3CD6P

Co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 44
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cd6P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cd6P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cd6P02
3I56P 3CCJP 2OTLP 1KQSO 3CC4P 3G6EP 3CXCO 1K8AQ 3CCLP 3CC2P 1YJ9P 1VQNP 3CMEP 1VQ8P 1YIJP 3CCQP 3OW2O 1K9MQ 1M90Q 1VQOP 1YJWP 1KC8Q 1QVFO 1W2BO 1Q86Q 1JJ2O 3CCUP 1VQ5P 1K73Q 1VQPP 3CCRP 1S72P 1YI2P 1NJIQ 3CCEP 1VQ6P 1Q82Q 1QVGO 3CCMP 1YJNP 1N8RQ 1M1KQ 3G71P 3CMAP 1VQLP 3I55P 1VQ4P 1YITP 3G4SP 1VQ9P 3CD6P 1YHQP 1Q81Q 1KD1Q 1VQ7P 3CC7P 2OTJP 3CCSP 2QEXP 1VQMP 1Q7YQ 3CPWO 3CCVP 1VQKP 2QA4P
chains in the Genus database with same CATH superfamily
2MVVA 1H0TA 4QMAA 2HFED 2N98A 1EQ7A 1FZEA 1PGJA 1W2BO 2B88A 5AVSB 2ZYAA 1QL2A 2OYOA 1IO4A 1NTZE 1MUUA 4KJMA 2XT1A 5BS2A 2BQ1E 3CX5E 2L91A 3M1MA 3AEDC 4H2XC 3H25A 1JTHB 2RH0A 1RE3C 2OYHB 2LKMA 1P84H 1R5LA 5AW2B 1G1IA 2ZJSE 1S1CX 1CSBA 3H1HD 5HGMA 4Z1MH 2BCCJ 2IFNA 2FXOA 3G0VA 5CCHD 3NTEA 1OVVA 1VQNP 1GL2A 1IFDA 2PEOA 2PRRA 2QJPC 3ABVC 2P10A 1L4AA 1RF1B 2D2CB 3GF3A 3D6YA 1OZHA 1BGYD 4ZNCA 3GG2A 3KDPB 3A0BE 4EI2A 2JWDA 1IFPA 3C9IA 3WUTA 3B4SA 2C0WA 1RHZB 1KV4A 3H1JG 5EJDA 1KN7A 1SQPD 3L73E 1FS0E 3EJBA 2GA1A 1AV1A 4U0BA 3S9OA 3VTPC 1VQ5P 4KT0J 1YQ4C 1JCDA 1NU1K 1NTMJ 1U7JA 1JY2O 3L70E 3VYIA 1N73A 1ZN5A 3VMXA 2E1MA 3I56P 5GTHE 2QRXA 4RESB 4PD4E 1NWQA 3VMZA 2R5DA 2M3EA 3P8MC 1RH5B 2GUSA 3L72D 2EHSA 1LNQA 1RO0A 4W7YA 3NY7B 2LOLA 1Q7YQ 5BVZA 4D6TJ 2HODA 1SQXK 1W5CE 5C39A 3A5TA 3L73G 5KAFE 1BE3G 1NQ4A 4H2WC 1K73Q 3LMOA 1XTCC 2PGDA 3H1ID 1L0IA 2XKMA 3G3ZA 3SSUA 4EIJA 3H1IG 3CL3D 1KD1Q 2CGQA 2YNYA 1PEQA 1OVRA 4COPA 3B5NB 1L2PA 2A45H 3MUDC 1SQVE 2KB7P 2OQQA 4HH2A 1OX3A 5AVTB 2AF8A 4UB8H 4U3FD 1AQTA 1QEXA 3OJAB 2X2BA 1PP9J 1G1JA 5DJTB 1KYOH 2UWJE 5APUA 2FKWB 2E74D 2WQYC 2KZIA 1HUCA 2D2CC 2CG5B 4C7NB 2P9XA 2KORA 1Y47A 2K5XA 1OIPA 4TLFA 1N8RQ 2XZRA 2JDIH 4U0FA 2K9JA 3V6IA 3HYBA 1NTZG 2JYLA 2WITA 2E42A 1PP9G 2KZJA 5AW7B 2L4BA 1EC5A 1GL2C 2XV6A 1FJKA 3EFFK 4LLHA 2QVAA 2N5IA 1Y9BA 4NEOA 1QVGO 1GMJA 4I6MC 1FAVA 4HB1A 1KYOD 4U3FE 3HZQA 2FACA 1K05A 1T2KD 1ZMBA 2LL8A 3IF4A 2FQ1A 3MZWB 1ZRTE 2ZVNB 3DTJA 2BCCE 2YKQA 4WY4B 2WSSH 2XU6A 3RK3D 3AE7C 3RK3C 1URQB 3CE7A 4NPEA 5APVA 1KTMA 3B71A 3CX5I 3G26A 2OYHA 4GOEA 3KPEA 3LRYA 1FU1A 3D71A 1VQ7P 1EDIA 2G8YA 5HVCA 1RE4A 4H44D 2N9YB 5APTA 1BSNA 2JP3A 3CXHD 1AF8A 1PL5A 2MF4A 3K5BA 4YPCA 1OW8A 3VP9A 2C9NY 3IAOA 2KYVA 2W6JH 2KLVA 1GK4A 5B66E 2PEKA 5KLVD 2K3RA 5KAFH 1BCCD 1JNMA 3CC7P 1VQMP 2BCCD 1EZVD 3H1HJ 1SFCB 4N6JA 3WUVA 1DNYA 1GXHA 2O01H 1H8AA 3MD0A 3CCRP 1AVOA 1X9VA 3L74J 2ZYDA 2JR8A 5I4TG 3AE1C 4JYBA 4IL6H 1Z56A 5KLVJ 1NTZD 3KZIH 3TGUJ 4WYMA 1ACPA 4UB6H 4UHPB 4Y99C 1NTMD 1YBKA 1S72P 1L4AB 2W8ZA 1IUQA 2L22A 2NPSA 3PJSK 3NTNA 2OTJP 3D6ZA 4PJ0H 5AVQB 1NTMK 1NTKJ 3CC2P 3CMEP 1SFCD 1X79B 5APXA 1KZUB 4N3YB 3Q1MA 1K04A 1LTTC 5CCGA 2Z5HA 3M9QA 2RN0A 2E74C 2Q3EA 5CBOA 5CHXA 2GM4A 3RL0B 2E43A 1LTGC 1PZQA 2JB0A 1M1JA 3P32A 2JBGA 1SQXJ 1FZCA 3IR9A 2GZGA 3AE3C 2KS1B 4EYYQ 2OTKE 5AVVB 5CMZA 2AXTE 2E76B 3H6PA 4WB4A 2KW2A 3UIAA 1KYOE 3NFQA 3CCMP 3RL0g 5JPAA 3GLMA 3SWFA 2Y0EA 2QEXP 3CCVP 2HLOA 4BPHA 1YJ9P 3H1KE 2KG8A 1URQA 2IBZG 1FDMA 1DIPA 2K0YA 2LIWA 2HYNA 2HPCB 1FOSF 3HUSC 3MP7B 2E75D 3BASA 3RBXA 2OARA 3KYQA 1K30A 5KJ7C 1BAJA 1EZVG 3L74E 1SP4A 1VQOP 5CCGC 2R3CA 2WSCH 2Z5IA 1P84D 2P1JA 3GZMA 4QKOA 1KMIZ 3M06A 3AEFC 2M8NA 2AFDA 1GL2B 3QWOC 1M8OB 5AVYB 1EOQA 4WVZA 3CWBE 3RL0D 2BASA 2LTEA 1HGVA 2FFDB 4PD4H 1NGMB 4GR6A 2NRGA 1DD4A 1OR5A 2IBZI 2MD9A 1SQBG 2IFMA 1QGKB 1DH3A 4IZ6A 2O01N 3VMYA 1VQLP 3A7OA 1ZMEC 3RK2D 3LW5H 1KFMA 1SQXG 3BCCJ 3USSA 1AQ5A 1PP9D 1SQQJ 2MVUA 2EIAA 1BGYJ 4RO0A 3TNUA 1L4AD 3L72J 1L4AC 4DZOA 3H1LD 5AVUB 2CPBA 4ZMDA 2I8DA 1FC2C 1FE6A 4GIFA 3AE9C 4L73A 4RKUJ 2FQ2A 1H0TB 1HWTC 3PHLA 1JM0A 5CJ0A 3WU2H 4L75A 2Y9YA 5KLIB 2Z44A 5HGNA 1KB9D 1IMPA 4DT0A 5TJHA 1KILA 3FGAD 1VPCA 2W83C 1PPJE 3Q3DA 2KGAA 1VQ6P 3P8CE 1S4XA 3Q2YA 2WZ7A 2AEFA 2A45I 3Q20A 3DS1A 5KP8B 1PEUA 2J58A 2AEJA 1JY3P 1M7LA 2KS1A 2Q9IA 1FZCB 1WRGA 3L35A 1VF5B 1KORA 3RGUA 1YJWP 2Q5UA 3B8EB 1JY2N 1PP9E 2N6YA 2FYUD 2IBZD 1SQBK 4AYCA 1NU1J 2OGUA 2VLPA 1ZOYC 3LIDA 2JGPA 1LWUC 2QJYB 1H89A 1S5LE 1SQPK 3W67A 5APSA 3E2DA 4PV1C 3TGUD 2GDXA 1JO5A 3NXSA 2KGCA 1Q90D 2N1TA 2AFEA 3O6QB 1OWAA 2PNGA 1PGOA 4BWNA 1EIAA 2KOPA 5F2NA 2VSQA 3G4SP 1N7SC 2A06D 3L72E 2LKIA 3WMM0 2AEMA 2N5HA 2FFDC 4W80A 2E75C 3P7KA 2FYUJ 2IYPA 1IC2A 4C7NA 3CCLP 2DGYA 1RF1C 1PGQA 3DS4A 3MUDA 1OMIA 2PAJA 3EJDA 4MRTC 1GD2E 3DS3A 1E5WA 1T8KA 2FXPA 2V7QH 4I7ZB 2NPSD 2GUVA 2YMYA 2JKVA 3AE8C 1NU1E 4H0LD 1KQLA 4R4MA 2M8RA 2GYKA 3CCQP 2H7HA 1L0LK 2MR8A 5CZDB 5K5GB 1VL2A 2K93A 1NKZB 3L71E 2ONTA 2KSJA 2P58A 1N7LA 1VQ9P 2H89C 4WY4D 5DJUB 3AEEC 2WVRA 3KHUA 3M0DC 1FDIA 4XFZA 1S9KE 1LWUB 3BRVB 2KGDA 2QE7H 2OYIA 4WY4A 3DS5A 3VOPA 2KXPB 1OW7A 2M5AA 2Q1KA 2KODA 1IFIA 3L70G 2LIUA 2KG9A 4PV1D 2PEJA 1ZNVA 3A0HE 4ASVA 1NO4A 2N1TB 4K35A 1E0HA 2IBZE 3FXDA 3SFEC 2OTLP 1U7MA 1HBWA 5H2FH 2N6ZA 1X8YA 1KC8Q 5GTHH 1FZBA 1HF9A 2WWWA 1BGYE 1NTME 4WBAA 4M3LA 1N73C 3P05A 4GR2A 5TISE 1DEEG 3CPWO 2WT7A 2FYUE 2WSCJ 2WPSA 2KI7B 4ZKPA 5APYA 1VQ8P 2MY5A 3MGEA 4JYCA 3V2PA 3WU2E 1R8EA 2ZYGA 4COCA 2YKOA 2YXQB 4DJGA 2A45G 3MIWA 1PGPA 2E76C 3EQ2A 1YITP 2OYIB 1MFTA 1L0NJ 2L6EA 1M6EX 1L0LJ 2R44A 3PTZA 1SQQD 5B5EE 2M5RA 1FDOA 3PP5A 5AW5B 3P8CD 2QM8A 2JQ4A 3N4XA 2AXTH 4XROA 3HRNA 1N7SA 5APWA 4H13B 3H32B 3KZIE 2FVEA 1J1EB 2N50A 3U59A 2IDBA 2QJKB 3Q5SA 2H43A 5KLVE 1AUMA 2FXMA 3AEGC 3H47A 5AW4B 2QJPB 1XTGB 1T3UA 3CWBJ 1JMMA 1G2CA 3M9BA 1KILD 1FJPA 2B87B 5BU8B 4YXDC 1M1JB 2WPRA 4DOJA 1M57D 2K9JB 4F37A 4WWIA 2PENA 1NTKE 1PEOA 1DEBA 3GMAA 4YTPC 1FZAA 3HD7B 1SQPJ 1HVVA 2ZXEB 1U57A 3HD7C 2E5TA 2M3BA 3AEBC 2LXBA 3RK2C 1JUNA 2I1JA 4PV1B 1M1JC 3KXDA 2K0XA 2P2UA 2BEQD 1A02F 3B5NC 2Z45A 2SPZA 2GZIA 3H1JD 1JOCA 1JMBA 3HTKA 1SQVK 1BE3D 1UJZA 1SS1A 3T97A 2KGEA 5BS1A 2QA4P 2LR2A 1AJYA 2POHA 3G21A 2O01J 2BCCG 4PXHB 5KKZB 3L74D 4HKZH 1HY8A 2JO0A 2J59M 2FYZA 3VRLC 3AE2C 2O1JA 2KWLA 3S4RA 1NOHA 1WT6A 1LP1B 2R32A 1YHQP 2ZVOB 1JTHA 3EJEA 3RG2A 3H0DA 1KLPA 1OW6A 5AW8B 3CXCO 1KB9I 4XFXA 1EZVI 3SFDC 1YI2P 4GT1A 1BCCG 3DS0A 1NYHA 1ZRTD 3WUUA 3H1KG 2M5AB 3A0BH 1S5LX 5KLVK 2PEIA 2KOOA 1SQQK 3EFGA 3L36A 1IFJA 2MR7A 4Y28J 1YTZI 1M1KQ 1HTLC 1LTJC 3CD6P 3ZDMA 4LGDE 2KSEA 1KFNA 2CK3H 1SFCC 1NKNA 3H1JE 5KJ7D 2OYHC 2QJYC 3GF7A 2QM7A 1MV8A 4OGQD 4JPZB 1NTKD 4MN4C 1BE3E 3G29A 1KILC 2EFJA 2KIKA 3TSIA 2K94A 2YO2A 5CCHA 1EMVA 4U0AA 3TYYA 3CCUP 1BXIA 2K37A 2Y0CA 2KOSA 2LMLA 5HGOA 2JEEA 3OA7A 1L0ND 2Y0DA 4C7RA 2CWOA 1PFIA 1USEA 5H2FE 5AW0B 1BCCJ 3L71G 3MHVA 2ROQA 1LTJB 2MKVA 3B5ND 4H13C 4I7ZC 3I55P 1GTWA 1LTBC 3FX0A 2M8PA 3M0DA 2B87A 2JO1A 3N7NA 3U43A 2V7QJ 3PH0A 3HD7D 3IN6A 1T3JA 3H1KJ 3VN0A 1LGHB 2A06G 2Z46A 1VQPP 3U1CA 2YO3A 1NTZK 4PD4D 1AVYA 3PLNA 1LP1A 3JSVC 3H4EA 2CQ8A 1L0LE 1L0HA 1S3JA 3CC4P 1OVUA 3HE5A 4L76A 1L0NG 4HKGA 3AE6C 3L37A 2GDWA 3RK3E 2PFXA 1QLED 2K9YA 2PP6A 4LC1A 2NPSC 1L0LG 1QX8A 3V2RA 4U0DA 1SQVJ 2P7JA 3CX5H 4TT3H 1ZXGA 3B5NA 1K9MQ 3ITKA 3V2QA 4B86A 3A2AA 3WBHA 1UNKA 1RNIA 3CCEP 1ZV8A 2WMMA 3H1LG 4NPFX 2E5YA 1T2KC 4ZKUA 2HPCA 3G9RA 2P67A 2N1TC 3EWKA 2BUOA 1X3OA 4GKGA 1ZP0C 1NTKG 1RE3A 2D2CD 3TNUB 4PH0A 1R5SA 1CW5A 3H1HG 1VF5C 2M8LA 1A02J 1J1DB 1PPJG 3M9HA 1SQBD 1HQBA 5KP6B 1WMKA 3L70D 3AECC 4XFJA 2XZ1C 4GOFA 4IOIH 2MJZA 3L75E 4U7JA 4K3AA 4A7PA 2W6AA 4OWFA 5KLVG 3L73J 1W2EA 2BEZF 3TF5A 1SQBJ 1L0NE 4BRYA 2G3AA 4N78D 1CI6A 3E1IA 3AE5C 3CWBD 1Z6MA 2I1KA 3H1IE 1M74A 1M90Q 1HJBA 1ZR4A 2DNWA 1VHNA 1LTJA 1NTZJ 2L0QA 3BCCE 1LWUA 1J1EC 2YXRB 2VLQA 1SQBE 2R5BA 2W6BA 4PJ0E 2W90A 4H13D 1HGZA 5DCKA 3GJNA 1KB9H 3L71J 3O6QA 2XNDH 3G1GA 3G28A 4U0CA 1GXGA 2XV5A 4PH1A 3L74G 3CXHI 3R2PA 2VRSA 1VF5D 5F2KA 1YTZT 1YIJP 1KQFB 1NAYA 2O1KA 3B5IA 1SFCA 1S2EA 2ZT9B 1TU3F 4BPFA 4L74A 4XRQA 4DG9A 1BSHA 4YXWH 2ERHA 2L9FA 4OGQC 1QRJA 5KLIC 4R0MA 2QG4A 4H2YC 2PY8A 1K8AQ 1BDDA 2WTYA 1RF1A 3U1AA 4OVNF 2QNWA 3MGNA 1CI6B 4JQ0D 1SVFA 4RJTA 1GPJA 4HJGH 5EFWB 2V4HA 2GDYA 4WY4C 1HH0A 2KR5A 5APQA 2FADA 2FYNB 2CPSA 4HYTB 4EDFA 2JYGA 2IZ0A 1KQGB 4XA4A 3TDKA 2XZ0D 2K88A 2NZ2A 1A43A 1NTMG 1BGYG 2W27A 4PD4I 1S9KD 5AW9B 3VP8A 5KAIH 3CCJP 1IK9A 3LW5J 3GHGA 4BXLA 4N78E 1JY3O 2FVFA 1GL2D 1BCCE 2FVAA 2PEQA 5HV8A 1IK7A 3L72G 1JCCA 3W68A 4O9BA 2QJKC 1LT9C 4H0LB 1D7MA 1UIIA 4IL6E 4BRYB 1FR2A 3Q5RA 1D1DA 3L75G 4XFYA 2JJLA 3L70J 1IFNA 5KJ7A 3F89A 2FFDA 2YMKA 1PEMA 4CPGA 2KG6A 3DS2A 4CA3A 1NTKK 2KNCB 3A3YB 1JY3N 1FZCC 5E79E 1EXJA 1RQVA 2K1AA 3JCUE 3V4QA 2GZFA 4BPGA 1CEIA 1YYCA 4GDOA 5KTBA 1JY2P 3QH9A 2WPTA 4IPYA 3HE4B 1AA0A 3JC22 3H1IJ 2B9BA 1ZLLA 1NAFA 1MFZA 4AUWA 1KILB 2E76D 1DX7A 1YQ3C 1URQC 2K2QA 3GW6A 4U3FJ 3JCUH 1G2CB 3HE5B 1PPJD 2ZT9C 1FOSE 4IFMA 3CLQA 1FZFA 1T6AA 3OW2O 1MZ8A 3HD7A 1X22A 4XE5B 3SWKA 5CCHC 2KOQA 2GZJA 1URQD 1JB0J 4U3FG 2WPQA 2XNXA 4EOTA 4H44C 5AW6B 4DCKA 2J5UA 5F2OA 2A06E 3AEAC 2Z4EA 1NJIQ 3T97B 3AE4C 3L4FA 2JAZA 3L75D 1L0LD 2GZEA 2WSFJ 2WSEJ 1GK6A 3H1LE 5E79H 3RG6C 2JU2A 4M0IA 1KB9E 7CEIA 2K0DX 2C9LY 1M6NA 1VDFA 4IFDK 1IZNB 2ITAA 1SQPE 3L73D 1S5LH 3V4WA 5M1BA 1GU5A 1SQVD 4GODA 3SWYA 2KLUA 1EZVE 1NH4A 3GHGB 2FAEA 2YIUB 3I5CA 4C46A 2Y9ZA 2LPKA 4OGQB 3DPHA 3E1RA 4U0EA 2JU1A 1E6JP 3B4QA 2KUBA 1JEKA 3BATA 1FZGA 3BVHA 3BCCD 3V2NA 1SQVG 2O3JA 5GTIH 1QL1A 1N86A 1SLQA 1IMQA 3D70A 1SQQG 2FBWC 1SQXE 1E79H 1ZW0A 3LIEA 5EW5E 1GU4A 1VKUA 3L75J 3FXEA 1VQKP 4UB8E 3CI9A 3R4YA 1BDCA 1PV3A 3CWBG 1QVFO 2PEMA 3HUSB 2JWAA 1Q86Q 3OAKA 5AVZB 1KILE 1GDTA 4I2LC 2NPSB 1USDA 2FHSC 3F5HA 2LF4A 3Q5PA 5AVWB 5TISH 3GHGC 1NVOA 1BE3J 4KHXA 5BU5A 5AVRB 1PIXA 1SQPG 2YIUC 3PRJA 1RF0A 3H1LJ 1SQXD 1A8OA 1LT1A 1UIXA 3RL0C 5AVXB 3II6A 1GZLA 4H44B 1LT9A 1NU1D 3O8ZA 3VMAA 1LTSC 3G71P 1CZQA 3FWNA 3V5BA 3G1IA 4R4LA 1NU1G 2Q3IA 2WT7B 3CCSP 5CBNA 2KP8A 2VLNA 4OH8B 2AXCA 3IFMA 1RO2A 2WSEH 2E75B 1KYOI 2E74B 2L5GB 3FWLA 3CXHH 1EDJA 2FY8A 2XDJA 3H1KD 3BRTB 2RKLA 2LXCB 2IZ1A 1SQQE 1LJ2A 3M0AA 5KKZC 2IX7C 1IFMA 1OFCX 5GTIE 2ZXXA 3HE4A 1N7SD 1RE4C 1EXIA 3C8VA 2IPPA 2KOGA 4Y99B 3C1LA 4IL6X 1JJ2O 3H32A 2R3SA 1DD3A 1N7SB 2EG5A 4JF7A 3RK2B 4W7ZA 1Q2NA 2HG5D 3E7KA 1OXZA 1X0TA 1Q81Q 2EHTA 5CJ4A 5B66H 4AQRD 1EDKA 4D6TE 1KQSO 2ZFCA 1J2JB 2Q6QA 2QSIA 1H88A 3TK1A 2WPVB 1FBMA 3MTUE 1N73B 3NMDA 5KP7B 1YJNP 3S1KA 3CMAP 2K92A 1IJDB 5L8RJ 2H88C 2ZAEB 2RMZA 2Q7CA 4QNBA 1DV5A 2IYOA 1F80D 4PWVB 5AW3B 4D6TD 1T8ZA 3KQGA 1M56D 3TGUG 1P84I 3CX5D 2VLOA 5KAIE 2YKPA 2HODB 2AVAA 1VQ4P 1AYIA 2QIWA 1EDLA 5B5EH 2CNRA 2KNCA 1Y8AA 2NO8A 1LTAC 1MZ9A 1LTIC 1NHLA 4ASWA 2DW3A 3RK3B 1Q82Q 5AW1B 2FQ0A 3BCCG 2WSFH 1MKMA 4D6TG 2OYIC 3GZLA 2ZT9D 2HR3A 3G6EP 4NPDA 5HGLA 3GKLC 1LT9B 4H0LC 3CXHE 1GW3A 2KK7A 1N2DC 2BHVA 1P84E 2M0BA 2C0XA 2FYUK 2B89A 3A0HH 3M91A 4I1LA 4UB6E 2FYNC 5CCGD 4IFFA 1RF0C 2FYUG 2XXMA 4JBZA 2N1TD 2H8PD 1AFOA 2N9BA 3TGUE 3L71D 3RBZA 1RQUA 3HUSA 1J1DC 3HTKB 1ZR2A 1HJ0A 1L0NK 1GW4A 1RY3A 3H1JJ 3H1HE
chains in the Genus database with same CATH topology
1AUMA 2CWOA 4QNBA 3I56P 3H47A 1K30A 3CXCO 2BUOA 2XV6A 3DS5A 1BAJA 5F2KA 4WYMA 1A8OA 1YIJP 1VQOP 1YJWP 4PH0A 1PEMA 1W2BO 3B5IA 4XFXA 2KODA 2M8LA 3RG6C 1RO0A 1S72P 1YI2P 3DS2A 4M0IA 1QVGO 3DS0A 1IUQA 3G71P 4XRQA 3I55P 1VQ4P 3G1IA 2XT1A 5BS2A 2BQ1E 1M6NA 2PEJA 2M8NA 2OTJP 1QRJA 3HZQA 3CCSP 1ZMBA 3M1MA 1Q7YQ 2M8PA 3E2DA 1EOQA 2OTLP 2PENA 3DTJA 1RO2A 2PEIA 2PY8A 1K8AQ 1PEOA 3CC2P 3CMEP 4GR6A 1KC8Q 4IPYA 1EIAA 2Z46A 1VQPP 1K73Q 5F2NA 3G26A 1Q82Q 1M1KQ 3LRYA 1VQLP 3P05A 5HGMA 3G4SP 3CD6P 4GR2A 3H4EA 1KD1Q 1VQ7P 3DPHA 1PEQA 3CPWO 4U0EA 3G0VA 4COPA 1E6JP 3CC4P 3G6EP 3NTEA 3CCLP 2DGYA 2JYGA 5HGLA 1VQNP 2EIAA 1M74A 2PEOA 1VQ8P 3DS4A 1M90Q 3MGEA 2Z45A 1JJ2O 4COCA 2EG5A 3DS3A 2PEKA 3CCMP 5JPAA 2BHVA 1A43A 1YITP 1Q81Q 2L6EA 1M6EX 3CC7P 2QEXP 1VQMP 3CCVP 1VQKP 5BS1A 2QA4P 3CCJP 1KQSO 2Z44A 4U0DA 3G21A 3G29A 5HGNA 2EFJA 1YJ9P 5DCKA 1QVFO 3CCQP 3OW2O 2PEMA 1K9MQ 4U0BA 1Q86Q 4U0AA 2XXMA 3CCUP 1VQ5P 3WBHA 2P9XA 3CCRP 1RNIA 2JO0A 4XROA 2PEQA 1NJIQ 3CCEP 1VQ6P 3VRLC 1YJNP 1N8RQ 3G1GA 2ONTA 4U0FA 3CMAP 3G28A 4U0CA 1VQ9P 2LF4A 4PH1A 3HYBA 5I4TG 1YHQP 5HGOA 1D1DA 3Q20A 3DS1A 4XFYA 1PEUA 2JYLA 4XFZA 3H0DA 5F2OA 2E1MA 2OARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 P;  3CCJ P;  2OTL P;  1KQS O;  3CC4 P;  3G6E P;  3CXC O;  1K8A Q;  3CCL P;  3CC2 P;  1YJ9 P;  1VQN P;  3CME P;  1VQ8 P;  1YIJ P;  3CCQ P;  3OW2 O;  1K9M Q;  1M90 Q;  1VQO P;  1YJW P;  1KC8 Q;  1QVF O;  1W2B O;  1Q86 Q;  1JJ2 O;  3CCU P;  1VQ5 P;  1K73 Q;  1VQP P;  3CCR P;  1S72 P;  1YI2 P;  1NJI Q;  3CCE P;  1VQ6 P;  1Q82 Q;  1QVG O;  3CCM P;  1YJN P;  1N8R Q;  1M1K Q;  3G71 P;  3CMA P;  1VQL P;  3I55 P;  1VQ4 P;  1YIT P;  3G4S P;  1VQ9 P;  3CD6 P;  1YHQ P;  1Q81 Q;  1KD1 Q;  1VQ7 P;  3CC7 P;  2OTJ P;  3CCS P;  2QEX P;  1VQM P;  1Q7Y Q;  3CPW O;  3CCV P;  1VQK P;  2QA4 P; 
#chains in the Genus database with same CATH topology
 2MVV A;  1H0T A;  4QMA A;  2HFE D;  2N98 A;  1EQ7 A;  1FZE A;  1PGJ A;  1W2B O;  2B88 A;  5AVS B;  2ZYA A;  1QL2 A;  2OYO A;  1IO4 A;  1NTZ E;  1MUU A;  4KJM A;  2XT1 A;  5BS2 A;  2BQ1 E;  3CX5 E;  2L91 A;  3M1M A;  3AED C;  4H2X C;  3H25 A;  1JTH B;  2RH0 A;  1RE3 C;  2OYH B;  2LKM A;  1P84 H;  1R5L A;  5AW2 B;  1G1I A;  2ZJS E;  1S1C X;  1CSB A;  3H1H D;  5HGM A;  4Z1M H;  2BCC J;  2IFN A;  2FXO A;  3G0V A;  5CCH D;  3NTE A;  1OVV A;  1VQN P;  1GL2 A;  1IFD A;  2PEO A;  2PRR A;  2QJP C;  3ABV C;  2P10 A;  1L4A A;  1RF1 B;  2D2C B;  3GF3 A;  3D6Y A;  1OZH A;  1BGY D;  4ZNC A;  3GG2 A;  3KDP B;  3A0B E;  4EI2 A;  2JWD A;  1IFP A;  3C9I A;  3WUT A;  3B4S A;  2C0W A;  1RHZ B;  1KV4 A;  3H1J G;  5EJD A;  1KN7 A;  1SQP D;  3L73 E;  1FS0 E;  3EJB A;  2GA1 A;  1AV1 A;  4U0B A;  3S9O A;  3VTP C;  1VQ5 P;  4KT0 J;  1YQ4 C;  1JCD A;  1NU1 K;  1NTM J;  1U7J A;  1JY2 O;  3L70 E;  3VYI A;  1N73 A;  1ZN5 A;  3VMX A;  2E1M A;  3I56 P;  5GTH E;  2QRX A;  4RES B;  4PD4 E;  1NWQ A;  3VMZ A;  2R5D A;  2M3E A;  3P8M C;  1RH5 B;  2GUS A;  3L72 D;  2EHS A;  1LNQ A;  1RO0 A;  4W7Y A;  3NY7 B;  2LOL A;  1Q7Y Q;  5BVZ A;  4D6T J;  2HOD A;  1SQX K;  1W5C E;  5C39 A;  3A5T A;  3L73 G;  5KAF E;  1BE3 G;  1NQ4 A;  4H2W C;  1K73 Q;  3LMO A;  1XTC C;  2PGD A;  3H1I D;  1L0I A;  2XKM A;  3G3Z A;  3SSU A;  4EIJ A;  3H1I G;  3CL3 D;  1KD1 Q;  2CGQ A;  2YNY A;  1PEQ A;  1OVR A;  4COP A;  3B5N B;  1L2P A;  2A45 H;  3MUD C;  1SQV E;  2KB7 P;  2OQQ A;  4HH2 A;  1OX3 A;  5AVT B;  2AF8 A;  4UB8 H;  4U3F D;  1AQT A;  1QEX A;  3OJA B;  2X2B A;  1PP9 J;  1G1J A;  5DJT B;  1KYO H;  2UWJ E;  5APU A;  2FKW B;  2E74 D;  2WQY C;  2KZI A;  1HUC A;  2D2C C;  2CG5 B;  4C7N B;  2P9X A;  2KOR A;  1Y47 A;  2K5X A;  1OIP A;  4TLF A;  1N8R Q;  2XZR A;  2JDI H;  4U0F A;  2K9J A;  3V6I A;  3HYB A;  1NTZ G;  2JYL A;  2WIT A;  2E42 A;  1PP9 G;  2KZJ A;  5AW7 B;  2L4B A;  1EC5 A;  1GL2 C;  2XV6 A;  1FJK A;  3EFF K;  4LLH A;  2QVA A;  2N5I A;  1Y9B A;  4NEO A;  1QVG O;  1GMJ A;  4I6M C;  1FAV A;  4HB1 A;  1KYO D;  4U3F E;  3HZQ A;  2FAC A;  1K05 A;  1T2K D;  1ZMB A;  2LL8 A;  3IF4 A;  2FQ1 A;  3MZW B;  1ZRT E;  2ZVN B;  3DTJ A;  2BCC E;  2YKQ A;  4WY4 B;  2WSS H;  2XU6 A;  3RK3 D;  3AE7 C;  3RK3 C;  1URQ B;  3CE7 A;  4NPE A;  5APV A;  1KTM A;  3B71 A;  3CX5 I;  3G26 A;  2OYH A;  4GOE A;  3KPE A;  3LRY A;  1FU1 A;  3D71 A;  1VQ7 P;  1EDI A;  2G8Y A;  5HVC A;  1RE4 A;  4H44 D;  2N9Y B;  5APT A;  1BSN A;  2JP3 A;  3CXH D;  1AF8 A;  1PL5 A;  2MF4 A;  3K5B A;  4YPC A;  1OW8 A;  3VP9 A;  2C9N Y;  3IAO A;  2KYV A;  2W6J H;  2KLV A;  1GK4 A;  5B66 E;  2PEK A;  5KLV D;  2K3R A;  5KAF H;  1BCC D;  1JNM A;  3CC7 P;  1VQM P;  2BCC D;  1EZV D;  3H1H J;  1SFC B;  4N6J A;  3WUV A;  1DNY A;  1GXH A;  2O01 H;  1H8A A;  3MD0 A;  3CCR P;  1AVO A;  1X9V A;  3L74 J;  2ZYD A;  2JR8 A;  5I4T G;  3AE1 C;  4JYB A;  4IL6 H;  1Z56 A;  5KLV J;  1NTZ D;  3KZI H;  3TGU J;  4WYM A;  1ACP A;  4UB6 H;  4UHP B;  4Y99 C;  1NTM D;  1YBK A;  1S72 P;  1L4A B;  2W8Z A;  1IUQ A;  2L22 A;  2NPS A;  3PJS K;  3NTN A;  2OTJ P;  3D6Z A;  4PJ0 H;  5AVQ B;  1NTM K;  1NTK J;  3CC2 P;  3CME P;  1SFC D;  1X79 B;  5APX A;  1KZU B;  4N3Y B;  3Q1M A;  1K04 A;  1LTT C;  5CCG A;  2Z5H A;  3M9Q A;  2RN0 A;  2E74 C;  2Q3E A;  5CBO A;  5CHX A;  2GM4 A;  3RL0 B;  2E43 A;  1LTG C;  1PZQ A;  2JB0 A;  1M1J A;  3P32 A;  2JBG A;  1SQX J;  1FZC A;  3IR9 A;  2GZG A;  3AE3 C;  2KS1 B;  4EYY Q;  2OTK E;  5AVV B;  5CMZ A;  2AXT E;  2E76 B;  3H6P A;  4WB4 A;  2KW2 A;  3UIA A;  1KYO E;  3NFQ A;  3CCM P;  3RL0 g;  5JPA A;  3GLM A;  3SWF A;  2Y0E A;  2QEX P;  3CCV P;  2HLO A;  4BPH A;  1YJ9 P;  3H1K E;  2KG8 A;  1URQ A;  2IBZ G;  1FDM A;  1DIP A;  2K0Y A;  2LIW A;  2HYN A;  2HPC B;  1FOS F;  3HUS C;  3MP7 B;  2E75 D;  3BAS A;  3RBX A;  2OAR A;  3KYQ A;  1K30 A;  5KJ7 C;  1BAJ A;  1EZV G;  3L74 E;  1SP4 A;  1VQO P;  5CCG C;  2R3C A;  2WSC H;  2Z5I A;  1P84 D;  2P1J A;  3GZM A;  4QKO A;  1KMI Z;  3M06 A;  3AEF C;  2M8N A;  2AFD A;  1GL2 B;  3QWO C;  1M8O B;  5AVY B;  1EOQ A;  4WVZ A;  3CWB E;  3RL0 D;  2BAS A;  2LTE A;  1HGV A;  2FFD B;  4PD4 H;  1NGM B;  4GR6 A;  2NRG A;  1DD4 A;  1OR5 A;  2IBZ I;  2MD9 A;  1SQB G;  2IFM A;  1QGK B;  1DH3 A;  4IZ6 A;  2O01 N;  3VMY A;  1VQL P;  3A7O A;  1ZME C;  3RK2 D;  3LW5 H;  1KFM A;  1SQX G;  3BCC J;  3USS A;  1AQ5 A;  1PP9 D;  1SQQ J;  2MVU A;  2EIA A;  1BGY J;  4RO0 A;  3TNU A;  1L4A D;  3L72 J;  1L4A C;  4DZO A;  3H1L D;  5AVU B;  2CPB A;  4ZMD A;  2I8D A;  1FC2 C;  1FE6 A;  4GIF A;  3AE9 C;  4L73 A;  4RKU J;  2FQ2 A;  1H0T B;  1HWT C;  3PHL A;  1JM0 A;  5CJ0 A;  3WU2 H;  4L75 A;  2Y9Y A;  5KLI B;  2Z44 A;  5HGN A;  1KB9 D;  1IMP A;  4DT0 A;  5TJH A;  1KIL A;  3FGA D;  1VPC A;  2W83 C;  1PPJ E;  3Q3D A;  2KGA A;  1VQ6 P;  3P8C E;  1S4X A;  3Q2Y A;  2WZ7 A;  2AEF A;  2A45 I;  3Q20 A;  3DS1 A;  5KP8 B;  1PEU A;  2J58 A;  2AEJ A;  1JY3 P;  1M7L A;  2KS1 A;  2Q9I A;  1FZC B;  1WRG A;  3L35 A;  1VF5 B;  1KOR A;  3RGU A;  1YJW P;  2Q5U A;  3B8E B;  1JY2 N;  1PP9 E;  2N6Y A;  2FYU D;  2IBZ D;  1SQB K;  4AYC A;  1NU1 J;  2OGU A;  2VLP A;  1ZOY C;  3LID A;  2JGP A;  1LWU C;  2QJY B;  1H89 A;  1S5L E;  1SQP K;  3W67 A;  5APS A;  3E2D A;  4PV1 C;  3TGU D;  2GDX A;  1JO5 A;  3NXS A;  2KGC A;  1Q90 D;  2N1T A;  2AFE A;  3O6Q B;  1OWA A;  2PNG A;  1PGO A;  4BWN A;  1EIA A;  2KOP A;  5F2N A;  2VSQ A;  3G4S P;  1N7S C;  2A06 D;  3L72 E;  2LKI A;  3WMM 0;  2AEM A;  2N5H A;  2FFD C;  4W80 A;  2E75 C;  3P7K A;  2FYU J;  2IYP A;  1IC2 A;  4C7N A;  3CCL P;  2DGY A;  1RF1 C;  1PGQ A;  3DS4 A;  3MUD A;  1OMI A;  2PAJ A;  3EJD A;  4MRT C;  1GD2 E;  3DS3 A;  1E5W A;  1T8K A;  2FXP A;  2V7Q H;  4I7Z B;  2NPS D;  2GUV A;  2YMY A;  2JKV A;  3AE8 C;  1NU1 E;  4H0L D;  1KQL A;  4R4M A;  2M8R A;  2GYK A;  3CCQ P;  2H7H A;  1L0L K;  2MR8 A;  5CZD B;  5K5G B;  1VL2 A;  2K93 A;  1NKZ B;  3L71 E;  2ONT A;  2KSJ A;  2P58 A;  1N7L A;  1VQ9 P;  2H89 C;  4WY4 D;  5DJU B;  3AEE C;  2WVR A;  3KHU A;  3M0D C;  1FDI A;  4XFZ A;  1S9K E;  1LWU B;  3BRV B;  2KGD A;  2QE7 H;  2OYI A;  4WY4 A;  3DS5 A;  3VOP A;  2KXP B;  1OW7 A;  2M5A A;  2Q1K A;  2KOD A;  1IFI A;  3L70 G;  2LIU A;  2KG9 A;  4PV1 D;  2PEJ A;  1ZNV A;  3A0H E;  4ASV A;  1NO4 A;  2N1T B;  4K35 A;  1E0H A;  2IBZ E;  3FXD A;  3SFE C;  2OTL P;  1U7M A;  1HBW A;  5H2F H;  2N6Z A;  1X8Y A;  1KC8 Q;  5GTH H;  1FZB A;  1HF9 A;  2WWW A;  1BGY E;  1NTM E;  4WBA A;  4M3L A;  1N73 C;  3P05 A;  4GR2 A;  5TIS E;  1DEE G;  3CPW O;  2WT7 A;  2FYU E;  2WSC J;  2WPS A;  2KI7 B;  4ZKP A;  5APY A;  1VQ8 P;  2MY5 A;  3MGE A;  4JYC A;  3V2P A;  3WU2 E;  1R8E A;  2ZYG A;  4COC A;  2YKO A;  2YXQ B;  4DJG A;  2A45 G;  3MIW A;  1PGP A;  2E76 C;  3EQ2 A;  1YIT P;  2OYI B;  1MFT A;  1L0N J;  2L6E A;  1M6E X;  1L0L J;  2R44 A;  3PTZ A;  1SQQ D;  5B5E E;  2M5R A;  1FDO A;  3PP5 A;  5AW5 B;  3P8C D;  2QM8 A;  2JQ4 A;  3N4X A;  2AXT H;  4XRO A;  3HRN A;  1N7S A;  5APW A;  4H13 B;  3H32 B;  3KZI E;  2FVE A;  1J1E B;  2N50 A;  3U59 A;  2IDB A;  2QJK B;  3Q5S A;  2H43 A;  5KLV E;  1AUM A;  2FXM A;  3AEG C;  3H47 A;  5AW4 B;  2QJP B;  1XTG B;  1T3U A;  3CWB J;  1JMM A;  1G2C A;  3M9B A;  1KIL D;  1FJP A;  2B87 B;  5BU8 B;  4YXD C;  1M1J B;  2WPR A;  4DOJ A;  1M57 D;  2K9J B;  4F37 A;  4WWI A;  2PEN A;  1NTK E;  1PEO A;  1DEB A;  3GMA A;  4YTP C;  1FZA A;  3HD7 B;  1SQP J;  1HVV A;  2ZXE B;  1U57 A;  3HD7 C;  2E5T A;  2M3B A;  3AEB C;  2LXB A;  3RK2 C;  1JUN A;  2I1J A;  4PV1 B;  1M1J C;  3KXD A;  2K0X A;  2P2U A;  2BEQ D;  1A02 F;  3B5N C;  2Z45 A;  2SPZ A;  2GZI A;  3H1J D;  1JOC A;  1JMB A;  3HTK A;  1SQV K;  1BE3 D;  1UJZ A;  1SS1 A;  3T97 A;  2KGE A;  5BS1 A;  2QA4 P;  2LR2 A;  1AJY A;  2POH A;  3G21 A;  2O01 J;  2BCC G;  4PXH B;  5KKZ B;  3L74 D;  4HKZ H;  1HY8 A;  2JO0 A;  2J59 M;  2FYZ A;  3VRL C;  3AE2 C;  2O1J A;  2KWL A;  3S4R A;  1NOH A;  1WT6 A;  1LP1 B;  2R32 A;  1YHQ P;  2ZVO B;  1JTH A;  3EJE A;  3RG2 A;  3H0D A;  1KLP A;  1OW6 A;  5AW8 B;  3CXC O;  1KB9 I;  4XFX A;  1EZV I;  3SFD C;  1YI2 P;  4GT1 A;  1BCC G;  3DS0 A;  1NYH A;  1ZRT D;  3WUU A;  3H1K G;  2M5A B;  3A0B H;  1S5L X;  5KLV K;  2PEI A;  2KOO A;  1SQQ K;  3EFG A;  3L36 A;  1IFJ A;  2MR7 A;  4Y28 J;  1YTZ I;  1M1K Q;  1HTL C;  1LTJ C;  3CD6 P;  3ZDM A;  4LGD E;  2KSE A;  1KFN A;  2CK3 H;  1SFC C;  1NKN A;  3H1J E;  5KJ7 D;  2OYH C;  2QJY C;  3GF7 A;  2QM7 A;  1MV8 A;  4OGQ D;  4JPZ B;  1NTK D;  4MN4 C;  1BE3 E;  3G29 A;  1KIL C;  2EFJ A;  2KIK A;  3TSI A;  2K94 A;  2YO2 A;  5CCH A;  1EMV A;  4U0A A;  3TYY A;  3CCU P;  1BXI A;  2K37 A;  2Y0C A;  2KOS A;  2LML A;  5HGO A;  2JEE A;  3OA7 A;  1L0N D;  2Y0D A;  4C7R A;  2CWO A;  1PFI A;  1USE A;  5H2F E;  5AW0 B;  1BCC J;  3L71 G;  3MHV A;  2ROQ A;  1LTJ B;  2MKV A;  3B5N D;  4H13 C;  4I7Z C;  3I55 P;  1GTW A;  1LTB C;  3FX0 A;  2M8P A;  3M0D A;  2B87 A;  2JO1 A;  3N7N A;  3U43 A;  2V7Q J;  3PH0 A;  3HD7 D;  3IN6 A;  1T3J A;  3H1K J;  3VN0 A;  1LGH B;  2A06 G;  2Z46 A;  1VQP P;  3U1C A;  2YO3 A;  1NTZ K;  4PD4 D;  1AVY A;  3PLN A;  1LP1 A;  3JSV C;  3H4E A;  2CQ8 A;  1L0L E;  1L0H A;  1S3J A;  3CC4 P;  1OVU A;  3HE5 A;  4L76 A;  1L0N G;  4HKG A;  3AE6 C;  3L37 A;  2GDW A;  3RK3 E;  2PFX A;  1QLE D;  2K9Y A;  2PP6 A;  4LC1 A;  2NPS C;  1L0L G;  1QX8 A;  3V2R A;  4U0D A;  1SQV J;  2P7J A;  3CX5 H;  4TT3 H;  1ZXG A;  3B5N A;  1K9M Q;  3ITK A;  3V2Q A;  4B86 A;  3A2A A;  3WBH A;  1UNK A;  1RNI A;  3CCE P;  1ZV8 A;  2WMM A;  3H1L G;  4NPF X;  2E5Y A;  1T2K C;  4ZKU A;  2HPC A;  3G9R A;  2P67 A;  2N1T C;  3EWK A;  2BUO A;  1X3O A;  4GKG A;  1ZP0 C;  1NTK G;  1RE3 A;  2D2C D;  3TNU B;  4PH0 A;  1R5S A;  1CW5 A;  3H1H G;  1VF5 C;  2M8L A;  1A02 J;  1J1D B;  1PPJ G;  3M9H A;  1SQB D;  1HQB A;  5KP6 B;  1WMK A;  3L70 D;  3AEC C;  4XFJ A;  2XZ1 C;  4GOF A;  4IOI H;  2MJZ A;  3L75 E;  4U7J A;  4K3A A;  4A7P A;  2W6A A;  4OWF A;  5KLV G;  3L73 J;  1W2E A;  2BEZ F;  3TF5 A;  1SQB J;  1L0N E;  4BRY A;  2G3A A;  4N78 D;  1CI6 A;  3E1I A;  3AE5 C;  3CWB D;  1Z6M A;  2I1K A;  3H1I E;  1M74 A;  1M90 Q;  1HJB A;  1ZR4 A;  2DNW A;  1VHN A;  1LTJ A;  1NTZ J;  2L0Q A;  3BCC E;  1LWU A;  1J1E C;  2YXR B;  2VLQ A;  1SQB E;  2R5B A;  2W6B A;  4PJ0 E;  2W90 A;  4H13 D;  1HGZ A;  5DCK A;  3GJN A;  1KB9 H;  3L71 J;  3O6Q A;  2XND H;  3G1G A;  3G28 A;  4U0C A;  1GXG A;  2XV5 A;  4PH1 A;  3L74 G;  3CXH I;  3R2P A;  2VRS A;  1VF5 D;  5F2K A;  1YTZ T;  1YIJ P;  1KQF B;  1NAY A;  2O1K A;  3B5I A;  1SFC A;  1S2E A;  2ZT9 B;  1TU3 F;  4BPF A;  4L74 A;  4XRQ A;  4DG9 A;  1BSH A;  4YXW H;  2ERH A;  2L9F A;  4OGQ C;  1QRJ A;  5KLI C;  4R0M A;  2QG4 A;  4H2Y C;  2PY8 A;  1K8A Q;  1BDD A;  2WTY A;  1RF1 A;  3U1A A;  4OVN F;  2QNW A;  3MGN A;  1CI6 B;  4JQ0 D;  1SVF A;  4RJT A;  1GPJ A;  4HJG H;  5EFW B;  2V4H A;  2GDY A;  4WY4 C;  1HH0 A;  2KR5 A;  5APQ A;  2FAD A;  2FYN B;  2CPS A;  4HYT B;  4EDF A;  2JYG A;  2IZ0 A;  1KQG B;  4XA4 A;  3TDK A;  2XZ0 D;  2K88 A;  2NZ2 A;  1A43 A;  1NTM G;  1BGY G;  2W27 A;  4PD4 I;  1S9K D;  5AW9 B;  3VP8 A;  5KAI H;  3CCJ P;  1IK9 A;  3LW5 J;  3GHG A;  4BXL A;  4N78 E;  1JY3 O;  2FVF A;  1GL2 D;  1BCC E;  2FVA A;  2PEQ A;  5HV8 A;  1IK7 A;  3L72 G;  1JCC A;  3W68 A;  4O9B A;  2QJK C;  1LT9 C;  4H0L B;  1D7M A;  1UII A;  4IL6 E;  4BRY B;  1FR2 A;  3Q5R A;  1D1D A;  3L75 G;  4XFY A;  2JJL A;  3L70 J;  1IFN A;  5KJ7 A;  3F89 A;  2FFD A;  2YMK A;  1PEM A;  4CPG A;  2KG6 A;  3DS2 A;  4CA3 A;  1NTK K;  2KNC B;  3A3Y B;  1JY3 N;  1FZC C;  5E79 E;  1EXJ A;  1RQV A;  2K1A A;  3JCU E;  3V4Q A;  2GZF A;  4BPG A;  1CEI A;  1YYC A;  4GDO A;  5KTB A;  1JY2 P;  3QH9 A;  2WPT A;  4IPY A;  3HE4 B;  1AA0 A;  3JC2 2;  3H1I J;  2B9B A;  1ZLL A;  1NAF A;  1MFZ A;  4AUW A;  1KIL B;  2E76 D;  1DX7 A;  1YQ3 C;  1URQ C;  2K2Q A;  3GW6 A;  4U3F J;  3JCU H;  1G2C B;  3HE5 B;  1PPJ D;  2ZT9 C;  1FOS E;  4IFM A;  3CLQ A;  1FZF A;  1T6A A;  3OW2 O;  1MZ8 A;  3HD7 A;  1X22 A;  4XE5 B;  3SWK A;  5CCH C;  2KOQ A;  2GZJ A;  1URQ D;  1JB0 J;  4U3F G;  2WPQ A;  2XNX A;  4EOT A;  4H44 C;  5AW6 B;  4DCK A;  2J5U A;  5F2O A;  2A06 E;  3AEA C;  2Z4E A;  1NJI Q;  3T97 B;  3AE4 C;  3L4F A;  2JAZ A;  3L75 D;  1L0L D;  2GZE A;  2WSF J;  2WSE J;  1GK6 A;  3H1L E;  5E79 H;  3RG6 C;  2JU2 A;  4M0I A;  1KB9 E;  7CEI A;  2K0D X;  2C9L Y;  1M6N A;  1VDF A;  4IFD K;  1IZN B;  2ITA A;  1SQP E;  3L73 D;  1S5L H;  3V4W A;  5M1B A;  1GU5 A;  1SQV D;  4GOD A;  3SWY A;  2KLU A;  1EZV E;  1NH4 A;  3GHG B;  2FAE A;  2YIU B;  3I5C A;  4C46 A;  2Y9Z A;  2LPK A;  4OGQ B;  3DPH A;  3E1R A;  4U0E A;  2JU1 A;  1E6J P;  3B4Q A;  2KUB A;  1JEK A;  3BAT A;  1FZG A;  3BVH A;  3BCC D;  3V2N A;  1SQV G;  2O3J A;  5GTI H;  1QL1 A;  1N86 A;  1SLQ A;  1IMQ A;  3D70 A;  1SQQ G;  2FBW C;  1SQX E;  1E79 H;  1ZW0 A;  3LIE A;  5EW5 E;  1GU4 A;  1VKU A;  3L75 J;  3FXE A;  1VQK P;  4UB8 E;  3CI9 A;  3R4Y A;  1BDC A;  1PV3 A;  3CWB G;  1QVF O;  2PEM A;  3HUS B;  2JWA A;  1Q86 Q;  3OAK A;  5AVZ B;  1KIL E;  1GDT A;  4I2L C;  2NPS B;  1USD A;  2FHS C;  3F5H A;  2LF4 A;  3Q5P A;  5AVW B;  5TIS H;  3GHG C;  1NVO A;  1BE3 J;  4KHX A;  5BU5 A;  5AVR B;  1PIX A;  1SQP G;  2YIU C;  3PRJ A;  1RF0 A;  3H1L J;  1SQX D;  1A8O A;  1LT1 A;  1UIX A;  3RL0 C;  5AVX B;  3II6 A;  1GZL A;  4H44 B;  1LT9 A;  1NU1 D;  3O8Z A;  3VMA A;  1LTS C;  3G71 P;  1CZQ A;  3FWN A;  3V5B A;  3G1I A;  4R4L A;  1NU1 G;  2Q3I A;  2WT7 B;  3CCS P;  5CBN A;  2KP8 A;  2VLN A;  4OH8 B;  2AXC A;  3IFM A;  1RO2 A;  2WSE H;  2E75 B;  1KYO I;  2E74 B;  2L5G B;  3FWL A;  3CXH H;  1EDJ A;  2FY8 A;  2XDJ A;  3H1K D;  3BRT B;  2RKL A;  2LXC B;  2IZ1 A;  1SQQ E;  1LJ2 A;  3M0A A;  5KKZ C;  2IX7 C;  1IFM A;  1OFC X;  5GTI E;  2ZXX A;  3HE4 A;  1N7S D;  1RE4 C;  1EXI A;  3C8V A;  2IPP A;  2KOG A;  4Y99 B;  3C1L A;  4IL6 X;  1JJ2 O;  3H32 A;  2R3S A;  1DD3 A;  1N7S B;  2EG5 A;  4JF7 A;  3RK2 B;  4W7Z A;  1Q2N A;  2HG5 D;  3E7K A;  1OXZ A;  1X0T A;  1Q81 Q;  2EHT A;  5CJ4 A;  5B66 H;  4AQR D;  1EDK A;  4D6T E;  1KQS O;  2ZFC A;  1J2J B;  2Q6Q A;  2QSI A;  1H88 A;  3TK1 A;  2WPV B;  1FBM A;  3MTU E;  1N73 B;  3NMD A;  5KP7 B;  1YJN P;  3S1K A;  3CMA P;  2K92 A;  1IJD B;  5L8R J;  2H88 C;  2ZAE B;  2RMZ A;  2Q7C A;  4QNB A;  1DV5 A;  2IYO A;  1F80 D;  4PWV B;  5AW3 B;  4D6T D;  1T8Z A;  3KQG A;  1M56 D;  3TGU G;  1P84 I;  3CX5 D;  2VLO A;  5KAI E;  2YKP A;  2HOD B;  2AVA A;  1VQ4 P;  1AYI A;  2QIW A;  1EDL A;  5B5E H;  2CNR A;  2KNC A;  1Y8A A;  2NO8 A;  1LTA C;  1MZ9 A;  1LTI C;  1NHL A;  4ASW A;  2DW3 A;  3RK3 B;  1Q82 Q;  5AW1 B;  2FQ0 A;  3BCC G;  2WSF H;  1MKM A;  4D6T G;  2OYI C;  3GZL A;  2ZT9 D;  2HR3 A;  3G6E P;  4NPD A;  5HGL A;  3GKL C;  1LT9 B;  4H0L C;  3CXH E;  1GW3 A;  2KK7 A;  1N2D C;  2BHV A;  1P84 E;  2M0B A;  2C0X A;  2FYU K;  2B89 A;  3A0H H;  3M91 A;  4I1L A;  4UB6 E;  2FYN C;  5CCG D;  4IFF A;  1RF0 C;  2FYU G;  2XXM A;  4JBZ A;  2N1T D;  2H8P D;  1AFO A;  2N9B A;  3TGU E;  3L71 D;  3RBZ A;  1RQU A;  3HUS A;  1J1D C;  3HTK B;  1ZR2 A;  1HJ0 A;  1L0N K;  1GW4 A;  1RY3 A;  3H1J J;  3H1H E; 
#chains in the Genus database with same CATH homology
 1AUM A;  2CWO A;  4QNB A;  3I56 P;  3H47 A;  1K30 A;  3CXC O;  2BUO A;  2XV6 A;  3DS5 A;  1BAJ A;  5F2K A;  4WYM A;  1A8O A;  1YIJ P;  1VQO P;  1YJW P;  4PH0 A;  1PEM A;  1W2B O;  3B5I A;  4XFX A;  2KOD A;  2M8L A;  3RG6 C;  1RO0 A;  1S72 P;  1YI2 P;  3DS2 A;  4M0I A;  1QVG O;  3DS0 A;  1IUQ A;  3G71 P;  4XRQ A;  3I55 P;  1VQ4 P;  3G1I A;  2XT1 A;  5BS2 A;  2BQ1 E;  1M6N A;  2PEJ A;  2M8N A;  2OTJ P;  1QRJ A;  3HZQ A;  3CCS P;  1ZMB A;  3M1M A;  1Q7Y Q;  2M8P A;  3E2D A;  1EOQ A;  2OTL P;  2PEN A;  3DTJ A;  1RO2 A;  2PEI A;  2PY8 A;  1K8A Q;  1PEO A;  3CC2 P;  3CME P;  4GR6 A;  1KC8 Q;  4IPY A;  1EIA A;  2Z46 A;  1VQP P;  1K73 Q;  5F2N A;  3G26 A;  1Q82 Q;  1M1K Q;  3LRY A;  1VQL P;  3P05 A;  5HGM A;  3G4S P;  3CD6 P;  4GR2 A;  3H4E A;  1KD1 Q;  1VQ7 P;  3DPH A;  1PEQ A;  3CPW O;  4U0E A;  3G0V A;  4COP A;  1E6J P;  3CC4 P;  3G6E P;  3NTE A;  3CCL P;  2DGY A;  2JYG A;  5HGL A;  1VQN P;  2EIA A;  1M74 A;  2PEO A;  1VQ8 P;  3DS4 A;  1M90 Q;  3MGE A;  2Z45 A;  1JJ2 O;  4COC A;  2EG5 A;  3DS3 A;  2PEK A;  3CCM P;  5JPA A;  2BHV A;  1A43 A;  1YIT P;  1Q81 Q;  2L6E A;  1M6E X;  3CC7 P;  2QEX P;  1VQM P;  3CCV P;  1VQK P;  5BS1 A;  2QA4 P;  3CCJ P;  1KQS O;  2Z44 A;  4U0D A;  3G21 A;  3G29 A;  5HGN A;  2EFJ A;  1YJ9 P;  5DCK A;  1QVF O;  3CCQ P;  3OW2 O;  2PEM A;  1K9M Q;  4U0B A;  1Q86 Q;  4U0A A;  2XXM A;  3CCU P;  1VQ5 P;  3WBH A;  2P9X A;  3CCR P;  1RNI A;  2JO0 A;  4XRO A;  2PEQ A;  1NJI Q;  3CCE P;  1VQ6 P;  3VRL C;  1YJN P;  1N8R Q;  3G1G A;  2ONT A;  4U0F A;  3CMA P;  3G28 A;  4U0C A;  1VQ9 P;  2LF4 A;  4PH1 A;  3HYB A;  5I4T G;  1YHQ P;  5HGO A;  1D1D A;  3Q20 A;  3DS1 A;  4XFY A;  1PEU A;  2JYL A;  4XFZ A;  3H0D A;  5F2O A;  2E1M A;  2OAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...