3CD6P

Co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 44
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cd6P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cd6P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cd6P02
3CXCO 1YJWP 1KQSO 1VQ6P 3CCRP 3CCSP 1K9MQ 1VQMP 1YHQP 1YIJP 2QA4P 1Q86Q 3CCLP 1QVFO 1YI2P 3CC2P 1W2BO 3CCJP 3G6EP 3CCUP 1VQPP 2OTJP 3I55P 3CCVP 1QVGO 3G4SP 1VQOP 3CCEP 3CMAP 1VQ7P 1Q81Q 3CD6P 3CCMP 1M90Q 1VQNP 1VQ9P 2OTLP 1VQKP 3CC7P 1Q7YQ 3I56P 1YJ9P 1KC8Q 1M1KQ 1K73Q 1YITP 1VQLP 3CPWO 3CMEP 1KD1Q 3G71P 1NJIQ 1Q82Q 3CCQP 1S72P 1VQ5P 1N8RQ 1VQ4P 1YJNP 3CC4P 1VQ8P 2QEXP 1JJ2O 1K8AQ 3OW2O
chains in the Genus database with same CATH superfamily
2W6JH 3VP9A 4HKZH 3SWYA 3RK3E 3MD0A 2J58A 3D70A 1RE3C 2ZXEB 1JMBA 3KZIH 3IN6A 5KP7B 1K73Q 3B5ND 3H1JD 1PP9E 1EZVI 3VYIA 3AE2C 1JY2O 2PEQA 1EZVD 1G2CA 2N5HA 3CX5E 2DGYA 1RE3A 2KGEA 4MRTC 1SQXD 1NTKG 3A5TA 4N78E 2WPTA 2XZ0D 3L72E 1NVOA 1HGZA 2CG5B 1GW4A 2JEEA 2ERHA 1SQQJ 2QRXA 2L6EA 2QM8A 4K35A 1ZMBA 5KKZB 5APWA 3G0VA 2C0XA 3EQ2A 3DS1A 5APSA 2EFJA 3P7KA 4PV1D 3AE8C 1JUNA 2KLVA 3L71G 3HE4A 4BPGA 2IBZG 2VLPA 5F2KA 5KP6B 1Z6MA 2R3SA 4NPFX 2JJLA 2LKMA 1N7SD 2YO3A 2JBGA 4W80A 2L4BA 3II6A 2W6BA 5AVXB 2E76C 1E6JP 3PJSK 3HTKA 1NQ4A 5APXA 1G2CB 3IAOA 5CHXA 2JO0A 2Q1KA 2PEJA 5DCKA 4PD4H 2MD9A 1P84H 1IMPA 1EDKA 3DS2A 1LWUA 3DS5A 1X79B 2N5IA 4YXDC 2Y0DA 3W68A 4XA4A 3G9RA 2XDJA 3CXHH 4UHPB 2AXCA 2EIAA 1DNYA 3L73D 3AEEC 2HR3A 5CBNA 2KWLA 4AYCA 2XZ1C 4R4MA 3CMEP 3EJBA 4GKGA 2FYUD 4GR6A 3FX0A 5CCHC 1ZMEC 3FXDA 2YO2A 3B5IA 2W27A 1YI2P 1CZQA 2JWDA 3HE4B 3CLQA 2ZT9C 4W7YA 2KP8A 4OWFA 4JF7A 5CCHA 4DZOA 3G28A 3CPWO 4GIFA 2Z5IA 1KYOE 1LTJA 2HG5D 3HTKB 2HYNA 1FOSE 4I1LA 1NTMD 1VQ6P 2QNWA 5AW0B 1GK6A 3N7NA 3AE9C 1FJKA 5AVRB 3B4QA 3HE5A 2I1JA 1LWUB 3H1IG 2E76B 1KB9E 4TT3H 3E1RA 3JCUE 1SQQK 3L70E 1HF9A 1EMVA 1YQ3C 1LTBC 7CEIA 2XT1A 5E79H 1A02F 2OYHC 1JEKA 3QH9A 1GTWA 1NAYA 1VL2A 4OGQD 3RK3D 1PEOA 1L4AD 1OVRA 3GKLC 2Y0CA 2YKPA 1PP9D 2OYHA 3CX5I 3U1AA 3H1IJ 3CX5D 4EDFA 1TU3F 3H1HG 2LKIA 1YJWP 5AVTB 4N78D 1YHQP 3L72D 2KGCA 2FXOA 4YTPC 1HQBA 1YQ4C 1LTJB 2R5DA 4H0LC 3BRTB 1S1CX 2PEKA 1PPJG 4H2YC 1YJNP 1K04A 1OW6A 3HE5B 3M0AA 2BASA 4I7ZB 3Q5RA 3L75D 4PH1A 1AQ5A 1L0ND 2K9JA 1EDJA 5TISE 3E1IA 4GR2A 2FYNC 2N6YA 1SQBE 4KHXA 2PAJA 2RMZA 3A2AA 5AVSB 2OYHB 3U43A 3P32A 4UB6E 2LF4A 2YMYA 1RQVA 3GG2A 1KC8Q 1U7MA 2Q7CA 3G3ZA 1LT9C 1BGYE 5AVUB 3CXCO 2H88C 5APVA 2C0WA 3NTEA 1W2BO 2ZYGA 1EXJA 1AVYA 1S5LH 2PEMA 1DEBA 3W67A 1FC2C 1VQKP 1KQGB 2QG4A 2EHTA 2Y9YA 1WMKA 4H0LB 2K9JB 1QLED 5KAFH 3B5NA 2OQQA 3R4YA 2N1TD 3ZDMA 2KSEA 1IFIA 4L76A 5AW9B 1LP1A 1KYOI 1NTKE 2POHA 1M1JA 2RH0A 5HGMA 2AFDA 5HV8A 2FQ1A 2IZ1A 5KP8B 1LNQA 4H13D 5F2OA 1FZFA 2O1KA 3CCRP 1GK4A 3CX5H 1KB9I 1VF5C 4U3FG 3IFMA 1KB9D 3H1KG 2QJPC 3L70D 1MV8A 3MP7B 1KV4A 1YTZT 4GOEA 5AW4B 4Z1MH 3AE6C 2XKMA 2PFXA 2K92A 1FDIA 1ACPA 2KW2A 2A06E 1K8AQ 3L71E 2Q9IA 1ZW0A 3B8EB 3I5CA 5M1BA 3M91A 3U1CA 4QNBA 5KLIC 3B5NB 3CD6P 1JCCA 4D6TG 2ZVOB 3HRNA 1NJIQ 1OVVA 4XRQA 3AE5C 1IFJA 5GTIE 4IZ6A 1LP1B 2WMMA 4H44C 5CBOA 1NO4A 4I2LC 3IF4A 4U0CA 1EZVE 3CCSP 1M1JB 2QA4P 1RNIA 2HPCA 4IFFA 2WZ7A 1KILE 2KNCA 1IO4A 1IK7A 5BU5A 1W5CE 4W7ZA 4QMAA 5E79E 1HWTC 2FQ0A 3LIEA 1Q82Q 2KZIA 4D6TJ 3RGUA 1BXIA 4KT0J 3AE4C 1UNKA 3A7OA 3UIAA 2NPSD 1RO0A 4CPGA 4I6MC 1FZBA 2O1JA 1JY2P 4IPYA 3ABVC 4PV1B 1SQPE 4PJ0E 1AYIA 2HLOA 3HD7D 1VF5B 1SQBD 5APYA 5CJ4A 2IFNA 4XFXA 2QJPB 2FBWC 3G1IA 2XZRA 1NKNA 1BE3E 3CWBG 2MJZA 2IPPA 3G6EP 5CZDB 1VQPP 3V2QA 1M74A 3TYYA 2CPBA 4OGQC 1NHLA 3RK3C 1JMMA 2FKWB 2CPSA 2HPCB 2I1KA 2KNCB 2MKVA 3GLMA 4N6JA 1SFCC 1RF1C 2R3CA 5L8RJ 1AF8A 4XROA 5AW5B 3WUTA 2KG8A 2OTLP 4WWIA 3KQGA 2R5BA 2LTEA 1SFCA 2KORA 1KB9H 1RF1A 3JCUH 1CW5A 2FYUE 2W90A 2KXPB 1IJDB 1ZV8A 1GPJA 5HGLA 3M0DA 1NTKD 3TNUA 2KR5A 2JR8A 3L74G 1L0LG 2WSCH 2QJKC 2WPVB 2GDXA 5KKZC 1S72P 1UJZA 3FWLA 4U0FA 2LXBA 3VTPC 1SQVG 2FVEA 3GJNA 2Q5UA 1S5LE 3G26A 4ZNCA 2RN0A 3MTUE 2E43A 2Z44A 3CL3D 1X22A 2ZYAA 1OX3A 4EIJA 2A06D 3SWFA 1L0LJ 3BCCE 1KMIZ 3L71D 4OGQB 3RK3B 4XFYA 3AE7C 3AEDC 3DS3A 1E0HA 1JB0J 1LTTC 1SQVJ 1FJPA 3Q20A 2VLOA 2YKOA 1SFCB 1RF1B 1DD3A 1SQQG 1M57D 2H8PD 1MFZA 5TISH 2FACA 2GZIA 2O01H 2WQYC 4Y99C 3CCQP 4DJGA 3CC4P 2KOPA 1Z56A 1EQ7A 1NU1J 3TNUB 3G21A 4NEOA 4RO0A 3T97A 1HVVA 4HB1A 1KILD 3BASA 1QX8A 3R2PA 4UB6H 2SPZA 5AVZB 1BGYJ 2RKLA 3M9HA 2AEMA 2J59M 3TGUG 2QJKB 2KIKA 3EFFK 4ZKPA 1KORA 1SQPD 4WY4D 4ASVA 2V7QH 2N1TA 3L75E 1L0NE 2IZ0A 4H13C 3CCMP 3V2PA 1BCCE 3AEFC 2KUBA 3CI9A 2V4HA 3DS0A 2JKVA 4BRYA 1BE3D 3PLNA 2QE7H 1H88A 3H1LG 2M5AA 3TGUJ 5KLVJ 3MHVA 2KGAA 5B66H 1NTZJ 1LWUC 1QVGO 1JY3O 5H2FE 2KB7P 1M56D 5K5GB 1Q7YQ 1VQLP 3T97B 3H1KE 2B87A 1HY8A 1N2DC 3L36A 1GL2D 4Y99B 1E79H 3H1LJ 1D1DA 2M3EA 2GA1A 1VQ7P 3MZWB 3OJAB 2WITA 4HH2A 3G29A 2FVFA 1L0LK 2N1TB 4COCA 1SQXG 1KFMA 4GODA 4YXWH 1M6EX 3H1HD 4MN4C 2XNDH 1NGMB 1LTJC 1HJ0A 1SQVK 4BRYB 4U0DA 4F37A 2M5AB 2MR8A 3H1JJ 4H13B 1AJYA 2BQ1E 4I7ZC 4ZKUA 1JJ2O 1NU1K 2WSEH 1SQXJ 2BCCE 4C7RA 5GTIH 1BDDA 2QIWA 1FZEA 3MUDA 1JY3N 1WRGA 2B87B 2Y0EA 4O9BA 3TDKA 1M1KQ 1AVOA 4CA3A 3BCCD 2JDIH 5KJ7D 1VQ5P 1SLQA 2AEJA 1GU5A 3AEGC 1URQD 1OWAA 2LOLA 4IL6E 2GDYA 3Q1MA 3P8CE 2D2CD 1T2KC 1T8ZA 3CWBE 3RL0D 2AFEA 1FE6A 2AEFA 4PJ0H 1W2EA 2E75D 4PWVB 1OXZA 2GYKA 5BS1A 3MGEA 3KPEA 3B71A 3EFGA 1MFTA 3L73G 5KLVK 3CCLP 5AVVB 1NTZK 2M8RA 2JYLA 3V4WA 2JU1A 2XU6A 1UIIA 2WWWA 1S4XA 2KS1A 2W8ZA 1LTAC 3P05A 3P8MC 3KDPB 4LC1A 1OMIA 2E5TA 3A0BH 3DS4A 1K30A 5AVWB 4U7JA 2GZGA 4N3YB 3L73J 3SFEC 1BCCD 2KOQA 3V4QA 3FXEA 3EJDA 1USDA 2L5GB 2XV5A 2P1JA 3L4FA 1NTMG 1NWQA 2FYUJ 2OGUA 2W6AA 3L74E 2FADA 1PEQA 1LTIC 1IMQA 3MIWA 3AECC 1LGHB 3VRLC 3BVHA 2J5UA 1VQNP 1U57A 4U3FD 3VOPA 3FGAD 3B4SA 3S1KA 2KOSA 2O3JA 3GZMA 3H1KD 1IZNB 1KD1Q 2Z46A 3L35A 2KI7B 1DV5A 4XFJA 2N50A 3VMZA 1NTMJ 1GMJA 3ITKA 2L22A 1SQXK 1PFIA 3S4RA 3B5NC 1G1JA 1U7JA 2KS1B 1K05A 2KYVA 2WSSH 2LIWA 3PRJA 2H89C 1MZ9A 3G71P 2JP3A 3KHUA 3SWKA 1SQQE 1CSBA 1M1JC 2L0QA 3L72G 4EYYQ 5B66E 4Y28J 1ZXGA 3RG6C 3NY7B 1RH5B 2JWAA 2GUSA 4AUWA 2ZFCA 3H6PA 3GZLA 1AQTA 1ZN5A 1KILA 3C1LA 1PP9J 2N98A 1ZLLA 2IYPA 5JPAA 1GD2E 1S3JA 3D6ZA 2BCCD 5EJDA 2LXCB 4PV1C 1FZCC 1Y9BA 1PV3A 2AVAA 3L72J 1QEXA 1J1EB 2PEIA 1X9VA 1FR2A 1LTSC 2A45I 2P2UA 4WY4A 4OVNF 1Q2NA 1OFCX 1BDCA 4PXHB 2N9YB 2P58A 1M7LA 4HYTB 1FS0E 1N7SC 5HVCA 4YPCA 1IUQA 1FZCA 1KTMA 2VRSA 1NAFA 2WVRA 2MF4A 1JM0A 3D6YA 2GZEA 3NXSA 3TSIA 1GXHA 3P8CD 4OH8B 2OARA 2BEQD 2IBZE 2QSIA 1L0NJ 3BRVB 3RBXA 4L75A 3RL0g 3CWBD 1QL1A 1N7SA 1Q81Q 1GZLA 2XV6A 2LR2A 5DJUB 3WU2E 3C9IA 5AW2B 1OR5A 2QEXP 1LT1A 1KILB 2K3RA 2ZAEB 1IFMA 1GL2A 3CCEP 1X3OA 1T6AA 1RF0C 5H2FH 4M0IA 3HYBA 1NTMK 4WY4B 2LIUA 2CGQA 1IK9A 3RK2D 2PNGA 1NH4A 5CCHD 1RF0A 1FZCB 3I55P 2MR7A 4B86A 1UIXA 1VQ9P 3I56P 2QJYB 1HH0A 2ZT9D 3L74D 3JSVC 2YKQA 4RKUJ 5AVQB 1N7SB 2WSFH 3GMAA 1L2PA 1H8AA 1YTZI 5CCGD 4ASWA 3TK1A 3LW5H 2JQ4A 4JPZB 1JO5A 1J1DC 2KGDA 5DJTB 2QM7A 3L70G 4DT0A 3WBHA 2Y9ZA 1DD4A 1GL2B 3A0BE 2Q3IA 1EXIA 3V2NA 4EI2A 1L4AC 4WVZA 1KN7A 3H1IE 2Q6QA 4JYCA 5KJ7A 2IYOA 2DW3A 1ZOYC 2K94A 1RE4A 5F2NA 1URQA 1QVFO 2E75C 3Q5SA 4UB8E 4ZMDA 1QL2A 2FHSC 1ZP0C 3L70J 1WT6A 4QKOA 1L4AA 2H7HA 1SQQD 3M0DC 4L74A 4KJMA 5GTHH 5HGNA 2XNXA 1NYHA 3HUSC 2K1AA 2A45H 5AW1B 2H43A 1EIAA 2WSCJ 1L0NK 3NTNA 2Z4EA 1AFOA 2KG9A 3H1HE 2FXMA 4IL6H 3CMAP 1KQFB 2PY8A 3HUSA 1N8RQ 1DEEG 3GW6A 2Q3EA 3O6QA 3TGUD 1PPJE 3USSA 4DCKA 4BPHA 2FFDC 3BATA 2ITAA 3PTZA 2IFMA 1KLPA 1J1DB 3CC7P 3IR9A 1G1IA 2Z45A 2FY8A 2WPSA 2KG6A 2L9FA 4NPEA 4WYMA 1URQB 1PZQA 1PGOA 2IBZI 1NU1G 2BEZF 1A02J 2FFDA 3O8ZA 2IBZD 3E2DA 1FDOA 1HBWA 2YIUC 2VLQA 1L4AB 3C8VA 2EHSA 1S9KD 5EFWB 1EDLA 1N7LA 3RL0B 1BGYG 5AW3B 2E75B 1SQBJ 3QWOC 1EC5A 4NPDA 3HZQA 5KAIE 2QVAA 1OIPA 5BU8B 3KYQA 3HUSB 1KQLA 3VMAA 1PGPA 4H2XC 1ZR4A 1AV1A 2WTYA 4C46A 2LMLA 1J2JB 3H32A 1N86A 2PP6A 2Z5HA 1VHNA 2AXTE 2KSJA 3O6QB 2N1TC 3EJEA 2IDBA 3FWNA 1RY3A 2GDWA 2V7QJ 2K9YA 3GHGC 4EOTA 3OW2O 3AE1C 5KLVG 1A43A 2JGPA 3Q2YA 5B5EH 1NTZG 3N4XA 3K5BA 1CEIA 2HFED 1ZRTD 3WUVA 1D7MA 2FFDB 1JCDA 2P67A 3GHGA 1JTHA 2VLNA 1YIJP 1S5LX 1SS1A 1GW3A 2E74D 1NTKJ 2YIUB 4WBAA 1OW7A 1KZUB 3AEBC 1QRJA 2A06G 1AUMA 3RG2A 1YITP 1M6NA 5BS2A 4U3FE 1VF5D 2VSQA 2XXMA 3H1ID 2YMKA 3H32B 3Q5PA 4XE5B 3CCUP 2X2BA 4AQRD 3H1JG 1BAJA 1FOSF 4JYBA 1FBMA 1EZVG 1JY2N 2MY5A 3L71J 1FDMA 1DX7A 4D6TE 1DH3A 4DOJA 3GHGB 2I8DA 2M8NA 3PH0A 4K3AA 3CCVP 4H44D 2GZJA 1JTHB 2NPSC 2WSEJ 4U0BA 1SQBK 1PEMA 3RK2C 3MUDC 4R4LA 2NRGA 4GT1A 1SQPG 1PPJD 3NFQA 3HD7C 3WU2H 2M8PA 1KQSO 1CI6A 5KTBA 1VQMP 1OVUA 2NPSA 5AW7B 4WB4A 2E42A 3S9OA 5GTHE 1EDIA 1BSNA 5CCGC 1BE3G 5CMZA 1PIXA 3A0HE 3HD7A 2L91A 5EW5E 1NOHA 3GF7A 5TJHA 1OW8A 1EOQA 1SQPJ 1M8OB 1IFDA 2WPQA 3PHLA 5CCGA 3G4SP 3H0DA 1HUCA 2JB0A 1ZNVA 1YJ9P 2KLUA 1F80D 1VPCA 2M5RA 1BE3J 1VQ8P 3G1GA 4BXLA 2KZJA 2HODA 2W83C 2CQ8A 2K2QA 1NTKK 2B88A 2YXQB 5APUA 1SFCD 2FYUG 1CI6B 2ZYDA 5C39A 2NPSB 3RK2B 5BVZA 1IFNA 1RO2A 2O01N 2FAEA 4A7PA 3HD7B 4L73A 3EWKA 2AF8A 2ZT9B 1DIPA 4UB8H 2OYOA 3TF5A 2ZVNB 1A8OA 1L0LE 1HJBA 1FZGA 1J1EC 3H1HJ 4BWNA 2K0DX 3KZIE 2YXRB 2K93A 4COPA 2OTJP 1X8YA 2K0YA 1XTGB 3BCCG 1OZHA 1SQVE 2OYIC 2HODB 2E5YA 3SFDC 5HGOA 4M3LA 2KK7A 5B5EE 2N6ZA 4IL6X 1NU1E 1FU1A 3KXDA 2OYIA 1PGQA 4U0AA 3CCJP 2C9LY 4C7NA 3OA7A 1PP9G 2WT7A 1VQOP 4IFDK 2G8YA 4JQ0D 3BCCJ 4GDOA 1FZAA 2BHVA 4D6TD 1KILC 3NMDA 2KOGA 3WMM0 1N73C 1SQPK 4U0EA 4RJTA 2PRRA 1H0TA 3D71A 1LT9A 2K37A 1L0IA 1N73A 4WY4C 4BPFA 2CWOA 1VQ4P 4XFZA 3WUUA 3DTJA 3L75G 2G3AA 1L0NG 2MVVA 1BCCG 5KAIH 3TGUE 2ROQA 5KLVE 1YBKA 5AVYB 2QJYC 1KFNA 4R0MA 2GZFA 1NTZE 4PD4E 3VP8A 2NZ2A 1P84E 2P9XA 1KYOD 1R5LA 2PGDA 2N9BA 1MUUA 2FYNB 2E74C 2OYIB 1R5SA 2AXTH 4C7NB 2WT7B 3CXHE 1Y47A 1H89A 1SVFA 2CK3H 3L75J 1BSHA 3H1LE 1T8KA 3H4EA 1BCCJ 2LPKA 1S9KE 1HTLC 2OTKE 1MZ8A 3H25A 5AW6B 3GF3A 1GL2C 2K0XA 1NKZB 4DG9A 2E76D 2FYUK 1H0TB 3F5HA 2R44A 3F89A 2JYGA 4RESB 3SSUA 1LT9B 3LRYA 3E7KA 2EG5A 1N73B 3A3YB 2UWJE 4U3FJ 3M06A 5CJ0A 2ONTA 2MVUA 3H1KJ 3H1JE 1SP4A 3V5BA 1JNMA 2R32A 1RQUA 1SQXE 2WPRA 2P7JA 2C9NY 2JAZA 1GU4A 1ZRTE 2WSFJ 1LJ2A 3H47A 1VDFA 3LW5J 2BCCG 5AW8B 5APTA 1L0LD 4HJGH 3VMXA 3PP5A 2FYZA 2E74B 2B9BA 3LMOA 4IOIH 1SQVD 5KJ7C 2A45G 4HKGA 1JOCA 3OAKA 1RE4C 1URQC 2JO1A 4LGDE 1GDTA 2K5XA 1T3JA 1PGJA 2LL8A 2IX7C 2D2CC 4H2WC 2PEOA 2JU2A 2BCCJ 3LIDA 4JBZA 5APQA 1NU1D 3V2RA 2FVAA 3RL0C 1Q86Q 1VKUA 1T3UA 1AA0A 1Q90D 2B89A 2FQ2A 2M8LA 3VMYA 1R8EA 1MKMA 2ZJSE 1X0TA 4TLFA 1IC2A 5KLIB 2CNRA 1LTGC 1BGYD 2DNWA 1JY3P 1T2KD 4GOFA 1E5WA 1L0HA 2P10A 3L37A 3A0HH 1KYOH 1PEUA 1QGKB 3M9BA 4H44B 2NO8A 3CC2P 3CWBJ 3U59A 2M3BA 3L73E 1PL5A 1XTCC 4H0LD 2K88A 1HGVA 1K9MQ 4PD4I 5KLVD 1P84I 2YNYA 4LLHA 1NTZD 4PD4D 1SQBG 3AE3C 1M90Q 1P84D 1YYCA 2M0BA 1S2EA 3CE7A 5I4TG 3V6IA 2E1MA 2FXPA 3Q3DA 3AEAC 1IFPA 1RHZB 3CXHI 3DPHA 3CXHD 2KODA 1FAVA 4IFMA 3RBZA 3MGNA 1Y8AA 3JC22 2D2CB 1NTME 3M1MA 2PENA 3H1LD 4PH0A 2O01J 2ZXXA 1ZR2A 2GUVA 2GM4A 3M9QA 1GXGA 2KOOA 5KAFE 3L74J 1USEA 2BUOA 3VN0A
chains in the Genus database with same CATH topology
1RO0A 3DS2A 1YJWP 2M8PA 3DS5A 1KQSO 1A43A 1VQMP 1EIAA 1YHQP 1Q86Q 4IPYA 3G26A 3H4EA 4COPA 2OTJP 2EIAA 1QVGO 2M8LA 2Z44A 3CCEP 3CMAP 2PEKA 1Q7YQ 1VQLP 1K73Q 2PY8A 3CMEP 5HGMA 3G71P 5HGOA 4XFXA 4M0IA 1N8RQ 4GR6A 1YJNP 2PEQA 5BS1A 3HYBA 3MGEA 4XFYA 3G1IA 2JYGA 5F2OA 2DGYA 3DS3A 1PEUA 3LRYA 3CCRP 3RG6C 1EOQA 4PH1A 3B5IA 1YIJP 2EG5A 3CCLP 1YI2P 4U0AA 3CC2P 3CCJP 3G6EP 1D1DA 1VQPP 3Q20A 3I55P 2JYLA 3G4SP 1VQOP 3H0DA 1VQ7P 1QRJA 4GR2A 1VQ9P 1AUMA 1M74A 3CC7P 5JPAA 3I56P 1YJ9P 2ONTA 1YITP 1M6NA 2Z45A 3G28A 3CPWO 5BS2A 4WYMA 2L6EA 3CCQP 2XXMA 3G29A 2BHVA 3CC4P 4COCA 1VQ8P 3P05A 1ZMBA 3G1GA 1K8AQ 3G0VA 3E2DA 3G21A 1VQ6P 1M6EX 1K9MQ 3DS4A 1K30A 4U0EA 3DS1A 3CCUP 2LF4A 2PEIA 2EFJA 4QNBA 4XROA 4U0DA 3CD6P 1M90Q 1BAJA 5I4TG 2OTLP 2E1MA 1KC8Q 3WBHA 3H47A 2BQ1E 1NJIQ 1IUQA 4XRQA 2CWOA 2XT1A 1VQ4P 3HZQA 5F2KA 3DPHA 2QEXP 4XFZA 2KODA 1RO2A 3DTJA 1JJ2O 3CXCO 1PEQA 4U0CA 3CCSP 2OARA 3M1MA 2PENA 5F2NA 2QA4P 1RNIA 5HGLA 1QVFO 1PEOA 3NTEA 2M8NA 1W2BO 4PH0A 1E6JP 3CCVP 1Q81Q 3VRLC 3CCMP 2PEMA 1VQNP 4U0BA 2XV6A 1VQKP 1PEMA 2P9XA 1M1KQ 2JO0A 1KD1Q 2Z46A 2PEJA 3DS0A 5DCKA 1Q82Q 2BUOA 1VQ5P 1S72P 5HGNA 2PEOA 1A8OA 4U0FA 3OW2O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXC O;  1YJW P;  1KQS O;  1VQ6 P;  3CCR P;  3CCS P;  1K9M Q;  1VQM P;  1YHQ P;  1YIJ P;  2QA4 P;  1Q86 Q;  3CCL P;  1QVF O;  1YI2 P;  3CC2 P;  1W2B O;  3CCJ P;  3G6E P;  3CCU P;  1VQP P;  2OTJ P;  3I55 P;  3CCV P;  1QVG O;  3G4S P;  1VQO P;  3CCE P;  3CMA P;  1VQ7 P;  1Q81 Q;  3CD6 P;  3CCM P;  1M90 Q;  1VQN P;  1VQ9 P;  2OTL P;  1VQK P;  3CC7 P;  1Q7Y Q;  3I56 P;  1YJ9 P;  1KC8 Q;  1M1K Q;  1K73 Q;  1YIT P;  1VQL P;  3CPW O;  3CME P;  1KD1 Q;  3G71 P;  1NJI Q;  1Q82 Q;  3CCQ P;  1S72 P;  1VQ5 P;  1N8R Q;  1VQ4 P;  1YJN P;  3CC4 P;  1VQ8 P;  2QEX P;  1JJ2 O;  1K8A Q;  3OW2 O; 
#chains in the Genus database with same CATH topology
 2W6J H;  3VP9 A;  4HKZ H;  3SWY A;  3RK3 E;  3MD0 A;  2J58 A;  3D70 A;  1RE3 C;  2ZXE B;  1JMB A;  3KZI H;  3IN6 A;  5KP7 B;  1K73 Q;  3B5N D;  3H1J D;  1PP9 E;  1EZV I;  3VYI A;  3AE2 C;  1JY2 O;  2PEQ A;  1EZV D;  1G2C A;  2N5H A;  3CX5 E;  2DGY A;  1RE3 A;  2KGE A;  4MRT C;  1SQX D;  1NTK G;  3A5T A;  4N78 E;  2WPT A;  2XZ0 D;  3L72 E;  1NVO A;  1HGZ A;  2CG5 B;  1GW4 A;  2JEE A;  2ERH A;  1SQQ J;  2QRX A;  2L6E A;  2QM8 A;  4K35 A;  1ZMB A;  5KKZ B;  5APW A;  3G0V A;  2C0X A;  3EQ2 A;  3DS1 A;  5APS A;  2EFJ A;  3P7K A;  4PV1 D;  3AE8 C;  1JUN A;  2KLV A;  3L71 G;  3HE4 A;  4BPG A;  2IBZ G;  2VLP A;  5F2K A;  5KP6 B;  1Z6M A;  2R3S A;  4NPF X;  2JJL A;  2LKM A;  1N7S D;  2YO3 A;  2JBG A;  4W80 A;  2L4B A;  3II6 A;  2W6B A;  5AVX B;  2E76 C;  1E6J P;  3PJS K;  3HTK A;  1NQ4 A;  5APX A;  1G2C B;  3IAO A;  5CHX A;  2JO0 A;  2Q1K A;  2PEJ A;  5DCK A;  4PD4 H;  2MD9 A;  1P84 H;  1IMP A;  1EDK A;  3DS2 A;  1LWU A;  3DS5 A;  1X79 B;  2N5I A;  4YXD C;  2Y0D A;  3W68 A;  4XA4 A;  3G9R A;  2XDJ A;  3CXH H;  4UHP B;  2AXC A;  2EIA A;  1DNY A;  3L73 D;  3AEE C;  2HR3 A;  5CBN A;  2KWL A;  4AYC A;  2XZ1 C;  4R4M A;  3CME P;  3EJB A;  4GKG A;  2FYU D;  4GR6 A;  3FX0 A;  5CCH C;  1ZME C;  3FXD A;  2YO2 A;  3B5I A;  2W27 A;  1YI2 P;  1CZQ A;  2JWD A;  3HE4 B;  3CLQ A;  2ZT9 C;  4W7Y A;  2KP8 A;  4OWF A;  4JF7 A;  5CCH A;  4DZO A;  3G28 A;  3CPW O;  4GIF A;  2Z5I A;  1KYO E;  1LTJ A;  2HG5 D;  3HTK B;  2HYN A;  1FOS E;  4I1L A;  1NTM D;  1VQ6 P;  2QNW A;  5AW0 B;  1GK6 A;  3N7N A;  3AE9 C;  1FJK A;  5AVR B;  3B4Q A;  3HE5 A;  2I1J A;  1LWU B;  3H1I G;  2E76 B;  1KB9 E;  4TT3 H;  3E1R A;  3JCU E;  1SQQ K;  3L70 E;  1HF9 A;  1EMV A;  1YQ3 C;  1LTB C;  7CEI A;  2XT1 A;  5E79 H;  1A02 F;  2OYH C;  1JEK A;  3QH9 A;  1GTW A;  1NAY A;  1VL2 A;  4OGQ D;  3RK3 D;  1PEO A;  1L4A D;  1OVR A;  3GKL C;  2Y0C A;  2YKP A;  1PP9 D;  2OYH A;  3CX5 I;  3U1A A;  3H1I J;  3CX5 D;  4EDF A;  1TU3 F;  3H1H G;  2LKI A;  1YJW P;  5AVT B;  4N78 D;  1YHQ P;  3L72 D;  2KGC A;  2FXO A;  4YTP C;  1HQB A;  1YQ4 C;  1LTJ B;  2R5D A;  4H0L C;  3BRT B;  1S1C X;  2PEK A;  1PPJ G;  4H2Y C;  1YJN P;  1K04 A;  1OW6 A;  3HE5 B;  3M0A A;  2BAS A;  4I7Z B;  3Q5R A;  3L75 D;  4PH1 A;  1AQ5 A;  1L0N D;  2K9J A;  1EDJ A;  5TIS E;  3E1I A;  4GR2 A;  2FYN C;  2N6Y A;  1SQB E;  4KHX A;  2PAJ A;  2RMZ A;  3A2A A;  5AVS B;  2OYH B;  3U43 A;  3P32 A;  4UB6 E;  2LF4 A;  2YMY A;  1RQV A;  3GG2 A;  1KC8 Q;  1U7M A;  2Q7C A;  3G3Z A;  1LT9 C;  1BGY E;  5AVU B;  3CXC O;  2H88 C;  5APV A;  2C0W A;  3NTE A;  1W2B O;  2ZYG A;  1EXJ A;  1AVY A;  1S5L H;  2PEM A;  1DEB A;  3W67 A;  1FC2 C;  1VQK P;  1KQG B;  2QG4 A;  2EHT A;  2Y9Y A;  1WMK A;  4H0L B;  2K9J B;  1QLE D;  5KAF H;  3B5N A;  2OQQ A;  3R4Y A;  2N1T D;  3ZDM A;  2KSE A;  1IFI A;  4L76 A;  5AW9 B;  1LP1 A;  1KYO I;  1NTK E;  2POH A;  1M1J A;  2RH0 A;  5HGM A;  2AFD A;  5HV8 A;  2FQ1 A;  2IZ1 A;  5KP8 B;  1LNQ A;  4H13 D;  5F2O A;  1FZF A;  2O1K A;  3CCR P;  1GK4 A;  3CX5 H;  1KB9 I;  1VF5 C;  4U3F G;  3IFM A;  1KB9 D;  3H1K G;  2QJP C;  3L70 D;  1MV8 A;  3MP7 B;  1KV4 A;  1YTZ T;  4GOE A;  5AW4 B;  4Z1M H;  3AE6 C;  2XKM A;  2PFX A;  2K92 A;  1FDI A;  1ACP A;  2KW2 A;  2A06 E;  1K8A Q;  3L71 E;  2Q9I A;  1ZW0 A;  3B8E B;  3I5C A;  5M1B A;  3M91 A;  3U1C A;  4QNB A;  5KLI C;  3B5N B;  3CD6 P;  1JCC A;  4D6T G;  2ZVO B;  3HRN A;  1NJI Q;  1OVV A;  4XRQ A;  3AE5 C;  1IFJ A;  5GTI E;  4IZ6 A;  1LP1 B;  2WMM A;  4H44 C;  5CBO A;  1NO4 A;  4I2L C;  3IF4 A;  4U0C A;  1EZV E;  3CCS P;  1M1J B;  2QA4 P;  1RNI A;  2HPC A;  4IFF A;  2WZ7 A;  1KIL E;  2KNC A;  1IO4 A;  1IK7 A;  5BU5 A;  1W5C E;  4W7Z A;  4QMA A;  5E79 E;  1HWT C;  2FQ0 A;  3LIE A;  1Q82 Q;  2KZI A;  4D6T J;  3RGU A;  1BXI A;  4KT0 J;  3AE4 C;  1UNK A;  3A7O A;  3UIA A;  2NPS D;  1RO0 A;  4CPG A;  4I6M C;  1FZB A;  2O1J A;  1JY2 P;  4IPY A;  3ABV C;  4PV1 B;  1SQP E;  4PJ0 E;  1AYI A;  2HLO A;  3HD7 D;  1VF5 B;  1SQB D;  5APY A;  5CJ4 A;  2IFN A;  4XFX A;  2QJP B;  2FBW C;  3G1I A;  2XZR A;  1NKN A;  1BE3 E;  3CWB G;  2MJZ A;  2IPP A;  3G6E P;  5CZD B;  1VQP P;  3V2Q A;  1M74 A;  3TYY A;  2CPB A;  4OGQ C;  1NHL A;  3RK3 C;  1JMM A;  2FKW B;  2CPS A;  2HPC B;  2I1K A;  2KNC B;  2MKV A;  3GLM A;  4N6J A;  1SFC C;  1RF1 C;  2R3C A;  5L8R J;  1AF8 A;  4XRO A;  5AW5 B;  3WUT A;  2KG8 A;  2OTL P;  4WWI A;  3KQG A;  2R5B A;  2LTE A;  1SFC A;  2KOR A;  1KB9 H;  1RF1 A;  3JCU H;  1CW5 A;  2FYU E;  2W90 A;  2KXP B;  1IJD B;  1ZV8 A;  1GPJ A;  5HGL A;  3M0D A;  1NTK D;  3TNU A;  2KR5 A;  2JR8 A;  3L74 G;  1L0L G;  2WSC H;  2QJK C;  2WPV B;  2GDX A;  5KKZ C;  1S72 P;  1UJZ A;  3FWL A;  4U0F A;  2LXB A;  3VTP C;  1SQV G;  2FVE A;  3GJN A;  2Q5U A;  1S5L E;  3G26 A;  4ZNC A;  2RN0 A;  3MTU E;  2E43 A;  2Z44 A;  3CL3 D;  1X22 A;  2ZYA A;  1OX3 A;  4EIJ A;  2A06 D;  3SWF A;  1L0L J;  3BCC E;  1KMI Z;  3L71 D;  4OGQ B;  3RK3 B;  4XFY A;  3AE7 C;  3AED C;  3DS3 A;  1E0H A;  1JB0 J;  1LTT C;  1SQV J;  1FJP A;  3Q20 A;  2VLO A;  2YKO A;  1SFC B;  1RF1 B;  1DD3 A;  1SQQ G;  1M57 D;  2H8P D;  1MFZ A;  5TIS H;  2FAC A;  2GZI A;  2O01 H;  2WQY C;  4Y99 C;  3CCQ P;  4DJG A;  3CC4 P;  2KOP A;  1Z56 A;  1EQ7 A;  1NU1 J;  3TNU B;  3G21 A;  4NEO A;  4RO0 A;  3T97 A;  1HVV A;  4HB1 A;  1KIL D;  3BAS A;  1QX8 A;  3R2P A;  4UB6 H;  2SPZ A;  5AVZ B;  1BGY J;  2RKL A;  3M9H A;  2AEM A;  2J59 M;  3TGU G;  2QJK B;  2KIK A;  3EFF K;  4ZKP A;  1KOR A;  1SQP D;  4WY4 D;  4ASV A;  2V7Q H;  2N1T A;  3L75 E;  1L0N E;  2IZ0 A;  4H13 C;  3CCM P;  3V2P A;  1BCC E;  3AEF C;  2KUB A;  3CI9 A;  2V4H A;  3DS0 A;  2JKV A;  4BRY A;  1BE3 D;  3PLN A;  2QE7 H;  1H88 A;  3H1L G;  2M5A A;  3TGU J;  5KLV J;  3MHV A;  2KGA A;  5B66 H;  1NTZ J;  1LWU C;  1QVG O;  1JY3 O;  5H2F E;  2KB7 P;  1M56 D;  5K5G B;  1Q7Y Q;  1VQL P;  3T97 B;  3H1K E;  2B87 A;  1HY8 A;  1N2D C;  3L36 A;  1GL2 D;  4Y99 B;  1E79 H;  3H1L J;  1D1D A;  2M3E A;  2GA1 A;  1VQ7 P;  3MZW B;  3OJA B;  2WIT A;  4HH2 A;  3G29 A;  2FVF A;  1L0L K;  2N1T B;  4COC A;  1SQX G;  1KFM A;  4GOD A;  4YXW H;  1M6E X;  3H1H D;  4MN4 C;  2XND H;  1NGM B;  1LTJ C;  1HJ0 A;  1SQV K;  4BRY B;  4U0D A;  4F37 A;  2M5A B;  2MR8 A;  3H1J J;  4H13 B;  1AJY A;  2BQ1 E;  4I7Z C;  4ZKU A;  1JJ2 O;  1NU1 K;  2WSE H;  1SQX J;  2BCC E;  4C7R A;  5GTI H;  1BDD A;  2QIW A;  1FZE A;  3MUD A;  1JY3 N;  1WRG A;  2B87 B;  2Y0E A;  4O9B A;  3TDK A;  1M1K Q;  1AVO A;  4CA3 A;  3BCC D;  2JDI H;  5KJ7 D;  1VQ5 P;  1SLQ A;  2AEJ A;  1GU5 A;  3AEG C;  1URQ D;  1OWA A;  2LOL A;  4IL6 E;  2GDY A;  3Q1M A;  3P8C E;  2D2C D;  1T2K C;  1T8Z A;  3CWB E;  3RL0 D;  2AFE A;  1FE6 A;  2AEF A;  4PJ0 H;  1W2E A;  2E75 D;  4PWV B;  1OXZ A;  2GYK A;  5BS1 A;  3MGE A;  3KPE A;  3B71 A;  3EFG A;  1MFT A;  3L73 G;  5KLV K;  3CCL P;  5AVV B;  1NTZ K;  2M8R A;  2JYL A;  3V4W A;  2JU1 A;  2XU6 A;  1UII A;  2WWW A;  1S4X A;  2KS1 A;  2W8Z A;  1LTA C;  3P05 A;  3P8M C;  3KDP B;  4LC1 A;  1OMI A;  2E5T A;  3A0B H;  3DS4 A;  1K30 A;  5AVW B;  4U7J A;  2GZG A;  4N3Y B;  3L73 J;  3SFE C;  1BCC D;  2KOQ A;  3V4Q A;  3FXE A;  3EJD A;  1USD A;  2L5G B;  2XV5 A;  2P1J A;  3L4F A;  1NTM G;  1NWQ A;  2FYU J;  2OGU A;  2W6A A;  3L74 E;  2FAD A;  1PEQ A;  1LTI C;  1IMQ A;  3MIW A;  3AEC C;  1LGH B;  3VRL C;  3BVH A;  2J5U A;  1VQN P;  1U57 A;  4U3F D;  3VOP A;  3FGA D;  3B4S A;  3S1K A;  2KOS A;  2O3J A;  3GZM A;  3H1K D;  1IZN B;  1KD1 Q;  2Z46 A;  3L35 A;  2KI7 B;  1DV5 A;  4XFJ A;  2N50 A;  3VMZ A;  1NTM J;  1GMJ A;  3ITK A;  2L22 A;  1SQX K;  1PFI A;  3S4R A;  3B5N C;  1G1J A;  1U7J A;  2KS1 B;  1K05 A;  2KYV A;  2WSS H;  2LIW A;  3PRJ A;  2H89 C;  1MZ9 A;  3G71 P;  2JP3 A;  3KHU A;  3SWK A;  1SQQ E;  1CSB A;  1M1J C;  2L0Q A;  3L72 G;  4EYY Q;  5B66 E;  4Y28 J;  1ZXG A;  3RG6 C;  3NY7 B;  1RH5 B;  2JWA A;  2GUS A;  4AUW A;  2ZFC A;  3H6P A;  3GZL A;  1AQT A;  1ZN5 A;  1KIL A;  3C1L A;  1PP9 J;  2N98 A;  1ZLL A;  2IYP A;  5JPA A;  1GD2 E;  1S3J A;  3D6Z A;  2BCC D;  5EJD A;  2LXC B;  4PV1 C;  1FZC C;  1Y9B A;  1PV3 A;  2AVA A;  3L72 J;  1QEX A;  1J1E B;  2PEI A;  1X9V A;  1FR2 A;  1LTS C;  2A45 I;  2P2U A;  4WY4 A;  4OVN F;  1Q2N A;  1OFC X;  1BDC A;  4PXH B;  2N9Y B;  2P58 A;  1M7L A;  4HYT B;  1FS0 E;  1N7S C;  5HVC A;  4YPC A;  1IUQ A;  1FZC A;  1KTM A;  2VRS A;  1NAF A;  2WVR A;  2MF4 A;  1JM0 A;  3D6Y A;  2GZE A;  3NXS A;  3TSI A;  1GXH A;  3P8C D;  4OH8 B;  2OAR A;  2BEQ D;  2IBZ E;  2QSI A;  1L0N J;  3BRV B;  3RBX A;  4L75 A;  3RL0 g;  3CWB D;  1QL1 A;  1N7S A;  1Q81 Q;  1GZL A;  2XV6 A;  2LR2 A;  5DJU B;  3WU2 E;  3C9I A;  5AW2 B;  1OR5 A;  2QEX P;  1LT1 A;  1KIL B;  2K3R A;  2ZAE B;  1IFM A;  1GL2 A;  3CCE P;  1X3O A;  1T6A A;  1RF0 C;  5H2F H;  4M0I A;  3HYB A;  1NTM K;  4WY4 B;  2LIU A;  2CGQ A;  1IK9 A;  3RK2 D;  2PNG A;  1NH4 A;  5CCH D;  1RF0 A;  1FZC B;  3I55 P;  2MR7 A;  4B86 A;  1UIX A;  1VQ9 P;  3I56 P;  2QJY B;  1HH0 A;  2ZT9 D;  3L74 D;  3JSV C;  2YKQ A;  4RKU J;  5AVQ B;  1N7S B;  2WSF H;  3GMA A;  1L2P A;  1H8A A;  1YTZ I;  5CCG D;  4ASW A;  3TK1 A;  3LW5 H;  2JQ4 A;  4JPZ B;  1JO5 A;  1J1D C;  2KGD A;  5DJT B;  2QM7 A;  3L70 G;  4DT0 A;  3WBH A;  2Y9Z A;  1DD4 A;  1GL2 B;  3A0B E;  2Q3I A;  1EXI A;  3V2N A;  4EI2 A;  1L4A C;  4WVZ A;  1KN7 A;  3H1I E;  2Q6Q A;  4JYC A;  5KJ7 A;  2IYO A;  2DW3 A;  1ZOY C;  2K94 A;  1RE4 A;  5F2N A;  1URQ A;  1QVF O;  2E75 C;  3Q5S A;  4UB8 E;  4ZMD A;  1QL2 A;  2FHS C;  1ZP0 C;  3L70 J;  1WT6 A;  4QKO A;  1L4A A;  2H7H A;  1SQQ D;  3M0D C;  4L74 A;  4KJM A;  5GTH H;  5HGN A;  2XNX A;  1NYH A;  3HUS C;  2K1A A;  2A45 H;  5AW1 B;  2H43 A;  1EIA A;  2WSC J;  1L0N K;  3NTN A;  2Z4E A;  1AFO A;  2KG9 A;  3H1H E;  2FXM A;  4IL6 H;  3CMA P;  1KQF B;  2PY8 A;  3HUS A;  1N8R Q;  1DEE G;  3GW6 A;  2Q3E A;  3O6Q A;  3TGU D;  1PPJ E;  3USS A;  4DCK A;  4BPH A;  2FFD C;  3BAT A;  2ITA A;  3PTZ A;  2IFM A;  1KLP A;  1J1D B;  3CC7 P;  3IR9 A;  1G1I A;  2Z45 A;  2FY8 A;  2WPS A;  2KG6 A;  2L9F A;  4NPE A;  4WYM A;  1URQ B;  1PZQ A;  1PGO A;  2IBZ I;  1NU1 G;  2BEZ F;  1A02 J;  2FFD A;  3O8Z A;  2IBZ D;  3E2D A;  1FDO A;  1HBW A;  2YIU C;  2VLQ A;  1L4A B;  3C8V A;  2EHS A;  1S9K D;  5EFW B;  1EDL A;  1N7L A;  3RL0 B;  1BGY G;  5AW3 B;  2E75 B;  1SQB J;  3QWO C;  1EC5 A;  4NPD A;  3HZQ A;  5KAI E;  2QVA A;  1OIP A;  5BU8 B;  3KYQ A;  3HUS B;  1KQL A;  3VMA A;  1PGP A;  4H2X C;  1ZR4 A;  1AV1 A;  2WTY A;  4C46 A;  2LML A;  1J2J B;  3H32 A;  1N86 A;  2PP6 A;  2Z5H A;  1VHN A;  2AXT E;  2KSJ A;  3O6Q B;  2N1T C;  3EJE A;  2IDB A;  3FWN A;  1RY3 A;  2GDW A;  2V7Q J;  2K9Y A;  3GHG C;  4EOT A;  3OW2 O;  3AE1 C;  5KLV G;  1A43 A;  2JGP A;  3Q2Y A;  5B5E H;  1NTZ G;  3N4X A;  3K5B A;  1CEI A;  2HFE D;  1ZRT D;  3WUV A;  1D7M A;  2FFD B;  1JCD A;  2P67 A;  3GHG A;  1JTH A;  2VLN A;  1YIJ P;  1S5L X;  1SS1 A;  1GW3 A;  2E74 D;  1NTK J;  2YIU B;  4WBA A;  1OW7 A;  1KZU B;  3AEB C;  1QRJ A;  2A06 G;  1AUM A;  3RG2 A;  1YIT P;  1M6N A;  5BS2 A;  4U3F E;  1VF5 D;  2VSQ A;  2XXM A;  3H1I D;  2YMK A;  3H32 B;  3Q5P A;  4XE5 B;  3CCU P;  2X2B A;  4AQR D;  3H1J G;  1BAJ A;  1FOS F;  4JYB A;  1FBM A;  1EZV G;  1JY2 N;  2MY5 A;  3L71 J;  1FDM A;  1DX7 A;  4D6T E;  1DH3 A;  4DOJ A;  3GHG B;  2I8D A;  2M8N A;  3PH0 A;  4K3A A;  3CCV P;  4H44 D;  2GZJ A;  1JTH B;  2NPS C;  2WSE J;  4U0B A;  1SQB K;  1PEM A;  3RK2 C;  3MUD C;  4R4L A;  2NRG A;  4GT1 A;  1SQP G;  1PPJ D;  3NFQ A;  3HD7 C;  3WU2 H;  2M8P A;  1KQS O;  1CI6 A;  5KTB A;  1VQM P;  1OVU A;  2NPS A;  5AW7 B;  4WB4 A;  2E42 A;  3S9O A;  5GTH E;  1EDI A;  1BSN A;  5CCG C;  1BE3 G;  5CMZ A;  1PIX A;  3A0H E;  3HD7 A;  2L91 A;  5EW5 E;  1NOH A;  3GF7 A;  5TJH A;  1OW8 A;  1EOQ A;  1SQP J;  1M8O B;  1IFD A;  2WPQ A;  3PHL A;  5CCG A;  3G4S P;  3H0D A;  1HUC A;  2JB0 A;  1ZNV A;  1YJ9 P;  2KLU A;  1F80 D;  1VPC A;  2M5R A;  1BE3 J;  1VQ8 P;  3G1G A;  4BXL A;  2KZJ A;  2HOD A;  2W83 C;  2CQ8 A;  2K2Q A;  1NTK K;  2B88 A;  2YXQ B;  5APU A;  1SFC D;  2FYU G;  1CI6 B;  2ZYD A;  5C39 A;  2NPS B;  3RK2 B;  5BVZ A;  1IFN A;  1RO2 A;  2O01 N;  2FAE A;  4A7P A;  3HD7 B;  4L73 A;  3EWK A;  2AF8 A;  2ZT9 B;  1DIP A;  4UB8 H;  2OYO A;  3TF5 A;  2ZVN B;  1A8O A;  1L0L E;  1HJB A;  1FZG A;  1J1E C;  3H1H J;  4BWN A;  2K0D X;  3KZI E;  2YXR B;  2K93 A;  4COP A;  2OTJ P;  1X8Y A;  2K0Y A;  1XTG B;  3BCC G;  1OZH A;  1SQV E;  2OYI C;  2HOD B;  2E5Y A;  3SFD C;  5HGO A;  4M3L A;  2KK7 A;  5B5E E;  2N6Z A;  4IL6 X;  1NU1 E;  1FU1 A;  3KXD A;  2OYI A;  1PGQ A;  4U0A A;  3CCJ P;  2C9L Y;  4C7N A;  3OA7 A;  1PP9 G;  2WT7 A;  1VQO P;  4IFD K;  2G8Y A;  4JQ0 D;  3BCC J;  4GDO A;  1FZA A;  2BHV A;  4D6T D;  1KIL C;  3NMD A;  2KOG A;  3WMM 0;  1N73 C;  1SQP K;  4U0E A;  4RJT A;  2PRR A;  1H0T A;  3D71 A;  1LT9 A;  2K37 A;  1L0I A;  1N73 A;  4WY4 C;  4BPF A;  2CWO A;  1VQ4 P;  4XFZ A;  3WUU A;  3DTJ A;  3L75 G;  2G3A A;  1L0N G;  2MVV A;  1BCC G;  5KAI H;  3TGU E;  2ROQ A;  5KLV E;  1YBK A;  5AVY B;  2QJY C;  1KFN A;  4R0M A;  2GZF A;  1NTZ E;  4PD4 E;  3VP8 A;  2NZ2 A;  1P84 E;  2P9X A;  1KYO D;  1R5L A;  2PGD A;  2N9B A;  1MUU A;  2FYN B;  2E74 C;  2OYI B;  1R5S A;  2AXT H;  4C7N B;  2WT7 B;  3CXH E;  1Y47 A;  1H89 A;  1SVF A;  2CK3 H;  3L75 J;  1BSH A;  3H1L E;  1T8K A;  3H4E A;  1BCC J;  2LPK A;  1S9K E;  1HTL C;  2OTK E;  1MZ8 A;  3H25 A;  5AW6 B;  3GF3 A;  1GL2 C;  2K0X A;  1NKZ B;  4DG9 A;  2E76 D;  2FYU K;  1H0T B;  3F5H A;  2R44 A;  3F89 A;  2JYG A;  4RES B;  3SSU A;  1LT9 B;  3LRY A;  3E7K A;  2EG5 A;  1N73 B;  3A3Y B;  2UWJ E;  4U3F J;  3M06 A;  5CJ0 A;  2ONT A;  2MVU A;  3H1K J;  3H1J E;  1SP4 A;  3V5B A;  1JNM A;  2R32 A;  1RQU A;  1SQX E;  2WPR A;  2P7J A;  2C9N Y;  2JAZ A;  1GU4 A;  1ZRT E;  2WSF J;  1LJ2 A;  3H47 A;  1VDF A;  3LW5 J;  2BCC G;  5AW8 B;  5APT A;  1L0L D;  4HJG H;  3VMX A;  3PP5 A;  2FYZ A;  2E74 B;  2B9B A;  3LMO A;  4IOI H;  1SQV D;  5KJ7 C;  2A45 G;  4HKG A;  1JOC A;  3OAK A;  1RE4 C;  1URQ C;  2JO1 A;  4LGD E;  1GDT A;  2K5X A;  1T3J A;  1PGJ A;  2LL8 A;  2IX7 C;  2D2C C;  4H2W C;  2PEO A;  2JU2 A;  2BCC J;  3LID A;  4JBZ A;  5APQ A;  1NU1 D;  3V2R A;  2FVA A;  3RL0 C;  1Q86 Q;  1VKU A;  1T3U A;  1AA0 A;  1Q90 D;  2B89 A;  2FQ2 A;  2M8L A;  3VMY A;  1R8E A;  1MKM A;  2ZJS E;  1X0T A;  4TLF A;  1IC2 A;  5KLI B;  2CNR A;  1LTG C;  1BGY D;  2DNW A;  1JY3 P;  1T2K D;  4GOF A;  1E5W A;  1L0H A;  2P10 A;  3L37 A;  3A0H H;  1KYO H;  1PEU A;  1QGK B;  3M9B A;  4H44 B;  2NO8 A;  3CC2 P;  3CWB J;  3U59 A;  2M3B A;  3L73 E;  1PL5 A;  1XTC C;  4H0L D;  2K88 A;  1HGV A;  1K9M Q;  4PD4 I;  5KLV D;  1P84 I;  2YNY A;  4LLH A;  1NTZ D;  4PD4 D;  1SQB G;  3AE3 C;  1M90 Q;  1P84 D;  1YYC A;  2M0B A;  1S2E A;  3CE7 A;  5I4T G;  3V6I A;  2E1M A;  2FXP A;  3Q3D A;  3AEA C;  1IFP A;  1RHZ B;  3CXH I;  3DPH A;  3CXH D;  2KOD A;  1FAV A;  4IFM A;  3RBZ A;  3MGN A;  1Y8A A;  3JC2 2;  2D2C B;  1NTM E;  3M1M A;  2PEN A;  3H1L D;  4PH0 A;  2O01 J;  2ZXX A;  1ZR2 A;  2GUV A;  2GM4 A;  3M9Q A;  1GXG A;  2KOO A;  5KAF E;  3L74 J;  1USE A;  2BUO A;  3VN0 A; 
#chains in the Genus database with same CATH homology
 1RO0 A;  3DS2 A;  1YJW P;  2M8P A;  3DS5 A;  1KQS O;  1A43 A;  1VQM P;  1EIA A;  1YHQ P;  1Q86 Q;  4IPY A;  3G26 A;  3H4E A;  4COP A;  2OTJ P;  2EIA A;  1QVG O;  2M8L A;  2Z44 A;  3CCE P;  3CMA P;  2PEK A;  1Q7Y Q;  1VQL P;  1K73 Q;  2PY8 A;  3CME P;  5HGM A;  3G71 P;  5HGO A;  4XFX A;  4M0I A;  1N8R Q;  4GR6 A;  1YJN P;  2PEQ A;  5BS1 A;  3HYB A;  3MGE A;  4XFY A;  3G1I A;  2JYG A;  5F2O A;  2DGY A;  3DS3 A;  1PEU A;  3LRY A;  3CCR P;  3RG6 C;  1EOQ A;  4PH1 A;  3B5I A;  1YIJ P;  2EG5 A;  3CCL P;  1YI2 P;  4U0A A;  3CC2 P;  3CCJ P;  3G6E P;  1D1D A;  1VQP P;  3Q20 A;  3I55 P;  2JYL A;  3G4S P;  1VQO P;  3H0D A;  1VQ7 P;  1QRJ A;  4GR2 A;  1VQ9 P;  1AUM A;  1M74 A;  3CC7 P;  5JPA A;  3I56 P;  1YJ9 P;  2ONT A;  1YIT P;  1M6N A;  2Z45 A;  3G28 A;  3CPW O;  5BS2 A;  4WYM A;  2L6E A;  3CCQ P;  2XXM A;  3G29 A;  2BHV A;  3CC4 P;  4COC A;  1VQ8 P;  3P05 A;  1ZMB A;  3G1G A;  1K8A Q;  3G0V A;  3E2D A;  3G21 A;  1VQ6 P;  1M6E X;  1K9M Q;  3DS4 A;  1K30 A;  4U0E A;  3DS1 A;  3CCU P;  2LF4 A;  2PEI A;  2EFJ A;  4QNB A;  4XRO A;  4U0D A;  3CD6 P;  1M90 Q;  1BAJ A;  5I4T G;  2OTL P;  2E1M A;  1KC8 Q;  3WBH A;  3H47 A;  2BQ1 E;  1NJI Q;  1IUQ A;  4XRQ A;  2CWO A;  2XT1 A;  1VQ4 P;  3HZQ A;  5F2K A;  3DPH A;  2QEX P;  4XFZ A;  2KOD A;  1RO2 A;  3DTJ A;  1JJ2 O;  3CXC O;  1PEQ A;  4U0C A;  3CCS P;  2OAR A;  3M1M A;  2PEN A;  5F2N A;  2QA4 P;  1RNI A;  5HGL A;  1QVF O;  1PEO A;  3NTE A;  2M8N A;  1W2B O;  4PH0 A;  1E6J P;  3CCV P;  1Q81 Q;  3VRL C;  3CCM P;  2PEM A;  1VQN P;  4U0B A;  2XV6 A;  1VQK P;  1PEM A;  2P9X A;  1M1K Q;  2JO0 A;  1KD1 Q;  2Z46 A;  2PEJ A;  3DS0 A;  5DCK A;  1Q82 Q;  2BUO A;  1VQ5 P;  1S72 P;  5HGN A;  2PEO A;  1A8O A;  4U0F A;  3OW2 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...