3CD6P

Co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 44
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cd6P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cd6P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cd6P02
2OTJP 3G4SP 1YI2P 1YIJP 1VQMP 3CCJP 1VQOP 3CMEP 1S72P 1KQSO 1VQNP 3CCUP 1VQKP 1VQPP 1K73Q 1YHQP 1KC8Q 1Q82Q 1M1KQ 1KD1Q 3CXCO 3CMAP 1YJ9P 1W2BO 1NJIQ 1VQLP 1VQ9P 3CCEP 1Q86Q 1QVGO 3OW2O 1QVFO 1VQ7P 3CCLP 3CCRP 1Q81Q 3CCSP 1JJ2O 1VQ5P 1VQ8P 1YJWP 1K8AQ 3CD6P 3I55P 3CCMP 2QA4P 3CC4P 1N8RQ 3CPWO 1VQ6P 2OTLP 1K9MQ 3CCVP 1YITP 3G71P 3CCQP 3CC7P 1Q7YQ 3G6EP 1M90Q 1VQ4P 2QEXP 3CC2P 1YJNP 3I56P
chains in the Genus database with same CATH superfamily
1MZ9A 4OGQC 2KOPA 3EJDA 2YNYA 4L74A 5HGLA 3L73D 2YKPA 3P8CE 2LOLA 1PGQA 3O6QA 3L71E 1T3UA 5F2OA 3RK3E 1K8AQ 1LT1A 1PEOA 2JWDA 2HPCA 1JCCA 3H1IJ 1T8KA 2VLPA 2VSQA 3HUSB 3TNUB 5HGOA 1VF5C 2R44A 4XRQA 1SQPK 3KQGA 4A7PA 1GXHA 2GZFA 2WSFH 5B5EH 2FVAA 2B9BA 3H47A 2EFJA 2LPKA 1FZFA 2YIUB 1NU1K 1OWAA 5AVWB 2K92A 4U0CA 2YO2A 3P05A 2IFNA 5CBNA 4WBAA 3GZLA 4U0DA 2MR7A 3CL3D 1A02J 2N98A 3CWBJ 5KTBA 1QRJA 5H2FH 5K5GB 3H1LJ 2H89C 3HE5B 1SQXJ 2KK7A 1KB9I 1XTGB 2D2CB 2UWJE 5APUA 3P32A 1VQ4P 2M3EA 4PXHB 3CC2P 1URQC 2K9JB 2M8PA 3B8EB 5TISH 2KSEA 1SFCC 4GOFA 2C9LY 2WSSH 2LTEA 1AJYA 1E6JP 5AVQB 3F5HA 1KYOI 1KQSO 2PP6A 3RK3B 2KGDA 1OVUA 1PP9D 1NJIQ 1GXGA 3L70G 3AE8C 2KOOA 1SQBJ 4RO0A 4U3FD 3I55P 3C9IA 2YXQB 1R5SA 3L4FA 4HKZH 3H1JD 2RKLA 2A06E 4D6TJ 2MVUA 2KNCB 1T2KC 1S3JA 2MF4A 2R5DA 2GUSA 2ZYAA 3EFGA 1CSBA 2ZYDA 2J59M 2E74D 1BE3D 2W90A 2GDXA 1VQOP 5APTA 2CWOA 5AW8B 3RK2D 4PV1D 1M6EX 1YJ9P 4EIJA 3Q3DA 1KYOE 5BU5A 2NPSD 3Q2YA 3RBXA 3NFQA 4OVNF 2KUBA 1EDKA 5F2KA 1RE4A 2FYUG 3RGUA 2OTLP 3HTKA 3G6EP 1BGYJ 1YI2P 1HH0A 1DX7A 5AW9B 2KLUA 1IFMA 2HPCB 1LT9A 3B5NA 2OGUA 1CW5A 1L0LG 1KQFB 1GPJA 3KHUA 2QVAA 3A0HE 3H1HD 1MV8A 1JCDA 5JPAA 2E42A 1Z56A 2FFDC 3A0HH 4DG9A 1GW4A 3U59A 1S9KE 1GU4A 2ERHA 1JB0J 1J1EC 1WMKA 1KORA 2OTKE 4PJ0H 3H1IG 3H32A 1OVVA 1N7LA 1LTGC 1HWTC 3LIDA 2FHSC 3G1GA 1M90Q 5BS2A 1VL2A 2K0XA 1QX8A 4BPGA 1YIJP 3CX5I 3WU2E 1JY3O 2LXCB 1SQQK 4HKGA 1PGPA 3L72E 4ASWA 1W2BO 1BCCJ 2A45H 3AE2C 3WU2H 2LIUA 3BASA 3N4XA 5B66E 4CPGA 4NPDA 4IOIH 1NTZD 1RQUA 1PIXA 5KLVK 4GOEA 1HBWA 2P2UA 5CCGA 1GMJA 3G0VA 2JU1A 1YYCA 1MUUA 3H1LG 2FYZA 2GA1A 2JDIH 1NTMJ 2YMYA 5KJ7A 2WSCJ 1VDFA 3NMDA 5M1BA 3KYQA 4NPFX 2KP8A 3GG2A 2RN0A 1SQVD 2E74C 4WY4A 2N6ZA 1VQNP 1RF1B 2PEIA 1FBMA 1R8EA 2Z4EA 1ZRTD 2K37A 3CX5E 4PD4E 1HQBA 1PPJG 1JJ2O 1YTZT 3RK2C 4PV1C 3CCMP 3HRNA 2N5HA 1U7MA 2W83C 2FQ0A 4U0FA 3AEFC 1J1DC 4PD4H 1LNQA 4I1LA 3DS2A 4C46A 3RL0D 3AE6C 1GDTA 2QJPC 2EHTA 3MUDA 2IBZE 3BCCE 3OW2O 1FZCC 2BCCG 1G2CA 1L0LE 1DV5A 2Z44A 3AEEC 3VMYA 3R4YA 1H0TB 2N9BA 1NTKK 1GL2A 1QEXA 3A2AA 2E76D 1S5LX 4D6TG 1D7MA 1NOHA 1JNMA 2O01J 1IFNA 1L2PA 3O8ZA 4YXDC 3L35A 1EDJA 2JYGA 1HGVA 3HTKB 1UIXA 2KSJA 2N1TB 1N86A 3H1JG 4WB4A 3G9RA 4YTPC 2AVAA 2JJLA 2JO0A 2J58A 2WITA 1RF0A 3H1IE 4H13B 5KP8B 1OR5A 3A5TA 3W68A 3B5NB 3HE4A 5CBOA 3I56P 1UJZA 1SLQA 5E79E 1HY8A 1T8ZA 1X22A 4TT3H 4ZKPA 2I1KA 2ZXEB 1LP1A 1Y8AA 2E75D 2KS1B 1FS0E 2KI7B 2QSIA 1IUQA 2FYNC 2KZJA 1BE3G 1ZP0C 1L4AC 1RO0A 5AW5B 2V7QJ 3CCQP 4U7JA 1CEIA 1BGYG 4MRTC 1U57A 4RJTA 1M1JC 1QL2A 4EYYQ 1K30A 2KWLA 3QWOC 2QM8A 3CWBE 3EWKA 1GTWA 3H32B 3HUSA 3TNUA 3H1LE 2OYHC 2P67A 2L6EA 1HF9A 1VQ6P 3RL0g 2SPZA 1K9MQ 3CE7A 3MGEA 1OIPA 2K9YA 3CXHD 3IN6A 2C9NY 2KOSA 4ZNCA 2MR8A 3NTNA 2WVRA 1SQPD 3L74D 2QE7H 1KLPA 2XNXA 1SQVK 4UB8E 1PPJE 2GZGA 1GW3A 2CPBA 3ITKA 1AQTA 1HUCA 1X9VA 4TLFA 3C1LA 1GZLA 5AW3B 2IFMA 2CPSA 1IFPA 1NU1D 3HD7D 1BCCG 3RL0C 4H44D 4F37A 3L70J 1SQBE 2BCCE 1YQ4C 1P84E 3CPWO 4WY4B 5KAIE 2M5AA 2PENA 2XZRA 3TGUD 2KOGA 4D6TE 2ZT9D 1HVVA 1P84H 1A8OA 4L75A 2E76C 5I4TG 3Q1MA 5KLIC 4GT1A 1LTJB 1NTMG 1NTZG 2XV6A 2AEJA 3BRVB 3BVHA 3MIWA 1KMIZ 3CC7P 3KZIE 1KILD 4XE5B 1NKNA 2X2BA 1JEKA 3CCJP 1G2CB 4GODA 3L75D 3KZIH 4GR2A 1GL2B 4JBZA 3GZMA 1IMPA 1EMVA 1RY3A 1SVFA 4KJMA 1BSHA 2E75C 1NWQA 1BE3E 3CCVP 3OAKA 1K05A 1Q2NA 2FYUJ 5APSA 2DW3A 3WUUA 1BGYE 3V5BA 3RG2A 3MTUE 3V4QA 1IZNB 1IC2A 5GTHH 1EXIA 2HG5D 2JU2A 4YPCA 3RBZA 4I7ZB 2E43A 4HH2A 4XFJA 1OW8A 3HE4B 3DTJA 1L0LJ 2P58A 1CI6A 2M8NA 1JTHA 3QH9A 2AXTE 5APYA 1N8RQ 1NHLA 1M8OB 3MHVA 1LP1B 4U0EA 1BAJA 2B89A 2L91A 2YMKA 2ONTA 3V2NA 3VP9A 5CJ0A 1N7SA 3RG6C 4W7ZA 1VQPP 1M1KQ 1M6NA 2LMLA 2QJYB 1L0NJ 3TK1A 3S1KA 1X0TA 3B71A 2Q9IA 4XFZA 3G29A 4JYBA 3VMAA 2LXBA 3L73J 5HVCA 1E79H 3H1KD 1D1DA 4XA4A 1BCCE 1YBKA 3HD7C 2QA4P 4IFDK 1FJKA 1NKZB 1U7JA 4H44C 2L4BA 1RE4C 3Q5RA 2ZT9C 3G21A 4IPYA 1FAVA 1EC5A 1EZVG 4N78E 1LT9C 1SQXD 2AXCA 1NTME 1NTZE 4DJGA 2B87A 1AYIA 2K1AA 2PEJA 2NPSB 2Q3EA 2FQ1A 1KILC 1F80D 3PP5A 2KG9A 2JO1A 5KP6B 2CQ8A 1Q86Q 1QVGO 2M5AB 5BU8B 3FWNA 2WT7A 3KXDA 2VLNA 1IK9A 7CEIA 2JP3A 2HODB 2GUVA 2R32A 1FZGA 1SQQD 3PJSK 2V4HA 4BPFA 2KGAA 1NVOA 3FGAD 3D6ZA 1NQ4A 1SQPG 1PEUA 2ZVNB 5KLVD 2LL8A 3GKLC 1JY3N 2BCCJ 1RF1A 5EFWB 2QJKB 5CCHA 2PEQA 3A7OA 1NU1G 1KB9E 2DGYA 1BDCA 1T3JA 4H2YC 1PP9J 1EZVI 3AEBC 1KB9H 4UHPB 1PEQA 2PNGA 1KFNA 2Y9YA 3TGUG 3CC4P 3H1JJ 3BATA 2XKMA 3KPEA 4LLHA 2G8YA 2R5BA 1JY3P 1ZXGA 2OYIC 4DCKA 1LWUC 2WWWA 1H0TA 1CI6B 3AEDC 1JTHB 5AW7B 5AVUB 3S4RA 1AFOA 1Q81Q 3USSA 2EHSA 3CXHI 1N73B 1N7SB 3MZWB 1PL5A 2VLQA 1BE3J 3PHLA 2N1TA 3JSVC 2XXMA 1KYOH 1BDDA 3L75G 3F89A 1YTZI 2D2CD 1LTTC 5TJHA 2V7QH 3LW5J 1NTKD 4H2XC 2YKOA 3N7NA 1HGZA 2FQ2A 5GTIE 1EZVE 3G71P 2R3SA 2KS1A 5GTIH 1R5LA 1SQXK 2LF4A 1KQLA 2OARA 4I6MC 1KC8Q 1S1CX 2N5IA 2JEEA 3P8CD 1L0NG 3TF5A 4W7YA 1KTMA 1QVFO 2K0DX 3H1HJ 4JPZB 3L71D 1VQ5P 3RK3D 3OJAB 1OFCX 1URQA 4C7NA 2I8DA 1RE3C 3AE5C 3CXHE 2POHA 4QMAA 2FACA 4COCA 1RF0C 3L73G 2RH0A 3H25A 2B87B 4MN4C 1L4AD 1ZV8A 2LKIA 3GHGC 3L70E 4AYCA 4I2LC 2K88A 2GDYA 2IYPA 3FX0A 3PH0A 2QEXP 2P7JA 3H1KG 2FXOA 1SQBK 5B66H 2WT7B 2MY5A 2CK3H 2Q6QA 4LGDE 2PAJA 5HGNA 1PGOA 1MFTA 5KKZB 3CCLP 2ROQA 3HUSC 2B88A 1NTZJ 2M5RA 4Y99B 2R3CA 5L8RJ 2QNWA 2WPRA 1JO5A 2K5XA 4QNBA 4BWNA 2YIUC 2JKVA 3P7KA 4ZKUA 2IZ1A 2IZ0A 2M8LA 2K2QA 2IYOA 3BRTB 1ZMBA 1FDMA 3E2DA 3CX5H 1LTJA 2FYUE 1JM0A 4WYMA 1SQVJ 4H0LB 2PY8A 3AECC 3AE9C 3E7KA 1JY2O 1EOQA 1YQ3C 1ZW0A 4OGQB 2D2CC 1SQQG 4OWFA 3WBHA 2GZIA 3VYIA 2OYOA 1ZNVA 3EJEA 2E1MA 2GDWA 2A06D 2FADA 4W80A 3NY7B 3TYYA 1PP9G 1VF5B 4JF7A 2FVFA 2JB0A 4U3FG 1M74A 2I1JA 4XFYA 5BS1A 3DS3A 2FFDA 1L0NE 2PRRA 4CA3A 5DCKA 3EQ2A 1ZN5A 1H8AA 3K5BA 2GM4A 3DS4A 3RK3C 2OTJP 3M91A 1BSNA 1K73Q 3L73E 3V2PA 5DJUB 5AVXB 2HYNA 2M3BA 4OH8B 1KYOD 1A43A 5E79H 1J2JB 3GLMA 1VKUA 3S9OA 1AF8A 4YXWH 2FVEA 3FWLA 1FDOA 1G1JA 2LKMA 2H8PD 4U0AA 1KFMA 1URQB 4C7NB 3UIAA 4JQ0D 5AW2B 1A02F 1SFCB 2Y0DA 2ZVOB 2WPTA 1KZUB 3M0DC 2G3AA 1N2DC 2GYKA 2EIAA 4M3LA 1FZAA 1FOSF 3WUVA 1NTKG 1NTMK 2LR2A 3GJNA 2XU6A 1S9KD 3Q20A 1JMBA 3H1HG 4R4MA 3CCEP 3ZDMA 2JGPA 4NEOA 1Q7YQ 1AV1A 1YJNP 2C0WA 2Z5IA 4UB8H 1PV3A 1KD1Q 3L71G 2QRXA 2KW2A 3L72D 4IL6E 1SQPJ 2PEKA 2W6AA 3WUTA 3L37A 2NPSA 3GW6A 1FC2C 2K3RA 1IK7A 1FZEA 1EXJA 1NU1J 2HODA 4H13D 2KOQA 3SWKA 3B5ND 3WMM0 1PP9E 5KAIH 1T6AA 3CMAP 2KB7P 2C0XA 4L76A 1GK6A 4PH0A 4U3FE 3V2QA 1EQ7A 5EJDA 1IFJA 3EJBA 3H1JE 4QKOA 3TGUJ 5AW4B 1Q90D 4LC1A 4UB6E 4ZMDA 3HYBA 1RO2A 4Y28J 1IMQA 1EIAA 2P10A 3Q5SA 2JYLA 1AA0A 4GIFA 1ZOYC 3H6PA 4PD4D 2IDBA 1IFDA 3V4WA 1Y47A 2JWAA 3MP7B 3M9HA 5KAFE 1SQVG 5AW1B 1WRGA 3II6A 3SWFA 5APXA 3GF3A 3L75J 2W27A 2FFDB 2P9XA 5KAFH 2MVVA 2W6JH 2QIWA 2IBZD 2AFDA 3BCCD 3CCRP 1J1EB 2KZIA 1PEMA 1M1JA 1PFIA 3G26A 3LW5H 2E5TA 5CCGD 1OMIA 1RF1C 1N73A 2FKWB 1RH5B 1JUNA 2AXTH 2OYHA 4N6JA 2KG6A 2WMMA 1USEA 2BASA 2AEFA 2KORA 1L0IA 5CZDB 3IFMA 3H1HE 1VQ8P 5KJ7D 2NO8A 2ZAEB 1E0HA 2A06G 3H1ID 4C7RA 5HV8A 2N6YA 3W67A 1AVOA 2Q1KA 4WY4D 3AE3C 4N3YB 2ZXXA 3M1MA 1RNIA 4BPHA 2PFXA 1VQLP 1AVYA 4L73A 4XROA 1YJWP 1FE6A 4NPEA 3B4SA 3DS1A 1SS1A 1IFIA 2VRSA 5B5EE 2RMZA 5CMZA 2KODA 5HGMA 1M7LA 2YKQA 1OW7A 2N1TC 3H1KJ 3VTPC 3CWBD 1WT6A 2M0BA 1X3OA 2E74B 3I5CA 3H1LD 1DEBA 1LTIC 4H13C 1VHNA 2QG4A 3B5NC 1GL2D 2PEMA 5H2FE 2WQYC 2Q3IA 4PV1B 3RK2B 4Z1MH 2K93A 3H0DA 2ITAA 4DT0A 5AVYB 4HJGH 1J1DB 4B86A 2WSCH 1G1IA 4AQRD 4R0MA 1NYHA 4GR6A 2OQQA 2E5YA 2JR8A 5EW5E 2QJPB 4RKUJ 2ZYGA 5TISE 1PPJD 1X8YA 1FZCB 2PEOA 1OXZA 5CHXA 3M06A 1S4XA 3AEGC 4IZ6A 1UNKA 1NH4A 1SQVE 3DS5A 1ZRTE 3L74G 1MKMA 2FBWC 2BQ1E 2FYUK 3V6IA 1OZHA 5AVVB 1SQQJ 1SQBD 3JC22 1GK4A 2BCCD 2WSEJ 1P84D 2A45G 3G3ZA 4PH1A 2BEZF 3GMAA 4D6TD 1L0LK 3VP8A 3L72G 5CCGC 5KLVJ 2NRGA 3NTEA 4U3FJ 2O01H 2GZJA 2FYNB 1EDIA 1L4AB 2PGDA 5KJ7C 1L0NK 5KP7B 4IFMA 1M1JB 3H4EA 1W2EA 2IPPA 4WY4C 1OVRA 4KHXA 2J5UA 1NO4A 3B5IA 1XTCC 2Y0CA 2OYHB 1ZR4A 2HR3A 3SWYA 2Z45A 3SSUA 3G4SP 1BGYD 1TU3F 3IR9A 2JAZA 1LTAC 1OX3A 1NGMB 1LTJC 3D6YA 5AW6B 3SFDC 3HD7A 3KDPB 5AVSB 1HJBA 3CCSP 3SFEC 2A45I 1L0HA 3MUDC 4M0IA 1JY2N 5AW0B 2N50A 1LJ2A 3CI9A 2Q7CA 4EOTA 1YITP 4PWVB 1ZR2A 2LIWA 4HB1A 3O6QB 3ABVC 3E1IA 1GL2C 2WPQA 2IBZG 1S72P 1NTKJ 3BCCG 2KLVA 3VMXA 1USDA 5APQA 2CNRA 5BVZA 2L5GB 3RL0B 3M9QA 5CJ4A 2Y9ZA 3D71A 1KILA 4WVZA 1H88A 1SFCA 3G1IA 1JY2P 4I7ZC 3JCUE 4PJ0E 2FY8A 1BXIA 2O01N 2XZ0D 3CXHH 3L71J 2AF8A 2E76B 1LGHB 1BCCD 1SQPE 3L74E 1OW6A 4GDOA 3JCUH 2BHVA 5KLIB 2WSFJ 3CLQA 1K04A 1NAFA 2W8ZA 4PD4I 1QLED 4O9BA 3FXEA 1NU1E 2QJYC 1ZMEC 1E5WA 4N78D 1W5CE 1NAYA 1QL1A 4R4LA 1NTMD 3TGUE 3VOPA 2E75B 2IBZI 1N7SD 3CWBG 5APVA 3CMEP 3T97A 5C39A 1SQXG 4IFFA 4K35A 2QM7A 2OYIA 2WPVB 3NXSA 2VLOA 1LWUA 3PRJA 1KILE 1LTBC 1FR2A 3D70A 3L75E 2NZ2A 2FAEA 2L22A 2IX7C 2CG5B 2MJZA 2Q5UA 2CGQA 1FZBA 3MGNA 3P8MC 2NPSC 2Z5HA 3FXDA 2XT1A 1HJ0A 1KB9D 2AEMA 2KG8A 1CZQA 3PLNA 2KXPB 5KLVG 4AUWA 2KIKA 1YHQP 3A0BE 3AE7C 4DOJA 1RQVA 1SQBG 3LMOA 2H43A 2JBGA 4COPA 1RHZB 3A0BH 1Y9BA 5AVTB 4DZOA 1QGKB 3HD7B 3G28A 3E1RA 3VMZA 4BRYA 2P1JA 4H44B 1VQMP 2W6BA 3Q5PA 1FDIA 1PZQA 1VQKP 2GZEA 1DNYA 2H88C 1RE3A 3A3YB 3CD6P 2QJKC 2WPSA 2KGEA 4IL6X 2L9FA 2ZT9B 2O3JA 1LT9B 1VPCA 1ZLLA 3LIEA 2XZ1C 3OA7A 1JOCA 1DD3A 2H7HA 3GHGA 3LRYA 3VRLC 3H1KE 2WTYA 1KILB 2M8RA 1DH3A 3R2PA 3V2RA 2KYVA 1EZVD 2Y0EA 3U43A 3AE4C 5CCHD 3TDKA 1PGJA 1M57D 1NTZK 1P84I 1N73C 1N7SC 2O1JA 4H0LD 2Z46A 1VQ7P 4RESB 2HLOA 3HZQA 1SQXE 1FOSE 1S5LE 3PTZA 4OGQD 1EDLA 2JQ4A 2N9YB 3C8VA 2XNDH 1LTSC 2MD9A 1S5LH 3DPHA 3L36A 3CCUP 1Q82Q 2L0QA 1KN7A 4U0BA 1VF5D 4H2WC 3L74J 3AEAC 1M56D 1UIIA 4GKGA 3L70D 1SQQE 3U1AA 3T97B 1DEEG 2N1TD 1S2EA 4IL6H 3HE5A 3TSIA 2XV5A 2WSEH 1GU5A 1FZCA 2BUOA 2OYIB 3L72J 3GF7A 1DD4A 1LWUB 5KLVE 4ASVA 2K9JA 1GD2E 3MD0A 2YO3A 4HYTB 5APWA 3VN0A 3M0AA 4KT0J 2WZ7A 1FJPA 2MKVA 3EFFK 2DNWA 1Z6MA 1IJDB 2K0YA 2ZJSE 1FU1A 3CX5D 4UB6H 5F2NA 1SP4A 1H89A 1URQD 3IAOA 2BEQD 2AFEA 2O1KA 1SFCD 2FYUD 5DJTB 5AVZB 2XDJA 2ZFCA 1IO4A 4EDFA 1HTLC 5KKZC 1KQGB 4JYCA 1MFZA 1L4AA 1VQ9P 1JMMA 5AVRB 2KNCA 4Y99C 4BRYB 1L0LD 5GTHE 2KR5A 3M9BA 3U1CA 4K3AA 1AQ5A 4XFXA 3IF4A 2K94A 4EI2A 5CCHC 1ACPA 2FXPA 1NTKE 2YXRB 4WWIA 2HFED 3CXCO 2KGCA 3BCCJ 3M0DA 1MZ8A 1AUMA 1L0ND 1KV4A 3B4QA 3DS0A 3GHGB 3AE1C 2EG5A 1T2KD 4H0LC 1X79B 1DIPA 2FXMA 4BXLA
chains in the Genus database with same CATH topology
1VQMP 3HYBA 1RO2A 1KQSO 5HGLA 1VQKP 2BUOA 1EIAA 3H4EA 4QNBA 2JYLA 1NJIQ 1Q86Q 1QVGO 3OW2O 3DTJA 5F2OA 1K8AQ 3CD6P 2Z44A 3I55P 2M8LA 3B5IA 2M8NA 1PEOA 1N8RQ 2PEMA 1ZMBA 3G71P 5HGOA 2Z45A 2EIAA 3E2DA 4XRQA 3G1GA 1BAJA 4U0EA 5BS2A 1M90Q 3H0DA 2ONTA 3G4SP 4WYMA 1YIJP 2LF4A 2PY8A 3RG6C 3CMEP 2OARA 3LRYA 3VRLC 1EOQA 3Q20A 1VQPP 1KC8Q 1M1KQ 2JYGA 2P9XA 1PEUA 1M6NA 1W2BO 3CCEP 4GR6A 1QVFO 3CCRP 3WBHA 3H47A 2EFJA 3CCSP 1VQ5P 5F2NA 1PEMA 4M0IA 3CPWO 2JO0A 4U0CA 2PEOA 3G26A 3P05A 1YITP 2E1MA 2PENA 4XFZA 3G29A 1Q7YQ 2PEQA 1YJNP 4U0DA 3I56P 4COCA 2DGYA 1VQOP 1A8OA 2CWOA 3G0VA 1S72P 5I4TG 3DS5A 1KD1Q 1QRJA 1M6EX 1YJ9P 1D1DA 2BQ1E 1VQ9P 1M74A 2PEKA 2Z46A 4XFYA 5BS1A 1VQ7P 3DS3A 1PEQA 1IUQA 3HZQA 1VQ8P 2XV6A 2QA4P 1RO0A 5DCKA 5F2KA 3CC4P 2OTLP 3CCQP 3CC7P 4PH1A 2XT1A 3G6EP 1VQ4P 3DS4A 2QEXP 3CC2P 2OTJP 2M8PA 4XFXA 3G1IA 1YI2P 3CCJP 1K30A 3DPHA 1VQNP 3CCUP 1K73Q 3M1MA 1YHQP 2PEIA 4GR2A 1Q82Q 1RNIA 5HGNA 3CXCO 3CMAP 1VQLP 3G21A 4IPYA 3NTEA 4U0BA 4XROA 4PH0A 1Q81Q 3CCLP 1JJ2O 1A43A 2BHVA 1AUMA 2L6EA 1YJWP 4COPA 3CCMP 3DS0A 1VQ6P 5JPAA 3DS1A 1K9MQ 1E6JP 2EG5A 4U0FA 3CCVP 3DS2A 3MGEA 3G28A 2KODA 2PEJA 5HGMA 2XXMA 4U0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTJ P;  3G4S P;  1YI2 P;  1YIJ P;  1VQM P;  3CCJ P;  1VQO P;  3CME P;  1S72 P;  1KQS O;  1VQN P;  3CCU P;  1VQK P;  1VQP P;  1K73 Q;  1YHQ P;  1KC8 Q;  1Q82 Q;  1M1K Q;  1KD1 Q;  3CXC O;  3CMA P;  1YJ9 P;  1W2B O;  1NJI Q;  1VQL P;  1VQ9 P;  3CCE P;  1Q86 Q;  1QVG O;  3OW2 O;  1QVF O;  1VQ7 P;  3CCL P;  3CCR P;  1Q81 Q;  3CCS P;  1JJ2 O;  1VQ5 P;  1VQ8 P;  1YJW P;  1K8A Q;  3CD6 P;  3I55 P;  3CCM P;  2QA4 P;  3CC4 P;  1N8R Q;  3CPW O;  1VQ6 P;  2OTL P;  1K9M Q;  3CCV P;  1YIT P;  3G71 P;  3CCQ P;  3CC7 P;  1Q7Y Q;  3G6E P;  1M90 Q;  1VQ4 P;  2QEX P;  3CC2 P;  1YJN P;  3I56 P; 
#chains in the Genus database with same CATH topology
 1MZ9 A;  4OGQ C;  2KOP A;  3EJD A;  2YNY A;  4L74 A;  5HGL A;  3L73 D;  2YKP A;  3P8C E;  2LOL A;  1PGQ A;  3O6Q A;  3L71 E;  1T3U A;  5F2O A;  3RK3 E;  1K8A Q;  1LT1 A;  1PEO A;  2JWD A;  2HPC A;  1JCC A;  3H1I J;  1T8K A;  2VLP A;  2VSQ A;  3HUS B;  3TNU B;  5HGO A;  1VF5 C;  2R44 A;  4XRQ A;  1SQP K;  3KQG A;  4A7P A;  1GXH A;  2GZF A;  2WSF H;  5B5E H;  2FVA A;  2B9B A;  3H47 A;  2EFJ A;  2LPK A;  1FZF A;  2YIU B;  1NU1 K;  1OWA A;  5AVW B;  2K92 A;  4U0C A;  2YO2 A;  3P05 A;  2IFN A;  5CBN A;  4WBA A;  3GZL A;  4U0D A;  2MR7 A;  3CL3 D;  1A02 J;  2N98 A;  3CWB J;  5KTB A;  1QRJ A;  5H2F H;  5K5G B;  3H1L J;  2H89 C;  3HE5 B;  1SQX J;  2KK7 A;  1KB9 I;  1XTG B;  2D2C B;  2UWJ E;  5APU A;  3P32 A;  1VQ4 P;  2M3E A;  4PXH B;  3CC2 P;  1URQ C;  2K9J B;  2M8P A;  3B8E B;  5TIS H;  2KSE A;  1SFC C;  4GOF A;  2C9L Y;  2WSS H;  2LTE A;  1AJY A;  1E6J P;  5AVQ B;  3F5H A;  1KYO I;  1KQS O;  2PP6 A;  3RK3 B;  2KGD A;  1OVU A;  1PP9 D;  1NJI Q;  1GXG A;  3L70 G;  3AE8 C;  2KOO A;  1SQB J;  4RO0 A;  4U3F D;  3I55 P;  3C9I A;  2YXQ B;  1R5S A;  3L4F A;  4HKZ H;  3H1J D;  2RKL A;  2A06 E;  4D6T J;  2MVU A;  2KNC B;  1T2K C;  1S3J A;  2MF4 A;  2R5D A;  2GUS A;  2ZYA A;  3EFG A;  1CSB A;  2ZYD A;  2J59 M;  2E74 D;  1BE3 D;  2W90 A;  2GDX A;  1VQO P;  5APT A;  2CWO A;  5AW8 B;  3RK2 D;  4PV1 D;  1M6E X;  1YJ9 P;  4EIJ A;  3Q3D A;  1KYO E;  5BU5 A;  2NPS D;  3Q2Y A;  3RBX A;  3NFQ A;  4OVN F;  2KUB A;  1EDK A;  5F2K A;  1RE4 A;  2FYU G;  3RGU A;  2OTL P;  3HTK A;  3G6E P;  1BGY J;  1YI2 P;  1HH0 A;  1DX7 A;  5AW9 B;  2KLU A;  1IFM A;  2HPC B;  1LT9 A;  3B5N A;  2OGU A;  1CW5 A;  1L0L G;  1KQF B;  1GPJ A;  3KHU A;  2QVA A;  3A0H E;  3H1H D;  1MV8 A;  1JCD A;  5JPA A;  2E42 A;  1Z56 A;  2FFD C;  3A0H H;  4DG9 A;  1GW4 A;  3U59 A;  1S9K E;  1GU4 A;  2ERH A;  1JB0 J;  1J1E C;  1WMK A;  1KOR A;  2OTK E;  4PJ0 H;  3H1I G;  3H32 A;  1OVV A;  1N7L A;  1LTG C;  1HWT C;  3LID A;  2FHS C;  3G1G A;  1M90 Q;  5BS2 A;  1VL2 A;  2K0X A;  1QX8 A;  4BPG A;  1YIJ P;  3CX5 I;  3WU2 E;  1JY3 O;  2LXC B;  1SQQ K;  4HKG A;  1PGP A;  3L72 E;  4ASW A;  1W2B O;  1BCC J;  2A45 H;  3AE2 C;  3WU2 H;  2LIU A;  3BAS A;  3N4X A;  5B66 E;  4CPG A;  4NPD A;  4IOI H;  1NTZ D;  1RQU A;  1PIX A;  5KLV K;  4GOE A;  1HBW A;  2P2U A;  5CCG A;  1GMJ A;  3G0V A;  2JU1 A;  1YYC A;  1MUU A;  3H1L G;  2FYZ A;  2GA1 A;  2JDI H;  1NTM J;  2YMY A;  5KJ7 A;  2WSC J;  1VDF A;  3NMD A;  5M1B A;  3KYQ A;  4NPF X;  2KP8 A;  3GG2 A;  2RN0 A;  1SQV D;  2E74 C;  4WY4 A;  2N6Z A;  1VQN P;  1RF1 B;  2PEI A;  1FBM A;  1R8E A;  2Z4E A;  1ZRT D;  2K37 A;  3CX5 E;  4PD4 E;  1HQB A;  1PPJ G;  1JJ2 O;  1YTZ T;  3RK2 C;  4PV1 C;  3CCM P;  3HRN A;  2N5H A;  1U7M A;  2W83 C;  2FQ0 A;  4U0F A;  3AEF C;  1J1D C;  4PD4 H;  1LNQ A;  4I1L A;  3DS2 A;  4C46 A;  3RL0 D;  3AE6 C;  1GDT A;  2QJP C;  2EHT A;  3MUD A;  2IBZ E;  3BCC E;  3OW2 O;  1FZC C;  2BCC G;  1G2C A;  1L0L E;  1DV5 A;  2Z44 A;  3AEE C;  3VMY A;  3R4Y A;  1H0T B;  2N9B A;  1NTK K;  1GL2 A;  1QEX A;  3A2A A;  2E76 D;  1S5L X;  4D6T G;  1D7M A;  1NOH A;  1JNM A;  2O01 J;  1IFN A;  1L2P A;  3O8Z A;  4YXD C;  3L35 A;  1EDJ A;  2JYG A;  1HGV A;  3HTK B;  1UIX A;  2KSJ A;  2N1T B;  1N86 A;  3H1J G;  4WB4 A;  3G9R A;  4YTP C;  2AVA A;  2JJL A;  2JO0 A;  2J58 A;  2WIT A;  1RF0 A;  3H1I E;  4H13 B;  5KP8 B;  1OR5 A;  3A5T A;  3W68 A;  3B5N B;  3HE4 A;  5CBO A;  3I56 P;  1UJZ A;  1SLQ A;  5E79 E;  1HY8 A;  1T8Z A;  1X22 A;  4TT3 H;  4ZKP A;  2I1K A;  2ZXE B;  1LP1 A;  1Y8A A;  2E75 D;  2KS1 B;  1FS0 E;  2KI7 B;  2QSI A;  1IUQ A;  2FYN C;  2KZJ A;  1BE3 G;  1ZP0 C;  1L4A C;  1RO0 A;  5AW5 B;  2V7Q J;  3CCQ P;  4U7J A;  1CEI A;  1BGY G;  4MRT C;  1U57 A;  4RJT A;  1M1J C;  1QL2 A;  4EYY Q;  1K30 A;  2KWL A;  3QWO C;  2QM8 A;  3CWB E;  3EWK A;  1GTW A;  3H32 B;  3HUS A;  3TNU A;  3H1L E;  2OYH C;  2P67 A;  2L6E A;  1HF9 A;  1VQ6 P;  3RL0 g;  2SPZ A;  1K9M Q;  3CE7 A;  3MGE A;  1OIP A;  2K9Y A;  3CXH D;  3IN6 A;  2C9N Y;  2KOS A;  4ZNC A;  2MR8 A;  3NTN A;  2WVR A;  1SQP D;  3L74 D;  2QE7 H;  1KLP A;  2XNX A;  1SQV K;  4UB8 E;  1PPJ E;  2GZG A;  1GW3 A;  2CPB A;  3ITK A;  1AQT A;  1HUC A;  1X9V A;  4TLF A;  3C1L A;  1GZL A;  5AW3 B;  2IFM A;  2CPS A;  1IFP A;  1NU1 D;  3HD7 D;  1BCC G;  3RL0 C;  4H44 D;  4F37 A;  3L70 J;  1SQB E;  2BCC E;  1YQ4 C;  1P84 E;  3CPW O;  4WY4 B;  5KAI E;  2M5A A;  2PEN A;  2XZR A;  3TGU D;  2KOG A;  4D6T E;  2ZT9 D;  1HVV A;  1P84 H;  1A8O A;  4L75 A;  2E76 C;  5I4T G;  3Q1M A;  5KLI C;  4GT1 A;  1LTJ B;  1NTM G;  1NTZ G;  2XV6 A;  2AEJ A;  3BRV B;  3BVH A;  3MIW A;  1KMI Z;  3CC7 P;  3KZI E;  1KIL D;  4XE5 B;  1NKN A;  2X2B A;  1JEK A;  3CCJ P;  1G2C B;  4GOD A;  3L75 D;  3KZI H;  4GR2 A;  1GL2 B;  4JBZ A;  3GZM A;  1IMP A;  1EMV A;  1RY3 A;  1SVF A;  4KJM A;  1BSH A;  2E75 C;  1NWQ A;  1BE3 E;  3CCV P;  3OAK A;  1K05 A;  1Q2N A;  2FYU J;  5APS A;  2DW3 A;  3WUU A;  1BGY E;  3V5B A;  3RG2 A;  3MTU E;  3V4Q A;  1IZN B;  1IC2 A;  5GTH H;  1EXI A;  2HG5 D;  2JU2 A;  4YPC A;  3RBZ A;  4I7Z B;  2E43 A;  4HH2 A;  4XFJ A;  1OW8 A;  3HE4 B;  3DTJ A;  1L0L J;  2P58 A;  1CI6 A;  2M8N A;  1JTH A;  3QH9 A;  2AXT E;  5APY A;  1N8R Q;  1NHL A;  1M8O B;  3MHV A;  1LP1 B;  4U0E A;  1BAJ A;  2B89 A;  2L91 A;  2YMK A;  2ONT A;  3V2N A;  3VP9 A;  5CJ0 A;  1N7S A;  3RG6 C;  4W7Z A;  1VQP P;  1M1K Q;  1M6N A;  2LML A;  2QJY B;  1L0N J;  3TK1 A;  3S1K A;  1X0T A;  3B71 A;  2Q9I A;  4XFZ A;  3G29 A;  4JYB A;  3VMA A;  2LXB A;  3L73 J;  5HVC A;  1E79 H;  3H1K D;  1D1D A;  4XA4 A;  1BCC E;  1YBK A;  3HD7 C;  2QA4 P;  4IFD K;  1FJK A;  1NKZ B;  1U7J A;  4H44 C;  2L4B A;  1RE4 C;  3Q5R A;  2ZT9 C;  3G21 A;  4IPY A;  1FAV A;  1EC5 A;  1EZV G;  4N78 E;  1LT9 C;  1SQX D;  2AXC A;  1NTM E;  1NTZ E;  4DJG A;  2B87 A;  1AYI A;  2K1A A;  2PEJ A;  2NPS B;  2Q3E A;  2FQ1 A;  1KIL C;  1F80 D;  3PP5 A;  2KG9 A;  2JO1 A;  5KP6 B;  2CQ8 A;  1Q86 Q;  1QVG O;  2M5A B;  5BU8 B;  3FWN A;  2WT7 A;  3KXD A;  2VLN A;  1IK9 A;  7CEI A;  2JP3 A;  2HOD B;  2GUV A;  2R32 A;  1FZG A;  1SQQ D;  3PJS K;  2V4H A;  4BPF A;  2KGA A;  1NVO A;  3FGA D;  3D6Z A;  1NQ4 A;  1SQP G;  1PEU A;  2ZVN B;  5KLV D;  2LL8 A;  3GKL C;  1JY3 N;  2BCC J;  1RF1 A;  5EFW B;  2QJK B;  5CCH A;  2PEQ A;  3A7O A;  1NU1 G;  1KB9 E;  2DGY A;  1BDC A;  1T3J A;  4H2Y C;  1PP9 J;  1EZV I;  3AEB C;  1KB9 H;  4UHP B;  1PEQ A;  2PNG A;  1KFN A;  2Y9Y A;  3TGU G;  3CC4 P;  3H1J J;  3BAT A;  2XKM A;  3KPE A;  4LLH A;  2G8Y A;  2R5B A;  1JY3 P;  1ZXG A;  2OYI C;  4DCK A;  1LWU C;  2WWW A;  1H0T A;  1CI6 B;  3AED C;  1JTH B;  5AW7 B;  5AVU B;  3S4R A;  1AFO A;  1Q81 Q;  3USS A;  2EHS A;  3CXH I;  1N73 B;  1N7S B;  3MZW B;  1PL5 A;  2VLQ A;  1BE3 J;  3PHL A;  2N1T A;  3JSV C;  2XXM A;  1KYO H;  1BDD A;  3L75 G;  3F89 A;  1YTZ I;  2D2C D;  1LTT C;  5TJH A;  2V7Q H;  3LW5 J;  1NTK D;  4H2X C;  2YKO A;  3N7N A;  1HGZ A;  2FQ2 A;  5GTI E;  1EZV E;  3G71 P;  2R3S A;  2KS1 A;  5GTI H;  1R5L A;  1SQX K;  2LF4 A;  1KQL A;  2OAR A;  4I6M C;  1KC8 Q;  1S1C X;  2N5I A;  2JEE A;  3P8C D;  1L0N G;  3TF5 A;  4W7Y A;  1KTM A;  1QVF O;  2K0D X;  3H1H J;  4JPZ B;  3L71 D;  1VQ5 P;  3RK3 D;  3OJA B;  1OFC X;  1URQ A;  4C7N A;  2I8D A;  1RE3 C;  3AE5 C;  3CXH E;  2POH A;  4QMA A;  2FAC A;  4COC A;  1RF0 C;  3L73 G;  2RH0 A;  3H25 A;  2B87 B;  4MN4 C;  1L4A D;  1ZV8 A;  2LKI A;  3GHG C;  3L70 E;  4AYC A;  4I2L C;  2K88 A;  2GDY A;  2IYP A;  3FX0 A;  3PH0 A;  2QEX P;  2P7J A;  3H1K G;  2FXO A;  1SQB K;  5B66 H;  2WT7 B;  2MY5 A;  2CK3 H;  2Q6Q A;  4LGD E;  2PAJ A;  5HGN A;  1PGO A;  1MFT A;  5KKZ B;  3CCL P;  2ROQ A;  3HUS C;  2B88 A;  1NTZ J;  2M5R A;  4Y99 B;  2R3C A;  5L8R J;  2QNW A;  2WPR A;  1JO5 A;  2K5X A;  4QNB A;  4BWN A;  2YIU C;  2JKV A;  3P7K A;  4ZKU A;  2IZ1 A;  2IZ0 A;  2M8L A;  2K2Q A;  2IYO A;  3BRT B;  1ZMB A;  1FDM A;  3E2D A;  3CX5 H;  1LTJ A;  2FYU E;  1JM0 A;  4WYM A;  1SQV J;  4H0L B;  2PY8 A;  3AEC C;  3AE9 C;  3E7K A;  1JY2 O;  1EOQ A;  1YQ3 C;  1ZW0 A;  4OGQ B;  2D2C C;  1SQQ G;  4OWF A;  3WBH A;  2GZI A;  3VYI A;  2OYO A;  1ZNV A;  3EJE A;  2E1M A;  2GDW A;  2A06 D;  2FAD A;  4W80 A;  3NY7 B;  3TYY A;  1PP9 G;  1VF5 B;  4JF7 A;  2FVF A;  2JB0 A;  4U3F G;  1M74 A;  2I1J A;  4XFY A;  5BS1 A;  3DS3 A;  2FFD A;  1L0N E;  2PRR A;  4CA3 A;  5DCK A;  3EQ2 A;  1ZN5 A;  1H8A A;  3K5B A;  2GM4 A;  3DS4 A;  3RK3 C;  2OTJ P;  3M91 A;  1BSN A;  1K73 Q;  3L73 E;  3V2P A;  5DJU B;  5AVX B;  2HYN A;  2M3B A;  4OH8 B;  1KYO D;  1A43 A;  5E79 H;  1J2J B;  3GLM A;  1VKU A;  3S9O A;  1AF8 A;  4YXW H;  2FVE A;  3FWL A;  1FDO A;  1G1J A;  2LKM A;  2H8P D;  4U0A A;  1KFM A;  1URQ B;  4C7N B;  3UIA A;  4JQ0 D;  5AW2 B;  1A02 F;  1SFC B;  2Y0D A;  2ZVO B;  2WPT A;  1KZU B;  3M0D C;  2G3A A;  1N2D C;  2GYK A;  2EIA A;  4M3L A;  1FZA A;  1FOS F;  3WUV A;  1NTK G;  1NTM K;  2LR2 A;  3GJN A;  2XU6 A;  1S9K D;  3Q20 A;  1JMB A;  3H1H G;  4R4M A;  3CCE P;  3ZDM A;  2JGP A;  4NEO A;  1Q7Y Q;  1AV1 A;  1YJN P;  2C0W A;  2Z5I A;  4UB8 H;  1PV3 A;  1KD1 Q;  3L71 G;  2QRX A;  2KW2 A;  3L72 D;  4IL6 E;  1SQP J;  2PEK A;  2W6A A;  3WUT A;  3L37 A;  2NPS A;  3GW6 A;  1FC2 C;  2K3R A;  1IK7 A;  1FZE A;  1EXJ A;  1NU1 J;  2HOD A;  4H13 D;  2KOQ A;  3SWK A;  3B5N D;  3WMM 0;  1PP9 E;  5KAI H;  1T6A A;  3CMA P;  2KB7 P;  2C0X A;  4L76 A;  1GK6 A;  4PH0 A;  4U3F E;  3V2Q A;  1EQ7 A;  5EJD A;  1IFJ A;  3EJB A;  3H1J E;  4QKO A;  3TGU J;  5AW4 B;  1Q90 D;  4LC1 A;  4UB6 E;  4ZMD A;  3HYB A;  1RO2 A;  4Y28 J;  1IMQ A;  1EIA A;  2P10 A;  3Q5S A;  2JYL A;  1AA0 A;  4GIF A;  1ZOY C;  3H6P A;  4PD4 D;  2IDB A;  1IFD A;  3V4W A;  1Y47 A;  2JWA A;  3MP7 B;  3M9H A;  5KAF E;  1SQV G;  5AW1 B;  1WRG A;  3II6 A;  3SWF A;  5APX A;  3GF3 A;  3L75 J;  2W27 A;  2FFD B;  2P9X A;  5KAF H;  2MVV A;  2W6J H;  2QIW A;  2IBZ D;  2AFD A;  3BCC D;  3CCR P;  1J1E B;  2KZI A;  1PEM A;  1M1J A;  1PFI A;  3G26 A;  3LW5 H;  2E5T A;  5CCG D;  1OMI A;  1RF1 C;  1N73 A;  2FKW B;  1RH5 B;  1JUN A;  2AXT H;  2OYH A;  4N6J A;  2KG6 A;  2WMM A;  1USE A;  2BAS A;  2AEF A;  2KOR A;  1L0I A;  5CZD B;  3IFM A;  3H1H E;  1VQ8 P;  5KJ7 D;  2NO8 A;  2ZAE B;  1E0H A;  2A06 G;  3H1I D;  4C7R A;  5HV8 A;  2N6Y A;  3W67 A;  1AVO A;  2Q1K A;  4WY4 D;  3AE3 C;  4N3Y B;  2ZXX A;  3M1M A;  1RNI A;  4BPH A;  2PFX A;  1VQL P;  1AVY A;  4L73 A;  4XRO A;  1YJW P;  1FE6 A;  4NPE A;  3B4S A;  3DS1 A;  1SS1 A;  1IFI A;  2VRS A;  5B5E E;  2RMZ A;  5CMZ A;  2KOD A;  5HGM A;  1M7L A;  2YKQ A;  1OW7 A;  2N1T C;  3H1K J;  3VTP C;  3CWB D;  1WT6 A;  2M0B A;  1X3O A;  2E74 B;  3I5C A;  3H1L D;  1DEB A;  1LTI C;  4H13 C;  1VHN A;  2QG4 A;  3B5N C;  1GL2 D;  2PEM A;  5H2F E;  2WQY C;  2Q3I A;  4PV1 B;  3RK2 B;  4Z1M H;  2K93 A;  3H0D A;  2ITA A;  4DT0 A;  5AVY B;  4HJG H;  1J1D B;  4B86 A;  2WSC H;  1G1I A;  4AQR D;  4R0M A;  1NYH A;  4GR6 A;  2OQQ A;  2E5Y A;  2JR8 A;  5EW5 E;  2QJP B;  4RKU J;  2ZYG A;  5TIS E;  1PPJ D;  1X8Y A;  1FZC B;  2PEO A;  1OXZ A;  5CHX A;  3M06 A;  1S4X A;  3AEG C;  4IZ6 A;  1UNK A;  1NH4 A;  1SQV E;  3DS5 A;  1ZRT E;  3L74 G;  1MKM A;  2FBW C;  2BQ1 E;  2FYU K;  3V6I A;  1OZH A;  5AVV B;  1SQQ J;  1SQB D;  3JC2 2;  1GK4 A;  2BCC D;  2WSE J;  1P84 D;  2A45 G;  3G3Z A;  4PH1 A;  2BEZ F;  3GMA A;  4D6T D;  1L0L K;  3VP8 A;  3L72 G;  5CCG C;  5KLV J;  2NRG A;  3NTE A;  4U3F J;  2O01 H;  2GZJ A;  2FYN B;  1EDI A;  1L4A B;  2PGD A;  5KJ7 C;  1L0N K;  5KP7 B;  4IFM A;  1M1J B;  3H4E A;  1W2E A;  2IPP A;  4WY4 C;  1OVR A;  4KHX A;  2J5U A;  1NO4 A;  3B5I A;  1XTC C;  2Y0C A;  2OYH B;  1ZR4 A;  2HR3 A;  3SWY A;  2Z45 A;  3SSU A;  3G4S P;  1BGY D;  1TU3 F;  3IR9 A;  2JAZ A;  1LTA C;  1OX3 A;  1NGM B;  1LTJ C;  3D6Y A;  5AW6 B;  3SFD C;  3HD7 A;  3KDP B;  5AVS B;  1HJB A;  3CCS P;  3SFE C;  2A45 I;  1L0H A;  3MUD C;  4M0I A;  1JY2 N;  5AW0 B;  2N50 A;  1LJ2 A;  3CI9 A;  2Q7C A;  4EOT A;  1YIT P;  4PWV B;  1ZR2 A;  2LIW A;  4HB1 A;  3O6Q B;  3ABV C;  3E1I A;  1GL2 C;  2WPQ A;  2IBZ G;  1S72 P;  1NTK J;  3BCC G;  2KLV A;  3VMX A;  1USD A;  5APQ A;  2CNR A;  5BVZ A;  2L5G B;  3RL0 B;  3M9Q A;  5CJ4 A;  2Y9Z A;  3D71 A;  1KIL A;  4WVZ A;  1H88 A;  1SFC A;  3G1I A;  1JY2 P;  4I7Z C;  3JCU E;  4PJ0 E;  2FY8 A;  1BXI A;  2O01 N;  2XZ0 D;  3CXH H;  3L71 J;  2AF8 A;  2E76 B;  1LGH B;  1BCC D;  1SQP E;  3L74 E;  1OW6 A;  4GDO A;  3JCU H;  2BHV A;  5KLI B;  2WSF J;  3CLQ A;  1K04 A;  1NAF A;  2W8Z A;  4PD4 I;  1QLE D;  4O9B A;  3FXE A;  1NU1 E;  2QJY C;  1ZME C;  1E5W A;  4N78 D;  1W5C E;  1NAY A;  1QL1 A;  4R4L A;  1NTM D;  3TGU E;  3VOP A;  2E75 B;  2IBZ I;  1N7S D;  3CWB G;  5APV A;  3CME P;  3T97 A;  5C39 A;  1SQX G;  4IFF A;  4K35 A;  2QM7 A;  2OYI A;  2WPV B;  3NXS A;  2VLO A;  1LWU A;  3PRJ A;  1KIL E;  1LTB C;  1FR2 A;  3D70 A;  3L75 E;  2NZ2 A;  2FAE A;  2L22 A;  2IX7 C;  2CG5 B;  2MJZ A;  2Q5U A;  2CGQ A;  1FZB A;  3MGN A;  3P8M C;  2NPS C;  2Z5H A;  3FXD A;  2XT1 A;  1HJ0 A;  1KB9 D;  2AEM A;  2KG8 A;  1CZQ A;  3PLN A;  2KXP B;  5KLV G;  4AUW A;  2KIK A;  1YHQ P;  3A0B E;  3AE7 C;  4DOJ A;  1RQV A;  1SQB G;  3LMO A;  2H43 A;  2JBG A;  4COP A;  1RHZ B;  3A0B H;  1Y9B A;  5AVT B;  4DZO A;  1QGK B;  3HD7 B;  3G28 A;  3E1R A;  3VMZ A;  4BRY A;  2P1J A;  4H44 B;  1VQM P;  2W6B A;  3Q5P A;  1FDI A;  1PZQ A;  1VQK P;  2GZE A;  1DNY A;  2H88 C;  1RE3 A;  3A3Y B;  3CD6 P;  2QJK C;  2WPS A;  2KGE A;  4IL6 X;  2L9F A;  2ZT9 B;  2O3J A;  1LT9 B;  1VPC A;  1ZLL A;  3LIE A;  2XZ1 C;  3OA7 A;  1JOC A;  1DD3 A;  2H7H A;  3GHG A;  3LRY A;  3VRL C;  3H1K E;  2WTY A;  1KIL B;  2M8R A;  1DH3 A;  3R2P A;  3V2R A;  2KYV A;  1EZV D;  2Y0E A;  3U43 A;  3AE4 C;  5CCH D;  3TDK A;  1PGJ A;  1M57 D;  1NTZ K;  1P84 I;  1N73 C;  1N7S C;  2O1J A;  4H0L D;  2Z46 A;  1VQ7 P;  4RES B;  2HLO A;  3HZQ A;  1SQX E;  1FOS E;  1S5L E;  3PTZ A;  4OGQ D;  1EDL A;  2JQ4 A;  2N9Y B;  3C8V A;  2XND H;  1LTS C;  2MD9 A;  1S5L H;  3DPH A;  3L36 A;  3CCU P;  1Q82 Q;  2L0Q A;  1KN7 A;  4U0B A;  1VF5 D;  4H2W C;  3L74 J;  3AEA C;  1M56 D;  1UII A;  4GKG A;  3L70 D;  1SQQ E;  3U1A A;  3T97 B;  1DEE G;  2N1T D;  1S2E A;  4IL6 H;  3HE5 A;  3TSI A;  2XV5 A;  2WSE H;  1GU5 A;  1FZC A;  2BUO A;  2OYI B;  3L72 J;  3GF7 A;  1DD4 A;  1LWU B;  5KLV E;  4ASV A;  2K9J A;  1GD2 E;  3MD0 A;  2YO3 A;  4HYT B;  5APW A;  3VN0 A;  3M0A A;  4KT0 J;  2WZ7 A;  1FJP A;  2MKV A;  3EFF K;  2DNW A;  1Z6M A;  1IJD B;  2K0Y A;  2ZJS E;  1FU1 A;  3CX5 D;  4UB6 H;  5F2N A;  1SP4 A;  1H89 A;  1URQ D;  3IAO A;  2BEQ D;  2AFE A;  2O1K A;  1SFC D;  2FYU D;  5DJT B;  5AVZ B;  2XDJ A;  2ZFC A;  1IO4 A;  4EDF A;  1HTL C;  5KKZ C;  1KQG B;  4JYC A;  1MFZ A;  1L4A A;  1VQ9 P;  1JMM A;  5AVR B;  2KNC A;  4Y99 C;  4BRY B;  1L0L D;  5GTH E;  2KR5 A;  3M9B A;  3U1C A;  4K3A A;  1AQ5 A;  4XFX A;  3IF4 A;  2K94 A;  4EI2 A;  5CCH C;  1ACP A;  2FXP A;  1NTK E;  2YXR B;  4WWI A;  2HFE D;  3CXC O;  2KGC A;  3BCC J;  3M0D A;  1MZ8 A;  1AUM A;  1L0N D;  1KV4 A;  3B4Q A;  3DS0 A;  3GHG B;  3AE1 C;  2EG5 A;  1T2K D;  4H0L C;  1X79 B;  1DIP A;  2FXM A;  4BXL A; 
#chains in the Genus database with same CATH homology
 1VQM P;  3HYB A;  1RO2 A;  1KQS O;  5HGL A;  1VQK P;  2BUO A;  1EIA A;  3H4E A;  4QNB A;  2JYL A;  1NJI Q;  1Q86 Q;  1QVG O;  3OW2 O;  3DTJ A;  5F2O A;  1K8A Q;  3CD6 P;  2Z44 A;  3I55 P;  2M8L A;  3B5I A;  2M8N A;  1PEO A;  1N8R Q;  2PEM A;  1ZMB A;  3G71 P;  5HGO A;  2Z45 A;  2EIA A;  3E2D A;  4XRQ A;  3G1G A;  1BAJ A;  4U0E A;  5BS2 A;  1M90 Q;  3H0D A;  2ONT A;  3G4S P;  4WYM A;  1YIJ P;  2LF4 A;  2PY8 A;  3RG6 C;  3CME P;  2OAR A;  3LRY A;  3VRL C;  1EOQ A;  3Q20 A;  1VQP P;  1KC8 Q;  1M1K Q;  2JYG A;  2P9X A;  1PEU A;  1M6N A;  1W2B O;  3CCE P;  4GR6 A;  1QVF O;  3CCR P;  3WBH A;  3H47 A;  2EFJ A;  3CCS P;  1VQ5 P;  5F2N A;  1PEM A;  4M0I A;  3CPW O;  2JO0 A;  4U0C A;  2PEO A;  3G26 A;  3P05 A;  1YIT P;  2E1M A;  2PEN A;  4XFZ A;  3G29 A;  1Q7Y Q;  2PEQ A;  1YJN P;  4U0D A;  3I56 P;  4COC A;  2DGY A;  1VQO P;  1A8O A;  2CWO A;  3G0V A;  1S72 P;  5I4T G;  3DS5 A;  1KD1 Q;  1QRJ A;  1M6E X;  1YJ9 P;  1D1D A;  2BQ1 E;  1VQ9 P;  1M74 A;  2PEK A;  2Z46 A;  4XFY A;  5BS1 A;  1VQ7 P;  3DS3 A;  1PEQ A;  1IUQ A;  3HZQ A;  1VQ8 P;  2XV6 A;  2QA4 P;  1RO0 A;  5DCK A;  5F2K A;  3CC4 P;  2OTL P;  3CCQ P;  3CC7 P;  4PH1 A;  2XT1 A;  3G6E P;  1VQ4 P;  3DS4 A;  2QEX P;  3CC2 P;  2OTJ P;  2M8P A;  4XFX A;  3G1I A;  1YI2 P;  3CCJ P;  1K30 A;  3DPH A;  1VQN P;  3CCU P;  1K73 Q;  3M1M A;  1YHQ P;  2PEI A;  4GR2 A;  1Q82 Q;  1RNI A;  5HGN A;  3CXC O;  3CMA P;  1VQL P;  3G21 A;  4IPY A;  3NTE A;  4U0B A;  4XRO A;  4PH0 A;  1Q81 Q;  3CCL P;  1JJ2 O;  1A43 A;  2BHV A;  1AUM A;  2L6E A;  1YJW P;  4COP A;  3CCM P;  3DS0 A;  1VQ6 P;  5JPA A;  3DS1 A;  1K9M Q;  1E6J P;  2EG5 A;  4U0F A;  3CCV P;  3DS2 A;  3MGE A;  3G28 A;  2KOD A;  2PEJ A;  5HGM A;  2XXM A;  4U0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...