJNP 2JO0A 2EG5A 3G28A 3CXCO 3DS5A 4U0EA 4U0AA 4PH0A 1K8AQ 3CMEP 1PEQA 1M6NA 5BS2A 2XV6A 3DS3A 1RO0A 3G6EP 2LF4A 3G4SP 2M8NA 2EFJA 2M8PA 3DS1A 5F2OA 2OARA 1VQMP 3I56P 1YITP 2JYGA 3CCJP 5F2NA 1VQLP 4IPYA 3M1MA 1M6EX 3DPHA 3DS4A 1YJWP 1S72P 3CC4P 2Z44A 1VQ7P 2PEJA 1JJ2O 1EIAA 1RO2A 3CCVP 2BQ1E 5HGNA 3G0VA 3I55P 3CCLP 2PEOA 1VQ5P 1YHQP 1K30A 1YI2P 3RG6C 2PEQA 2Z45A 1PEUA 4GR6A 4XFYA 4M0IA 4COCA 2PEKA 1VQKP 1K9MQ 3CCEP 1PEMA 3B5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 P;  1YIT P;  1W2B O;  3CCJ P;  1VQL P;  3CC2 P;  1Q81 Q;  3CC7 P;  3G71 P;  3CCQ P;  3OW2 O;  3CD6 P;  2OTJ P;  1YJW P;  1S72 P;  3CC4 P;  2QA4 P;  1VQ7 P;  1VQN P;  3CCR P;  1JJ2 O;  1VQ8 P;  3CMA P;  1N8R Q;  2OTL P;  1VQ4 P;  1YJN P;  1VQP P;  3CCS P;  1M1K Q;  1KQS O;  2QEX P;  1YIJ P;  3CCV P;  3CCU P;  3CXC O;  1QVG O;  3I55 P;  1NJI Q;  1K8A Q;  3CME P;  3CCL P;  1KD1 Q;  1VQ5 P;  1M90 Q;  3CPW O;  1VQ9 P;  1YHQ P;  1Q7Y Q;  1YI2 P;  3G6E P;  1YJ9 P;  1VQO P;  3G4S P;  1Q86 Q;  1VQ6 P;  1Q82 Q;  1VQK P;  1K73 Q;  1K9M Q;  3CCE P;  1QVF O;  1KC8 Q;  3CCM P;  1VQM P; 
#chains in the Genus database with same CATH topology
 2FBW C;  3IN6 A;  3M9Q A;  2M3E A;  3EJD A;  3CC7 P;  3G29 A;  2N6Z A;  1M1J A;  3L37 A;  1LP1 B;  2MR8 A;  5B5E E;  3AEE C;  4IL6 E;  3CCR P;  2MJZ A;  3JCU H;  2IYO A;  4U0D A;  1Q7Y Q;  1FZE A;  4GR2 A;  5CCG D;  1AJY A;  3H1I E;  5AW1 B;  3HYB A;  1FZB A;  2EIA A;  2OGU A;  1BGY J;  1OW6 A;  3VRL C;  1IK9 A;  3PLN A;  2GZJ A;  1N8R Q;  1PZQ A;  2ZT9 D;  3E2D A;  1SP4 A;  3EJB A;  1L4A B;  3GG2 A;  3BVH A;  4PV1 D;  3L70 E;  2ZYD A;  2KGE A;  2FFD A;  3TGU G;  3TSI A;  3CXH E;  4COP A;  1OW8 A;  3H1J G;  1X22 A;  4NEO A;  1BCC G;  3B4S A;  2OTL P;  4TLF A;  4U0E A;  2P67 A;  2JBG A;  3L75 J;  1SQQ E;  5AW4 B;  1QX8 A;  3MIW A;  1SQB K;  3GLM A;  4O9B A;  1M6E X;  1YTZ T;  3UIA A;  1LTI C;  3WU2 E;  4IFM A;  1FJP A;  4ASW A;  3BRV B;  3M9H A;  3OA7 A;  1OFC X;  3CCL P;  2PEO A;  3P8C E;  3V4W A;  1BXI A;  2D2C C;  3NFQ A;  1M57 D;  1G2C B;  3B5N A;  1GL2 A;  3RG6 C;  1RF1 C;  2XKM A;  1NTM J;  1GXG A;  5AW5 B;  5KTB A;  4L76 A;  1HJB A;  2YXQ B;  3Q2Y A;  5KLV K;  2IFN A;  2KGA A;  1HUC A;  2KG6 A;  1NTK K;  4HJG H;  1URQ C;  1S5L X;  1AFO A;  5BU5 A;  1T3J A;  2XDJ A;  4U7J A;  1USE A;  1A43 A;  1NVO A;  5CHX A;  2H7H A;  2OTJ P;  2WSF H;  3NXS A;  3U59 A;  2JJL A;  1PEO A;  4ZKP A;  2FVF A;  2PY8 A;  4UHP B;  4BRY B;  3LID A;  3VOP A;  1RF0 A;  2CNR A;  2CG5 B;  2ZFC A;  3EWK A;  3B8E B;  1EQ7 A;  1ZLL A;  2PEM A;  2P1J A;  1JTH B;  1T8K A;  3NY7 B;  3RK3 B;  2N98 A;  1BGY E;  3H6P A;  2VSQ A;  3H47 A;  4RES B;  1KIL E;  1HY8 A;  2HOD A;  1YJN P;  4JYB A;  2EG5 A;  3V2P A;  4DG9 A;  5HV8 A;  3KXD A;  3BCC G;  3DS3 A;  2IBZ I;  2I1K A;  3I56 P;  2KG8 A;  1LTG C;  3IAO A;  3TGU J;  2Z44 A;  3M06 A;  1JJ2 O;  3H1K G;  3H1J J;  1L0L D;  5KLV J;  1BCC J;  3RGU A;  4PJ0 H;  1T8Z A;  1FE6 A;  2W90 A;  3L75 E;  1H0T A;  4M0I A;  4UB6 E;  1K9M Q;  4I2L C;  2JU1 A;  1T6A A;  2R3C A;  2KNC A;  1YIJ P;  5CMZ A;  2KI7 B;  2O01 N;  3A0H H;  1QL1 A;  4YPC A;  2WT7 A;  1SQX G;  1VQ6 P;  1X0T A;  1IMQ A;  4WY4 B;  1RQV A;  2E75 B;  3E7K A;  1NTM E;  3FX0 A;  3PTZ A;  1BSN A;  2W6J H;  3CWB G;  2OYH A;  2QJY B;  3EJE A;  2WSS H;  3NTE A;  2GUV A;  3AEA C;  3FXD A;  2PAJ A;  2FQ0 A;  4B86 A;  2FQ2 A;  3AED C;  3HD7 A;  5K5G B;  2W27 A;  4QNB A;  1NKN A;  1RE3 C;  1A8O A;  2JO1 A;  2Z5I A;  2M5A A;  2BHV A;  4GOD A;  1LTJ B;  3AEG C;  2ZXX A;  2N1T B;  2Q7C A;  2KGD A;  2LXB A;  1QGK B;  1HVV A;  3B5N D;  1RO0 A;  1GMJ A;  1N7L A;  2LF4 A;  2W83 C;  3TF5 A;  3IFM A;  4OVN F;  4H13 B;  1VKU A;  3DS1 A;  2OTK E;  4WWI A;  1OWA A;  2K37 A;  3L74 J;  3H32 B;  3OAK A;  2J5U A;  3KQG A;  4U3F G;  4IFD K;  5EW5 E;  1NTZ G;  1MV8 A;  3TDK A;  1K30 A;  2NPS D;  3BCC J;  2PEQ A;  2WWW A;  1UNK A;  2WSF J;  4N78 D;  2E74 B;  3SFE C;  1NU1 G;  2KWL A;  2FHS C;  3CCE P;  3ABV C;  4GOF A;  3KYQ A;  3CCM P;  1GK6 A;  1W2B O;  2GZG A;  2FYN B;  3JCU E;  2LIU A;  3GKL C;  3TGU E;  2PRR A;  3H1J E;  2POH A;  3H1K J;  1HGV A;  2HYN A;  5KKZ B;  1BCC E;  3DTJ A;  1W5C E;  1S9K D;  1GW3 A;  1AQ5 A;  1K73 Q;  1EDI A;  5I4T G;  1Q90 D;  1XTC C;  4U0B A;  1XTG B;  2K2Q A;  2BAS A;  2PGD A;  2XU6 A;  2L9F A;  2ZYG A;  1EMV A;  1QVG O;  2IYP A;  1NU1 K;  5EFW B;  2E1M A;  2E76 B;  1OVV A;  1QVF O;  1PP9 G;  2FYU G;  1QLE D;  1SQX J;  2M8L A;  5APU A;  4RKU J;  2RMZ A;  2KXP B;  4QKO A;  1ZN5 A;  2L4B A;  3GW6 A;  1IFD A;  2AVA A;  3RL0 B;  3ZDM A;  2KSE A;  2KG9 A;  1Z6M A;  1NAF A;  1N7S B;  3V2R A;  1GW4 A;  2IBZ D;  2H89 C;  3L36 A;  2JKV A;  5BVZ A;  5AVR B;  3EFG A;  4HB1 A;  4IPY A;  2H8P D;  4JQ0 D;  1FDO A;  2BCC G;  1RO2 A;  1NKZ B;  1LTT C;  3MGN A;  4HKG A;  1RE3 A;  5KP6 B;  5HVC A;  2GA1 A;  5AW8 B;  2L22 A;  1HJ0 A;  1Y9B A;  2WPQ A;  2B87 B;  1KLP A;  2H88 C;  1LT9 B;  1MZ8 A;  5CBO A;  4PD4 D;  5BU8 B;  3AEF C;  4BPG A;  2N5I A;  2ZYA A;  3CWB D;  4WY4 D;  2E75 D;  1VPC A;  3WMM 0;  3D6Y A;  3IR9 A;  4W80 A;  1NTZ J;  3RK3 E;  2RH0 A;  1ZR4 A;  1KIL B;  1FOS E;  3EFF K;  3BCC E;  1NOH A;  2KZJ A;  2C0W A;  3PP5 A;  5KLI B;  2YMY A;  1Y8A A;  2JQ4 A;  1NU1 J;  3VMY A;  1JY2 P;  1URQ D;  4PXH B;  4I7Z B;  3VTP C;  1VQN P;  2L91 A;  2FXO A;  3AE4 C;  5L8R J;  1CW5 A;  3SWF A;  3H0D A;  3T97 B;  5H2F H;  1DD4 A;  3JC2 2;  3H1K E;  2AXT H;  2IPP A;  2WSE H;  2CQ8 A;  1L4A C;  3BRT B;  1KQL A;  1KN7 A;  3P7K A;  2KLU A;  2KOQ A;  1SQP G;  2N1T D;  4NPF X;  3FGA D;  5BS1 A;  1SQV G;  5GTI E;  2KZI A;  2M0B A;  4YXW H;  5APQ A;  4U3F D;  3MUD C;  3PHL A;  4R0M A;  2KS1 B;  2NO8 A;  1GDT A;  3G6E P;  2WPS A;  2OQQ A;  3Q1M A;  2Z4E A;  3F89 A;  1SQX E;  2FYU J;  1OMI A;  2AFD A;  3LW5 H;  4K3A A;  1KV4 A;  3N7N A;  2E74 D;  2P58 A;  3QH9 A;  3CWB E;  2N5H A;  3K5B A;  2A45 H;  5AVY B;  3KZI H;  2PEK A;  3D6Z A;  2YO3 A;  2QM8 A;  1R8E A;  2ZXE B;  5DJU B;  1UIX A;  1USD A;  1SQV K;  3CXH D;  4R4M A;  2XZR A;  2QM7 A;  2BUO A;  2ROQ A;  5HGL A;  2J58 A;  2BCC J;  3CCU P;  1JY3 N;  3HE4 A;  3AE7 C;  5KAI H;  1QL2 A;  3IF4 A;  1SFC B;  1GZL A;  1NO4 A;  3U1C A;  3H1H G;  1LTA C;  5JPA A;  3DS0 A;  2YXR B;  1FZC B;  3CC2 P;  1PP9 D;  2HG5 D;  1DEE G;  1SLQ A;  2A45 G;  1FC2 C;  5AVW B;  5GTH H;  2G3A A;  3E1R A;  5AW7 B;  1HTL C;  4U3F E;  3P8C D;  3L71 G;  2QJK B;  2Q3I A;  4QMA A;  1NTZ E;  1LP1 A;  3LIE A;  3CX5 H;  1LT1 A;  3LRY A;  1X8Y A;  3RL0 D;  4C7N B;  1D7M A;  1NU1 E;  1SQB G;  3RK3 C;  2K3R A;  2OYO A;  4A7P A;  5E79 H;  2JR8 A;  3AEB C;  3CX5 I;  4AQR D;  4U0A A;  2BCC D;  1ZRT D;  1QEX A;  3U43 A;  3F5H A;  3G4S P;  2AEM A;  4WB4 A;  3HE5 B;  3KDP B;  2C0X A;  4N6J A;  3M91 A;  5APW A;  1G1J A;  1SQP J;  4ASV A;  2AXC A;  1L4A A;  3JSV C;  1SQV J;  5KLV G;  3C1L A;  1L0N G;  2K88 A;  2B9B A;  1NTK G;  2I1J A;  1AVY A;  1PEM A;  2KYV A;  4JPZ B;  1PP9 E;  2X2B A;  2FYU E;  3MUD A;  1BGY D;  2WSE J;  2QA4 P;  4ZKU A;  4XRO A;  1U7J A;  1S5L E;  1KIL D;  4HH2 A;  4I6M C;  4GT1 A;  1DIP A;  2FVE A;  1NH4 A;  2YNY A;  1KD1 Q;  3Q20 A;  3BAT A;  1QRJ A;  1ZME C;  2LL8 A;  2FKW B;  1KC8 Q;  4PH1 A;  4OH8 B;  3PRJ A;  4WY4 C;  1OZH A;  2E75 C;  5TIS E;  3HZQ A;  2PP6 A;  4K35 A;  1RE4 C;  2C9N Y;  1L0N K;  1FR2 A;  1G2C A;  1OVR A;  2JWA A;  1M1K Q;  3EQ2 A;  3SFD C;  2O3J A;  3MP7 B;  2QJY C;  2BCC E;  2KLV A;  3H1L J;  1ZRT E;  4XFZ A;  2GYK A;  2AFE A;  4AYC A;  2NPS A;  3L75 D;  3LW5 J;  1M74 A;  1N86 A;  3AE9 C;  3H1H J;  4H2X C;  1K05 A;  1SS1 A;  2QVA A;  2M8R A;  2K9J B;  3NTN A;  2YKO A;  1LTJ C;  3RL0 g;  2N1T C;  3CXC O;  1R5S A;  4WBA A;  2KW2 A;  4PH0 A;  1PEQ A;  3WUU A;  1KFN A;  2R5D A;  3O6Q B;  2A06 G;  2OYI B;  1KYO H;  3L71 J;  1GTW A;  4H13 C;  2K93 A;  2YKQ A;  2ZJS E;  3CL3 D;  1JM0 A;  3L74 G;  3Q3D A;  1NTM D;  4BRY A;  3DPH A;  4NPE A;  1N73 B;  1SQB J;  1EIA A;  4BPF A;  1EXJ A;  3G0V A;  3CI9 A;  2XNX A;  1JB0 J;  2HOD B;  5M1B A;  1YTZ I;  4RO0 A;  5AW0 B;  2E74 C;  2Q1K A;  2QIW A;  2NRG A;  1JCD A;  5HGM A;  1N2D C;  3USS A;  2FYN C;  1SQP E;  2WSC H;  4H0L B;  2LKM A;  1SQV E;  3MGE A;  5KKZ C;  1L0N J;  1KB9 H;  3G1G A;  5AW3 B;  2K0Y A;  4UB8 H;  1NTK J;  4H44 B;  3V5B A;  5AVS B;  1FOS F;  2LPK A;  1L0I A;  5KAF E;  3G3Z A;  2B88 A;  1KB9 I;  3AE8 C;  2DW3 A;  2IFM A;  2XV5 A;  5H2F E;  2AXT E;  3RK2 B;  1KQG B;  1GU5 A;  1KQS O;  2KB7 P;  2R3S A;  1FBM A;  2VLQ A;  3CPW O;  1YBK A;  1HF9 A;  3L73 G;  3ITK A;  1Q82 Q;  2E76 C;  1P84 H;  1IFM A;  1KFM A;  2Q6Q A;  3HTK B;  3BAS A;  2N9Y B;  3PH0 A;  2LR2 A;  1L4A D;  3TGU D;  2W6B A;  2QE7 H;  1JO5 A;  1RF1 A;  3FXE A;  3H1J D;  3RL0 C;  5KLV D;  1A02 J;  2E5Y A;  1BCC D;  4WY4 A;  3WUV A;  3V4Q A;  2OYH B;  3RBX A;  5CCH C;  1RE4 A;  2I8D A;  2M3B A;  1T2K C;  1H89 A;  1N7S C;  5APT A;  1EC5 A;  3S9O A;  1E0H A;  2V7Q H;  1EZV I;  3SWK A;  4D6T J;  3H1H E;  3HD7 B;  1URQ A;  3SWY A;  1RQU A;  2M5R A;  3PJS K;  1PGJ A;  2BQ1 E;  3KZI E;  2LML A;  1RH5 B;  3I5C A;  3LMO A;  2GUS A;  2HR3 A;  2RKL A;  2O1J A;  4Y28 J;  3L71 E;  3M0A A;  2CGQ A;  1LTJ A;  3VMX A;  1CSB A;  1EZV G;  2N1T A;  3CCQ P;  1GPJ A;  1CZQ A;  4BPH A;  1MFZ A;  1FZG A;  1EXI A;  3DS2 A;  1BE3 G;  2LKI A;  1LT9 C;  1SQB E;  3D71 A;  1OIP A;  3G1I A;  2H43 A;  2PEN A;  2LIW A;  3TYY A;  1KIL C;  3H32 A;  1LTS C;  4H2W C;  5KLI C;  2O1K A;  5GTH E;  2FAE A;  2EHT A;  4IZ6 A;  1MKM A;  3HUS B;  4I7Z C;  5AVV B;  4LLH A;  1VQ4 P;  2RN0 A;  2WMM A;  4OGQ B;  3P05 A;  1CI6 B;  1M90 Q;  3CX5 E;  5KLV E;  1IJD B;  1L0N E;  2XZ0 D;  1ZMB A;  1NTK E;  2XZ1 C;  1IFI A;  5E79 E;  2ONT A;  1G1I A;  1FZF A;  2B89 A;  3L74 D;  1M7L A;  2JEE A;  3P32 A;  2AEJ A;  4Y99 B;  3S4R A;  5CJ0 A;  1VDF A;  1L0H A;  3GZM A;  5BS2 A;  1S1C X;  2GM4 A;  3RK3 D;  2MY5 A;  2K92 A;  2WSC J;  3HRN A;  5APX A;  3BCC D;  5F2O A;  3L73 J;  4KT0 J;  2KP8 A;  1T3U A;  3CCJ P;  1WT6 A;  3M1M A;  1AQT A;  1H8A A;  2FXP A;  3L72 J;  4GOE A;  2VLO A;  2GDW A;  3H1K D;  3M0D C;  3C8V A;  2P10 A;  3C9I A;  3CLQ A;  1PGQ A;  4ZNC A;  4H0L D;  4GKG A;  2XXM A;  3TNU A;  5AVZ B;  5CCH A;  1HH0 A;  1J2J B;  4XRQ A;  3E1I A;  4EDF A;  4Z1M H;  2ZT9 B;  3GHG B;  1SFC C;  2A06 E;  1SQX D;  1FZC C;  2IX7 C;  3MHV A;  5KJ7 D;  4PV1 B;  2JP3 A;  3L74 E;  1SQQ K;  1RY3 A;  1DNY A;  1BE3 J;  2AEF A;  2GZF A;  2B87 A;  3MTU E;  2V7Q J;  2KGC A;  2KSJ A;  2FY8 A;  2QJK C;  5AVU B;  2ZVN B;  1IK7 A;  1LT9 A;  5HGO A;  1IUQ A;  1X9V A;  3G71 P;  1NWQ A;  1PPJ G;  2FAD A;  2K5X A;  2L5G B;  2CWO A;  2KOP A;  1KIL A;  5AW2 B;  2JO0 A;  2MVV A;  4GDO A;  3H1I J;  4MN4 C;  2IZ0 A;  5CZD B;  1EDJ A;  3KPE A;  5F2N A;  4JYC A;  2YO2 A;  3T97 A;  1IMP A;  3A0B H;  3CC4 P;  3Q5R A;  2KK7 A;  3FWN A;  4H13 D;  2E5T A;  2QJP B;  1Q2N A;  4LGD E;  1E79 H;  4DZO A;  1Y47 A;  1NTZ D;  4RJT A;  2XT1 A;  3L73 E;  5CBN A;  2YIU B;  4LC1 A;  1NU1 D;  1E6J P;  3OW2 O;  4PJ0 E;  1GU4 A;  1KB9 E;  2KS1 A;  4BWN A;  3CMA P;  4UB8 E;  1JCC A;  2L0Q A;  2QSI A;  2KUB A;  3G21 A;  3GMA A;  1SQQ J;  2KOR A;  1D1D A;  3G9R A;  1IFN A;  2R32 A;  3MZW B;  4W7Z A;  1JY2 N;  2WIT A;  2A45 I;  2IZ1 A;  3A0H E;  1J1D B;  4N3Y B;  2EHS A;  1IFJ A;  3H1L G;  1P84 E;  1YJ9 P;  2P2U A;  5TJH A;  2J59 M;  2JYL A;  2Q3E A;  2HPC B;  1DX7 A;  4CA3 A;  2R5B A;  2FYU D;  1ZOY C;  1EDK A;  2JB0 A;  1LWU B;  2O01 H;  1EOQ A;  1EZV E;  1OX3 A;  3FWL A;  3W68 A;  2WPT A;  2E76 D;  3G28 A;  1M1J B;  1SFC A;  3DS5 A;  1BE3 E;  1BDC A;  2K0D X;  4JBZ A;  1FZC A;  2OYI C;  2SPZ A;  4KJM A;  2ZVO B;  2OAR A;  1RF0 C;  2N9B A;  1PIX A;  1LGH B;  1L0L G;  1N73 C;  1S4X A;  5CCH D;  1T2K D;  2Q9I A;  1N7S D;  4NPD A;  1KTM A;  2ERH A;  2PNG A;  3U1A A;  1VF5 B;  1NTM K;  4C7N A;  1OXZ A;  2MVU A;  3Q5P A;  4XFY A;  2QG4 A;  1MUU A;  1IC2 A;  3RG2 A;  1JNM A;  2FFD B;  2VRS A;  2FYZ A;  4H0L C;  2DGY A;  4IL6 X;  1NJI Q;  2YMK A;  2LTE A;  4C46 A;  2KOD A;  3HE5 A;  2K1A A;  2PEI A;  4H44 C;  1R5L A;  1KZU B;  1ZW0 A;  1X79 B;  2Y0C A;  1AV1 A;  1YQ4 C;  1L0L K;  4M3L A;  2L6E A;  1J1E B;  3RK2 C;  1VQ8 P;  4DCK A;  4L75 A;  4DJG A;  5B66 H;  4EI2 A;  2QEX P;  2KOO A;  1PPJ D;  4WVZ A;  1YYC A;  4WYM A;  5KJ7 C;  4XFJ A;  1JUN A;  3B71 A;  1Q86 Q;  4W7Y A;  1DEB A;  3CE7 A;  3S1K A;  3B5N B;  1GL2 B;  1HWT C;  2QNW A;  1SQP D;  2KOG A;  5APS A;  1FS0 E;  1SQV D;  1K8A Q;  2QRX A;  3B4Q A;  2OYH C;  2M8N A;  2M8P A;  1VQM P;  2FAC A;  4D6T G;  2NPS B;  3WUT A;  1U7M A;  3HD7 C;  3DS4 A;  4YTP C;  3VN0 A;  3I55 P;  2CK3 H;  5KP8 B;  2JDI H;  1A02 F;  3AE2 C;  3AE1 C;  2K9J A;  1YQ3 C;  4GIF A;  1JMM A;  4XE5 B;  2KIK A;  1NAY A;  5KP7 B;  2WTY A;  1KYO I;  1L0L J;  3O6Q A;  2OYI A;  2YKP A;  2HFE D;  2DNW A;  1PPJ E;  1VQ9 P;  1JTH A;  3H1L D;  4L74 A;  4CPG A;  2O01 J;  1N73 A;  2FVA A;  1UJZ A;  4MRT C;  1VHN A;  1FJK A;  1Q81 Q;  3H1H D;  4JF7 A;  3HUS C;  1VL2 A;  5EJD A;  1KQF B;  1ZP0 C;  5APY A;  1SFC D;  4OGQ C;  5GTI H;  5DCK A;  3GZL A;  4XA4 A;  1AA0 A;  1AYI A;  2P7J A;  4HYT B;  3L71 D;  4EYY Q;  4TT3 H;  3WBH A;  2WVR A;  1H0T B;  2K94 A;  1RNI A;  1BAJ A;  1PFI A;  2E43 A;  2JU2 A;  1SQB D;  4Y99 C;  2KNC B;  1M6N A;  4PD4 H;  2IBZ G;  2XV6 A;  2C9L Y;  2XND H;  1PGP A;  3A0B E;  3A5T A;  1JOC A;  2BEQ D;  4L73 A;  1YIT P;  4PD4 I;  1IZN B;  2WT7 B;  1OVU A;  1WMK A;  4EOT A;  3II6 A;  5KJ7 A;  1VF5 D;  1VQ7 P;  3L72 G;  1EDL A;  1P84 I;  3TK1 A;  4I1L A;  3SSU A;  2D2C B;  3CX5 D;  1YHQ P;  1L0N D;  3H1L E;  3HTK A;  1RF1 B;  2HLO A;  1NTK D;  4COC A;  1VQK P;  2JAZ A;  2WZ7 A;  1S3J A;  1W2E A;  4AUW A;  1FDM A;  5CCG C;  1L2P A;  1URQ B;  2M5A B;  2E42 A;  2FXM A;  5B5E H;  5C39 A;  4IL6 H;  5AW9 B;  2V4H A;  2ZT9 C;  3GHG C;  3V2Q A;  3A2A A;  3AE3 C;  1DV5 A;  1K04 A;  1IFP A;  3Q5S A;  4PV1 C;  7CEI A;  2K9Y A;  2CPS A;  1L0L E;  4IOI H;  3AEC C;  2Q5U A;  1FDI A;  5KAI E;  1GL2 D;  1SQX K;  2GZE A;  4C7R A;  4XFX A;  5AVQ B;  1KOR A;  5DJT B;  1JEK A;  3VYI A;  2ITA A;  2W8Z A;  4D6T D;  3G26 A;  2KR5 A;  3AE6 C;  3CXH H;  3KHU A;  2GZI A;  2VLP A;  3CME P;  3H1I G;  4YXD C;  1M56 D;  4R4L A;  3H25 A;  4KHX A;  3HUS A;  3CXH I;  2KOS A;  2A06 D;  4DT0 A;  1GK4 A;  1CI6 A;  1DD3 A;  2NZ2 A;  3W67 A;  3A7O A;  1OW7 A;  2PEJ A;  3RBZ A;  2FQ1 A;  3O8Z A;  1JY2 O;  5HGN A;  1BDD A;  1VQ5 P;  3L70 G;  1MFT A;  1S5L H;  3WU2 H;  1U57 A;  4OWF A;  2QJP C;  1NQ4 A;  2WPR A;  1TU3 F;  1FZA A;  1PEU A;  3R4Y A;  5CJ4 A;  1JY3 O;  5F2K A;  2YIU C;  3N4X A;  1AVO A;  2G8Y A;  3NMD A;  5TIS H;  1NTZ K;  1KYO D;  1SQQ G;  2Z5H A;  4BXL A;  1S2E A;  1BSH A;  2ZAE B;  2BEZ F;  2R44 A;  5B66 E;  2Z46 A;  2VLN A;  4D6T E;  3H4E A;  1IO4 A;  1MZ9 A;  4H44 D;  3CWB J;  2N50 A;  1J1D C;  1HBW A;  1N7S A;  3TNU B;  2UWJ E;  1Z56 A;  3VMZ A;  4N78 E;  5CCG A;  1FU1 A;  4EIJ A;  3RK2 D;  1DH3 A;  1M8O B;  2GDY A;  1LNQ A;  4U0C A;  3A3Y B;  3L73 D;  4IFF A;  1X3O A;  1KMI Z;  2Y9Z A;  1KB9 D;  1JMB A;  1LWU C;  3GHG A;  4PWV B;  2WPV B;  3L72 D;  1M1J C;  2K0X A;  3V6I A;  2JWD A;  1S9K E;  1GXH A;  4H2Y C;  2FYU K;  2EFJ A;  2MD9 A;  1E5W A;  1SVF A;  2Y9Y A;  1PGO A;  2D2C D;  3R2P A;  4U3F J;  1KYO E;  2MKV A;  3VP8 A;  2MF4 A;  1AF8 A;  4F37 A;  1P84 D;  2WQY C;  1VF5 C;  3VMA A;  3HD7 D;  2W6A A;  4GR6 A;  1BGY G;  3B5I A;  4DOJ A;  1ZR2 A;  2JGP A;  3D70 A;  4UB6 H;  5KAF H;  1LTB C;  1AUM A;  1EZV D;  2FFD C;  1VQP P;  1ZXG A;  3CCS P;  1JY3 P;  1F80 D;  1BE3 D;  2Y0E A;  2LOL A;  1PV3 A;  1ACP A;  1HGZ A;  3L70 J;  5APV A;  4U0F A;  2IBZ E;  1RHZ B;  5AVX B;  2MR7 A;  2IDB A;  1UII A;  3MD0 A;  2PFX A;  3CD6 P;  1NGM B;  1J1E C;  2LXC B;  3GJN A;  2P9X A;  3L75 G;  3L72 E;  3GF7 A;  1FAV A;  1VQO P;  3H1I D;  5AW6 B;  3OJA B;  1ZNV A;  1PP9 J;  4OGQ D;  3B5N C;  1GL2 C;  3GF3 A;  3L35 A;  4HKZ H;  4PD4 E;  1WRG A;  3M0D A;  3P8M C;  2N6Y A;  4ZMD A;  1NYH A;  1CEI A;  1ZV8 A;  3L4F A;  2Y0D A;  3AE5 C;  3L70 D;  1NTM G;  1SQP K;  3HE4 B;  3VP9 A;  3V2N A;  2JYG A;  1HQB A;  1VQL P;  2NPS C;  1H88 A;  1PL5 A;  1YJW P;  1OR5 A;  1S72 P;  5AVT B;  3M9B A;  3CCV P;  2AF8 A;  1LJ2 A;  1YI2 P;  2HPC A;  1SQQ D;  2CPB A;  1NHL A;  2GDX A;  2Z45 A;  1GD2 E;  3QWO C;  1LWU A; 
#chains in the Genus database with same CATH homology
 2XT1 A;  5F2K A;  1W2B O;  2XXM A;  5HGM A;  3CC7 P;  3G29 A;  3CCQ P;  1E6J P;  3OW2 O;  3CCM P;  2BUO A;  3DS2 A;  2QA4 P;  1AUM A;  4XRO A;  3CCR P;  3CMA P;  5HGL A;  1VQP P;  3CCS P;  3G21 A;  1YIJ P;  3CCU P;  3MGE A;  2DGY A;  1NJI Q;  4XRQ A;  3G1I A;  1KD1 Q;  2KOD A;  3Q20 A;  3DTJ A;  3G1G A;  1VQ9 P;  4U0D A;  1Q7Y Q;  2PEN A;  4GR2 A;  1D1D A;  1QRJ A;  2PEI A;  4U0F A;  1VQ6 P;  3HYB A;  1K73 Q;  2EIA A;  1A43 A;  5JPA A;  4PH1 A;  1KC8 Q;  3DS0 A;  3CC2 P;  1Q81 Q;  2Z46 A;  3VRL C;  3HZQ A;  5I4T G;  3CD6 P;  4U0B A;  2OTJ P;  2L6E A;  3H4E A;  1VQN P;  1VQ8 P;  1N8R Q;  1PEO A;  1VQ4 P;  2PY8 A;  1M1K Q;  2P9X A;  3H0D A;  2QEX P;  3P05 A;  1KQS O;  3NTE A;  1QVG O;  3E2D A;  5DCK A;  1M90 Q;  3CPW O;  4XFZ A;  4WYM A;  1ZMB A;  1YJ9 P;  1VQO P;  4XFX A;  2E1M A;  1Q86 Q;  1M74 A;  2PEM A;  1Q82 Q;  1QVF O;  2JYL A;  2ONT A;  5HGO A;  4QNB A;  3LRY A;  3WBH A;  1IUQ A;  2M8L A;  1A8O A;  4U0C A;  4COP A;  3G71 P;  2BHV A;  1RNI A;  5BS1 A;  3H47 A;  1EOQ A;  1BAJ A;  3G26 A;  2OTL P;  2CWO A;  1YJN P;  2JO0 A;  2EG5 A;  3G28 A;  3CXC O;  3DS5 A;  4U0E A;  4U0A A;  4PH0 A;  1K8A Q;  3CME P;  1PEQ A;  1M6N A;  5BS2 A;  2XV6 A;  3DS3 A;  1RO0 A;  3G6E P;  2LF4 A;  3G4S P;  2M8N A;  2EFJ A;  2M8P A;  3DS1 A;  5F2O A;  2OAR A;  1VQM P;  3I56 P;  1YIT P;  2JYG A;  3CCJ P;  5F2N A;  1VQL P;  4IPY A;  3M1M A;  1M6E X;  3DPH A;  3DS4 A;  1YJW P;  1S72 P;  3CC4 P;  2Z44 A;  1VQ7 P;  2PEJ A;  1JJ2 O;  1EIA A;  1RO2 A;  3CCV P;  2BQ1 E;  5HGN A;  3G0V A;  3I55 P;  3CCL P;  2PEO A;  1VQ5 P;  1YHQ P;  1K30 A;  1YI2 P;  3RG6 C;  2PEQ A;  2Z45 A;  1PEU A;  4GR6 A;  4XFY A;  4M0I A;  4COC A;  2PEK A;  1VQK P;  1K9M Q;  3CCE P;  1PEM A;  3B5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...