3CD6Q

Co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
molecule tags Ribosome
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 17
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3cd6Q00
1VQNQ 1Q81R 1Q7YR 3G6EQ 1VQ7Q 1VQLQ 3CCJQ 1VQ5Q 3CD6Q 1VQ9Q 3CCUQ 1VQPQ 3CCEQ 1VQ8Q 1K8AR 1QVGP 1K9MR 1YI2Q 1VQ6Q 3CPWP 3CCVQ 1M1KR 1YJ9Q 1YJNQ 3G71Q 1Q82R 1VQKQ 1M90R 2OTJQ 3CCLQ 1YIJQ 3CMEQ 1VQMQ 1VQOQ 3G4SQ 1S72Q 1YITQ 1K73R 1KQSP 1KD1R 1YJWQ 3CCQQ 3CC7Q 1VQ4Q 1QVFP 3CC4Q 1NJIR 3CC2Q 1KC8R 2OTLQ 2QEXQ 1W2BP 1N8RR 1JJ2P 2QA4Q 3CMAQ 1Q86R 3I55Q 3OW2P 1YHQQ 3CCMQ 3I56Q 3CXCP 3CCRQ 3CCSQ
chains in the Genus database with same CATH superfamily
3OBYA 3OMGA 3HTRA 4DEXA 2DA9A 1M5Q1 1MGQA 1WQWA 2JMAA 3EG9B 4C0GA 3VS0A 1QKWA 1MV0B 1AZGB 4F7UB 1G2BA 3O8VA 3CPWS 1K73U 2KRMA 3RR6A 3FJ5A 3RDVA 4PJOD 2DBKA 2OTJT 5CKEA 1X27A 2RI3A 1U3OA 3M59A 2DYIA 2MCNA 5FLXE 4DOVA 3ZL7C 2RI2A 1IXDA 3JCMJ 4PJOG 2RQUA 3M55A 4KBMB 2EW3A 3L2UA 5GAN2 3MP6A 2CP0A 1YHQQ 2LTOA 1M3AA 1KG1A 1MUZA 1SKUB 1DJ7B 3E9GA 1QVGP 2BZYA 2QQ9A 3OY9A 1QP2A 2CH4W 3VU3C 2CYZB 5FROA 2DX1A 2VGMA 1IRXA 1NE8A 1I1JA 1OPKA 1Q86R 2COWA 2L3SA 2CP2A 2L0AA 1WGSA 5KYXB 3CCUT 4OB3B 5IHKA 4KUDK 3QHSA 2W10A 4XTWA 3OMCA 1SSHA 2EYQA 4IUVA 1WHJA 2R5AA 2DFUA 1VYTA 1ZX6A 2ROLA 2L3RA 3CCLA 5HY6A 2ZPIB 1HD3A 2AKKA 3QBYA 4M75G 1BI1A 1QCOA 2IG0A 8ATCB 5LJ3d 1Q86U 1WXTA 3QZ9B 1NLPC 1RAIB 4BY6C 1QVGS 1KD1U 4NL3A 2XK0A 2YRVA 3QYGB 1OQKA 3CMAA 4D6WA 1WNLA 1YITT 4OGEA 3GP8A 1QW1A 4HT9A 3AT1B 4C8QB 1UGQB 5FU6C 3OYLA 2QEXQ 1MMDA 4OF1A 2SEMA 2KEAA 3EG9A 1YI2T 2O4XA 1YNZA 2ZGWA 1K76A 4ELZC 2HNIA 1IGUA 4OMPA 4XU0A 1UECA 3TSZA 3ZFJA 3N5BB 4KH1B 3WVDB 4KULA 3TSWA 2HL5C 4M7DA 1M8VA 5FU7B 1QKXA 2PUKB 2CUDA 1VYVA 2P0KA 1WI7A 3JCMf 2AZSA 1OYXA 4E7SA 2B86A 2HKNA 4AG1C 3OYKA 3SWNB 4JRIA 3CCEQ 4F17A 4EPCA 1N8RC 2ZAEA 3NGPA 4C8QG 4HCBA 3UWNA 3M5AA 1BB9A 3SD4A 3QXEB 1OULA 1YIJA 2Y4YA 3ASKA 2AIRB 1YIJT 2K3XA 2V26A 3PE0A 3JB9D 1T0JA 1I81A 3CCSA 1KHCA 2HQHA 4BD3A 1D3BA 2FEIA 2CKKA 5FWCA 3BY7A 1Q7YC 1A0NB 1HXDA 1M1GA 1R0CB 5EG2A 3CC2Q 4WCIA 2ZPEB 3H6ZA 4JJCA 1VQ9T 1VQKT 4FYXB 1M3CA 2DBMA 3DB3A 4LUDA 3TREA 2DVJA 5KYUB 1YI2Q 2M0OA 4PLIA 1MV3A 3E19A 1MNDA 1UHCA 1I0CA 4ZGDB 1KC8C 5FRNA 4N4HA 9ATCB 3OYJA 1W4SA 4M78C 2MI6A 1TSFA 2C0TA 2L3PA 1UEBA 4XTZA 4JDSA 5KYUA 4LD9K 3CCJA 2K2VA 4M7DB 2R58A 3ULRB 5L23A 2DL4A 2MAMA 2FPFA 4C8QA 5GAMh 4J7IA 2D8JA 2PUOB 2YT6A 1K8AU 4AFUC 3L2WA 1B34A 2O9SA 1SG5A 2FPEA 5GAOq 1BBZA 3JV3A 1EZZB 1OX8A 4PJOE 1OOTA 1D0YA 2QQSA 1X75C 3RERA 3M9QA 2XD0A 2ESWA 3LH0A 2E3HA 4XTXA 1EIFA 4ZTJA 3EGDA 1NG2A 2OTLT 1YJNQ 1YFNA 2ZZDA 3HRSA 1KFZA 2MOXA 3JCMc 1WYXA 5D6WA 3CQTA 3MEUA 2FVUA 4M78D 1VQMA 2P0PA 2HBPA 1D1BA 1W70A 3L42A 4Q5WA 3GNGA 4EMKA 1VQ7A 3J80E 1WA7A 3OSSC 1NYFA 3M54A 1BCOA 1VYUA 1W2BS 4PJOB 1VQ6A 1K0SA 2F69A 4ESRA 1S72T 3OYYA 1WX6A 3CCLQ 1VQOQ 4M75A 1UUEA 4M78F 2LQWA 5GAMg 3Q1JA 2RQTA 3I55A 1RUWA 3E1SA 4A4EA 2O2OA 3C95A 3LW5E 1BCMA 2NYSA 3MP8A 2M51A 1NEBA 2PNIA 3OYMA 4PKCC 3G4SQ 5KYXA 2XDDA 2VV5A 4E7JA 2QTVA 3L1AA 1XTDA 3M0TA 2QQRA 2WSFE 1B34B 4M7AE 1T3LA 2QDYB 2LX7A 2GNCA 2K3YA 1VQ8Q 1VQ6Q 3QWXX 1AWJA 1ZSZC 2YXYA 2KYBA 3EG2A 4JRQA 1E7OA 2KT8A 2CDTA 3T9NA 4R55A 2LQKA 4PJLA 3A5ZB 3JSCA 1TU0B 2DRMA 1QVFA 1VQNQ 1H92A 2P4RA 2JS2A 3G6ET 3S3OA 2KROA 2CZ7B 3VV0A 1O75A 2L8DA 1T0HA 1T3SA 4ZTFA 3M58A 3SHWA 3VS3A 1IB8A 2F2VA 4FM4B 2DF6A 3CCMA 1IREB 2FZCB 3V7CA 3PVQA 3LLRA 5LJ5g 2XDBA 4C5IA 4KH0B 1ARKA 1S72A 2HL3A 2V8IA 2JJ9A 3G71T 1BI0A 4JLIA 1NYGA 2E4HA 2NUTA 3NMZC 3CMET 4AMCA 5J26A 4M7AA 4NL2A 1G3WA 2ED0A 3M4YA 1NJIU 2KAFA 2YHTA 1WQ7A 1K9AA 3OW2S 1G5VA 1D09B 4RTVA 1D3BB 1QCNA 2MK5A 4RTZA 2X4XA 1Z9ZA 3NPFA 2XICA 2QASA 3CPWA 1GFDA 1M2VA 2YUNA 3EHRA 3RKWA 5C0MA 2RHZA 4C92D 1UDLA 3ZBDA 4F04B 2EKOA 1ZA1B 3CCMQ 4J9DA 4IUUA 1IGQA 1YJNA 4X34A 1IHWA 3CCRA 1J3TA 1LNXA 2WSCE 1YHQT 1X6GA 4ZN1A 1KD1C 1M3BA 2E6ZA 1RAGB 3V8JA 4DBRA 2RK2A 3OYAA 2E41A 2YRDA 2XHCA 1YWOA 3AHUA 5GAN8 5IHIA 2EQIA 3CMAT 5LJ5e 5HCKA 2NUPA 4M75D 3RMSA 3TVTA 2HSPA 2HKQB 3CC7T 2CP5A 1JO8A 3SB2A 1UGRB 3I35A 2LZ6B 2OTLA 3CEYA 1JXOA 2RB6A 4M7AF 4C92C 2YUQA 1WHHA 2YDLA 5GAN4 1Y96B 2YRCA 1YJNT 3VS2A 1VIEA 3GIBA 4L6V5 1WJQA 1M27C 2MMPA 1K73C 2NUTB 1TH7A 1WJRA 2A0FB 2X3WD 3MPUB 2XIDA 2ATCB 2QI2A 2XG8D 2X9HA 3OYHA 2EJ9A 3DLLA 4LE9A 2CT3A 5AYFA 2LCCA 4F7UF 5CK9A 3OQ5A 3GPLA 2QQAA 2EAYA 5DM7R 3OYFA 1VQKA 3R6NA 5DY9A 3JCMQ 3JCMP 5GAMf 5KYYB 3NTKA 3QDRB 2EYWA 1WHGA 2JMCA 1VQ5T 1AT1B 1RAHB 1R8OB 1YITA 5GMKm 4IKFA 2E1HA 5L8RE 1QP3A 2OTJA 5FU7C 1YI2A 3PIOA 2RQVA 1JEGA 2JXBA 1N5ZA 5DLOA 3EGDB 2F1LA 4J83A 1QVPA 4KGVB 1E6GA 3I56A 2DD4A 4M7DC 2EWNA 4OVAA 2EIFA 1MMNA 2M02A 3NTIA 3KBGA 2LRQA 1NLOC 2JVVA 2EQMA 4XU1A 1YJ9Q 4C0FA 1VQ8A 4JJDA 2JT4A 1S72Q 1OPLA 2E3IA 3HRUA 3HL8A 4J9GA 5CO7A 1X43A 4BI4A 3LGFA 1Q86C 2YWWA 1M1KU 1PRLC 4EMGA 3H0IA 1X2KA 1WIEA 1PKSA 3M53A 1Y0MA 4M78G 3RESA 4E2FB 2LJ0A 1SPKA 2YUOA 2CREA 2VASA 4QT7A 1TOVA 4PJOC 4RKUE 1CKAA 4IIMA 1PSFA 4ELYC 1PRMC 4ME7A 5IXBA 3JCMh 1H641 4FYVB 4LDXA 1ZLMA 1KIKA 1G3TA 1K4US 4E7ZA 2OJ2A 2EYYA 3BE3A 4DBHA 2F5TX 2AZVA 4B9WA 4C92E 2FYKA 3QYHB 1K9MU 1X2QA 4CC2A 3M0QA 1Y07A 4MDXA 3SEMA 2RA2A 2AKLA 1KC8U 4MZPA 2DRKA 1OX9A 2KSSA 1OU9A 2LCSA 1WHMA 5FRMA 3E2UA 3PNWC 3VS6A 2L3QA 4E7KA 3QIIA 1MMGA 2DL7A 1JU5C 2GFUA 4J9BA 1ZUUA 3EG1A 2DVEA 1GFCA 5HKCA 3CCVA 1AEYA 4BB7A 2MYSA 2LC4A 2XMFA 3E9FA 4M7DD 4QQGA 2LT1A 2KNBB 5LJ5j 2K7AA 1PSEA 4OB2B 1RAFB 3RUXA 2DETA 4L5GA 3P8DA 3OYIA 3TQ7P 2MWPA 4PJOF 3EH1A 1PCXA 2FL7A 2RHYA 2V1QA 1Q81R 1FYNA 5GANd 3QDFA 4M7AB 2DL3A 2RQRA 1TUDA 2KXDA 4KRTA 5IH2A 2WACA 4J9CA 5I22A 3HSBA 1VQ8T 3CCQQ 4C8QD 2KBTA 2H3JA 3JCMW 4O5VA 3O5ZA 4XQ3A 2Y4XA 2QEXA 3OYCA 2V8JA 4J9IA 3EGXB 3CCJQ 3VS1A 2DTOA 5A0GA 4TVRA 2XU8A 4C92F 2X3XD 1HYOA 5KE2A 1M90U 1UGSB 1XOVA 3CBPA 4J7FA 2QXFA 1TWBA 5GANj 2VUBA 1WJSA 2KE9A 4BACA 1HSQA 2P0QA 4FT2A 1VQPA 1KQ2A 1V1CA 2JM8A 3ER0A 2GQIA 1YCSB 1VQLA 1RACB 1RI0A 3CPWP 1VQLT 2RHXA 2C0IA 3OA6A 1VQKQ 1KQSA 2JS0A 1YP5A 3JB9H 1WFWA 2NWMA 2V8KA 5D6XA 1YJ9A 5GANe 3CMEA 4IIOA 3VS5A 3FRNA 4FSXA 4RTUA 1VA7A 3PGGA 4M7AC 3LGLA 2OTJQ 2DL5A 2F2WA 5LJ3e 3UA7A 1QVFP 2J05A 5KE3A 4C8QE 5GAN7 2HDAA 5GAOp 5A0DA 1K9MC 4JZ3A 4GLKA 2A08A 4DBFA 1I8FA 1X6OA 4Z8AA 3I9QA 1ZSGA 1ZUYA 3I56T 4AFQC 5GAOm 4NOYA 2E12A 3PMIA 1O9SA 1N27A 3J81E 1AWOA 2A3LA 4IUQA 4AG2C 3OS1A 3EAEA 1LCKA 2GCXA 3L2VA 2RM4A 2VC8A 1IO6A 1KC8R 4KGXB 5CQYA 1KSWA 2J06A 3JAME 2DD5A 2DPPB 4M7DG 1VQ4Q 3X28B 3QJ6A 1YJWA 4R0KA 1U1TA 1H3HA 3THKA 1ZSZB 4HKEA 1UGVA 2DJQA 4FT4A 4R56A 3CC7Q 2EJFA 3D7SB 4RG8A 5CAIA 3FDRA 4CRIA 3RMQA 1RLQC 2DL8A 3CC4A 3G71Q 3QWYA 4HCZA 1Q7YR 1JJ2S 4Z89A 2D0NA 5D7UA 5CQXA 2RF0A 1WXUA 3KXTA 3GOXA 4WTOB 1GXIE 2RNAA 2E70A 1D0XA 2VVKA 4QQ6A 1K1ZA 2QDLA 5KH6A 5GJVB 2JTMA 4FU6A 1OZ3A 4M77A 1G3SA 4LDYA 1JJ2P 3QO3A 2DTHA 2KGTA 1B07A 2JTFA 1TS9A 3CCUQ 3EG3A 1KJWA 1QCFA 2HQEA 1D1AA 3CXCA 4ZNXA 4RCBA 5A2QE 4B9XA 3BFMA 3FJPA 2NUPB 4FW1A 3BW1A 1CKBA 1WPYA 1VQOA 1G8XA 2LJ3A 2EYXA 3PMTA 5CKBA 2CT4A 2EVRA 1NZ9A 1VQ6T 1F1BB 1ZBJA 2DERA 4EMKC 4FYWB 2E5KA 3OBWA 5KYWA 2LVMA 2XDPA 2EGEA 2DEUA 5KYYA 1AHJB 2BZXA 1JJ2A 2JZ2A 2RJFA 3LX7A 3C0CA 2HQXA 1Y57A 5LL6S 2CSQA 2RHIA 1VQMQ 2GGRA 4FIBA 4DOWA 4JS4A 4ZGEB 4XAXB 1BU1A 2KYMA 3X24B 4PJJA 2COYA 3GNFB 5GAOr 3INZA 2DE0X 1Q81C 3VYGA 3QUIA 3C4SA 3JCMd 3TEEA 5IT9E 5KCHA 3CMEQ 3H0FA 2CSIA 2JOYA 4BI3A 1AVZC 2X51A 1BIBA 1WHLA 3LYIA 1VQLQ 1CSKA 5GMKe 1UFFA 1VIFA 1OEBA 2K9GA 3H0HA 1WDXA 1K8AR 2EPDA 4M77F 1WLPB 1AZEA 3EHQA 3OYGA 1Q82R 3LWHA 3CCRT 2CP3A 4Z02A 2X4YA 2CZ0B 5C6SA 1K8AC 2HZYA 2MF2A 4MZTA 3CXCP 1MNEA 4M77D 2DXTA 1VQNT 2DIGA 1C6VX 1UTIA 4CC7A 1VQNA 2LP5A 4PJOA 3EFRA 2K3BA 2K5FA 3VS7A 1NPPA 1N9RA 1OZ2A 1YWPA 3QKJA 2QAZA 3KFVA 4BDZA 4C92B 5LJ3h 1LJOA 2ENMA 3CMAQ 4AT1B 2EJGA 4M7AG 1I07A 2BIVA 4RTYA 2SRCA 2JN0A 5GANh 1Q81U 3CPFA 3SWNA 3JB9I 2EQUA 4FSSA 2OAWA 3JCMb 2RJCA 3CCLT 1SRLA 4J6WA 3ZEHA 4X9DA 5CKDA 1GBRA 2KRNA 4A4GA 1RAEB 3EG0A 4RUGA 2VWFA 4A4HA 3CC4Q 4OMQA 3U23A 3UDCA 3V8LA 4ZN3A 4M78B 2KMTA 2CP6A 2AK5A 2H3EB 5LJ3f 5M9OA 2I0NA 2I2LA 7AT1B 1RL2A 2A37A 1X01A 4PJMA 2RPNA 1K9MR 4HCKA 4LNPA 2EQJA 4M77E 2F5KA 5GAOl 4JRPA 4F7UG 2K5LA 1W6XA 1VQMT 2P84A 1NJIR 2M1HA 4RTWA 4BUGA 4LDVA 1VQPT 3A8HB 2ZPHB 2FG0A 2KQWA 2LQ8A 3PTAA 4IUPA 2JM9A 1QWEA 3G71A 3DKMA 1UG1A 5GMKj 3G4SA 1MHNA 1YCYA 2O88A 4C8QF 1GCQC 4D8KA 1OU8A 5IHNA 2IVWA 3EH2A 1IHVA 3VUBA 1ZHIA 1SHFA 1V76A 2LNHB 1M2VB 3JB9J 1ZA2B 4Z88A 4F14A 4MZMA 2QQBA 2JTEA 3VYHB 3VKIA 3CCET 4AFZC 3UATA 2FO0A 4PFOA 2VXFA 2DXUA 2E64A 3OW2A 4YTLA 3CCVQ 3R6OA 4Y91A 2KY9A 2D6FA 3CCQT 5GAMe 3H8ZA 4M77B 3FC3A 2K57A 2QGGA 3UF4A 1XJWB 1W2BA 1D1CA 2O9VA 4BDYA 2B8AA 1GCQA 2RMOA 1KQ1A 2QA4T 3NHNA 3JB9F 2DZ9A 4X9CA 3BDUA 4M75E 5LJ5d 1FX7A 4F7UA 1N8RU 1TXQA 3WVEB 5KCOA 4C92G 3OYEA 2YLBA 3X26B 3OS5A 3X25B 3I5RA 4E6RA 3OS0A 1E6HA 4C5HA 4EMKB 4F16A 5LJ3g 1NPRA 3OS2A 4HCCA 1U8RA 1PD0A 2E5QA 3CXCS 2DK3A 4IURA 1WHKA 5I21A 4RTXA 4OMLA 3I55Q 4GLMA 2RK1A 3NTHA 3CCMT 4X1VA 4LUEA 2J6OA 2L5QA 1R0BG 2HMAA 4EDUA 3EFSA 1M8MA 5D6YA 1TUCA 2E65A 4JJNK 5AT1B 2LNVA 4BI8B 4XK8E 1I5LA 2K6DA 3UT1A 2ZCFB 4J5YA 1TTHB 2OI3A 3M57A 5KYWB 3G6EA 3MKDA 1GL5A 1JXMA 1LPLA 1VQ5A 4QQDA 5CR2A 1VQ7Q 2RI5A 1G83A 4JZ4A 2A7YA 2G3RA 3WXMB 1PG5B 2E10A 3TU4K 2L2PA 3UPUA 1U5SA 4XTYA 1Q95G 4JPBW 4KT0E 5FU6B 4OB0B 3P8BB 3A8LB 3META 1QMCA 4JLGA 1N8RR 2DEQA 1X6BA 2KXCA 2MPXC 2R57A 1VQOT 3CC2T 1LOJA 2EYZA 1RAAB 2GF7A 2DO3A 3RBBB 1U06A 2LDMA 5I11A 3OYDA 5CKFA 1D0ZA 1VQ7T 2XKOC 1AWXA 3MJXA 2JNGA 4N4IA 1UB4A 4XTVA 2KK4A 4ATOA 2JW4A 5GAN6 3HFNA 1VQ5Q 3X20B 2KI7A 2K4YA 4A53A 3J7AF 2RD1A 2C0OA 4XU3A 3UA6A 3QPHA 4C0DB 5CIUA 4FL6A 5GJWB 4F7UE 2EBPA 3MEAA 4HVVA 2DM1A 2KVQG 2CGHA 2K2MA 1JQQA 1RADB 2YUPA 4GY5A 4M75C 1OI1A 1FXXA 3F70A 1AD5A 2GTOA 2FHDA 3V7SA 4OMFB 3CCST 3MEVA 4C92A 4J8OA 3OB9A 3QG1A 1ZUKA 4GBQA 1VOMA 3MHXA 4PJNA 5IN1A 4QVCA 4MMKA 3REBB 4DQ2A 4M7DF 3P8HA 5GANg 2VYTA 1UHFA 3I56Q 4PFPA 2VXEA 2WSEE 1PNJA 2BE7D 1BI2A 3G7ZA 3JCMg 2G6FX 1NBEB 3A8MB 2EGCA 4HVUA 5IXFA 1VQPQ 3DLMA 2W0ZA 2D1XA 2A28A 1UE9A 1I4K1 4C5EA 4MMLA 3GBQA 2X35A 4RMOA 4MDWA 2FB7A 4CI0C 2RO0A 1V29B 1WZOA 4HVWA 1XNIA 3CC2A 5ECAA 2D8HA 3SFMA 1OV3A 4Y28E 3L2ZA 4XU2A 3MCAB 3PIPA 2QA4A 1KQSS 1TUGB 1YIJQ 3QSUA 1BKBA 2YSQA 3JCMV 2Z0WA 3VUZA 2MWOA 5DLQE 5GAMj 4XTUA 3JCMe 2HEQA 2DILA 1U1SA 3RNJA 2E6NA 4LDWA 2F2XA 3MO8A 4K11A 2R5MA 2QEXT 1VQ9A 3M0PA 3GF5A 2DYBA 2J6KA 1MMAA 5IAYA 2ABLA 4VUBA 5J39A 1HJDA 1QVFS 3G1JA 1B7TA 1QLYA 6AT1B 4PK4A 2YLCA 1Y71A 2DZCA 1IZ6A 3H41A 1SRMA 3JCMX 1K73R 2Y90A 2PVGB 4PL6A 2M0YA 4CC3A 1RABB 4E7HA 2DXCA 2O01E 4WF2A 2K5IA 2LMJA 2GQVA 2FZGB 2RJEA 5GAOn 2C06A 1VQ4A 4M78A 4KUIA 3S3NA 3V8KA 3EFOB 3HP9A 2HAXA 4ZGJB 1PD1A 2HSEB 3CBOA 2RQWA 1S1NA 1JRIA 3REAB 4L59A 4M75F 2CUBA 2PVDB 3C94A 3RIRA 5GAN5 1H3ZA 5GANf 3G6EQ 4DBQA 4M78E 3SWNC 1JBMA 1UJ0A 3QJYA 1VQ9Q 4PFZA 4CC4B 1M2OA 3S6WA 2CH4A 2QK0A 4LDUA 2H8HA 3A8OB 4E7IA 1M1FA 1ZBXA 2DKGA 1Q82C 3GLXA 2DIQA 4HT8A 1KD1R 2DAQA 3URGA 5J3BA 2NUZA 4RTTA 2J7IA 4E47A 1UJYA 3HKSA 2RN8A 2ZPBB 2ROTA 2K79A 4OMOA 3MEWA 1N9SA 1ABOA 3ME9A 4RG2A 4LN2A 2QYZA 3CCUA 1M1KR 2RHUA 1ACMB 1GBQA 1Y7XA 1KQSP 1SEMA 2JUFA 3G4ST 4EIKA 2V1RA 4BE0A 2AHJB 1K0XA 2PVOB 4QKUA 4QW2A 5CKHA 2EKHA 1W1FA 2DNUA 4A54A 3C12A 2ECZA 3L2RA 4OMMA 4BY6B 4C0ZA 1PKTA 3FEOA 1YBYA 4OGCA 2ZPFB 2O4XB 4PLLA 2XI9A 3JRZA 3M0RA 3FB9A 3M0UA 4HXJA 1BK2A 1H8KA 1FMVA 3JB9G 4ORZA 2OAUA 4OP0A 3FLGA 3FIFA 3VRZA 1EX4A 1QWFA 1XQHA 5A0LA 4M7DE 3EGXA 4AFSC 5HK0A 2PU9B 1GCPA 1ZSZA 2FPDA 3M4GA 4QVZA 3OYNA 1M30A 2PQWA 2LX9A 2HD0A 2BTTA 2D9TA 2OTLQ 1ZQ1A 2BKDN 3BDLA 4LXCA 2FRWA 2ED1A 2FZKB 4D8DA 3A98A 4A63B 4Y92A 3CD6T 2BUDA 4JUVA 4M4ZA 2P4TA 1Q7YU 1QVGA 2D0QB 2BZ8A 1M90R 1BYMA 3CCQA 2EFIA 1BIAA 1SSFA 1TG0A 1M4ZA 5GAMd 2LT4A 1HK9A 3HFOA 1RI9A 1Z9QA 2LQNA 2CZ1B 4C0DC 5KYNA 4NS5A 4A4FA 2IIMA 5HK3A 4OB1B 3A1PA 4M77C 1QQJA 1P92A 2HCKA 5GAN3 3V7RA 1PHTA 1M90C 3A8GB 3M56A 2HBWA 4C5GA 2AT1B 1AOJA 2L89A 3L2QA 4JS5A 2NLUA 4N4GA 3CD6Q 2QG9B 4EMHA 1YN8A 2CS7A 2QTXA 2M16A 1G3YA 1FMWA 3LWIA 2GTJA 2DJZA 3QZ5B 4P5NA 1FMKA 3VRYA 1NEGA 1C0MA 2KDSA 5LJ5f 3NFCA 2MIOA 3CCRQ 4PNOA 2M9UA 3OSVA 5I2MA 5FWBA 3S3MA 1I5OB 1C1AA 4IUTA 4B6MA 2VGNA 1EFNA 1WXBA 5GMKh 3HHTB 1LVKA 4V2SA 2DMOA 3HPWA 4UC4A 4C8QC 3LH5A 2FRYA 4J6XA 2KR3A 1YHQA 4J9EA 2GFAA 1NM7A 4OMNA 1W2BP 5I2SA 3OW2P 1RLPC 1BI3A 3I55T 2IPOB 3HRTA 3I5SA 3IQLA 2DXBA 2J6FA 4DEYA 1B3QA 3M0SA 1X69A 2RJDA 1R77A 4DA4A 1ABQA 3EGUA 1VUBA 5FW9A 2DTIA 2X4JA 2X4WA 2GBQA 5GMKi 1N6AA 3PT9A 1KK7A 1GRIA 3OYBA 2OX7A 4M77G 3CCJT 2LJ1A 4M75B 5EC7A 4J9HA 4KGZB 4RCCA 4QVDA 2COZA 2EQKA 3CBMA 4LD6A 1NJIC 2QGFB 4J9FA 3PFSA 1YITQ 1KHIA 3PVLA 1JB0E 2A36A 3CD6A 1PWTA 4N0AC 5LJ3j 2QA4Q 2RH2A 1M1KC 2KT1A 4JRKA 1PC0A 2CP7A 4FYYB 3EFOA 3RKYA 1YJ9T 2PZ1A 4BE1A 3CC7A 1SHGA 4A4KA 5GMKl 2EGAA 4II1A 2VKNA 1Y96A 4N0AA 1SF9A 4HA8A 2VB6A 2DLPA 3SDZA 1YJWQ 4O6JA 2CZ6B 1AWWA 3DB4A 2BE9B 8AT1B 1FWZA 1Q82U 2ZPGB 1PM3A 3CC4T 4J6YA 4BE2A 1UGPB 3CCSQ 4E7LA 5CCAA 3VS4A 4FCYA 3TCJA 1VQ4T 2O31A 2LCLA 3MP1A 4M7AD 2KRSA 5CVIA 1M9SA 4FW2A 3RKXA 2PTKA 3H9NA 4ANJA 3VJPA 1YJWT 5LJ5h 3KUFA 4JJBA 3CCEA 3CCVT
chains in the Genus database with same CATH topology
1VQNQ 1Q81R 1Q7YR 3G6EQ 1VQ7Q 1VQLQ 3CCJQ 1VQ5Q 3CD6Q 1VQ9Q 3CCUQ 1VQPQ 3CCEQ 1VQ8Q 1K8AR 1QVGP 1K9MR 1YI2Q 1VQ6Q 3CPWP 3CCVQ 1M1KR 1YJ9Q 1YJNQ 3G71Q 1Q82R 1VQKQ 1M90R 2OTJQ 3CCLQ 1YIJQ 3CMEQ 1VQMQ 1VQOQ 3G4SQ 1S72Q 1YITQ 1K73R 1KQSP 1KD1R 1YJWQ 3CCQQ 3CC7Q 1VQ4Q 1QVFP 3CC4Q 1NJIR 3CC2Q 1KC8R 2OTLQ 2QEXQ 1W2BP 1N8RR 1JJ2P 2QA4Q 3CMAQ 1Q86R 3I55Q 3OW2P 1YHQQ 3CCMQ 3I56Q 3CXCP 3CCRQ 3CCSQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQN Q;  1Q81 R;  1Q7Y R;  3G6E Q;  1VQ7 Q;  1VQL Q;  3CCJ Q;  1VQ5 Q;  3CD6 Q;  1VQ9 Q;  3CCU Q;  1VQP Q;  3CCE Q;  1VQ8 Q;  1K8A R;  1QVG P;  1K9M R;  1YI2 Q;  1VQ6 Q;  3CPW P;  3CCV Q;  1M1K R;  1YJ9 Q;  1YJN Q;  3G71 Q;  1Q82 R;  1VQK Q;  1M90 R;  2OTJ Q;  3CCL Q;  1YIJ Q;  3CME Q;  1VQM Q;  1VQO Q;  3G4S Q;  1S72 Q;  1YIT Q;  1K73 R;  1KQS P;  1KD1 R;  1YJW Q;  3CCQ Q;  3CC7 Q;  1VQ4 Q;  1QVF P;  3CC4 Q;  1NJI R;  3CC2 Q;  1KC8 R;  2OTL Q;  2QEX Q;  1W2B P;  1N8R R;  1JJ2 P;  2QA4 Q;  3CMA Q;  1Q86 R;  3I55 Q;  3OW2 P;  1YHQ Q;  3CCM Q;  3I56 Q;  3CXC P;  3CCR Q;  3CCS Q; 
#chains in the Genus database with same CATH topology
 3OBY A;  3OMG A;  3HTR A;  4DEX A;  2DA9 A;  1M5Q 1;  1MGQ A;  1WQW A;  2JMA A;  3EG9 B;  4C0G A;  3VS0 A;  1QKW A;  1MV0 B;  1AZG B;  4F7U B;  1G2B A;  3O8V A;  3CPW S;  1K73 U;  2KRM A;  3RR6 A;  3FJ5 A;  3RDV A;  4PJO D;  2DBK A;  2OTJ T;  5CKE A;  1X27 A;  2RI3 A;  1U3O A;  3M59 A;  2DYI A;  2MCN A;  5FLX E;  4DOV A;  3ZL7 C;  2RI2 A;  1IXD A;  3JCM J;  4PJO G;  2RQU A;  3M55 A;  4KBM B;  2EW3 A;  3L2U A;  5GAN 2;  3MP6 A;  2CP0 A;  1YHQ Q;  2LTO A;  1M3A A;  1KG1 A;  1MUZ A;  1SKU B;  1DJ7 B;  3E9G A;  1QVG P;  2BZY A;  2QQ9 A;  3OY9 A;  1QP2 A;  2CH4 W;  3VU3 C;  2CYZ B;  5FRO A;  2DX1 A;  2VGM A;  1IRX A;  1NE8 A;  1I1J A;  1OPK A;  1Q86 R;  2COW A;  2L3S A;  2CP2 A;  2L0A A;  1WGS A;  5KYX B;  3CCU T;  4OB3 B;  5IHK A;  4KUD K;  3QHS A;  2W10 A;  4XTW A;  3OMC A;  1SSH A;  2EYQ A;  4IUV A;  1WHJ A;  2R5A A;  2DFU A;  1VYT A;  1ZX6 A;  2ROL A;  2L3R A;  3CCL A;  5HY6 A;  2ZPI B;  1HD3 A;  2AKK A;  3QBY A;  4M75 G;  1BI1 A;  1QCO A;  2IG0 A;  8ATC B;  5LJ3 d;  1Q86 U;  1WXT A;  3QZ9 B;  1NLP C;  1RAI B;  4BY6 C;  1QVG S;  1KD1 U;  4NL3 A;  2XK0 A;  2YRV A;  3QYG B;  1OQK A;  3CMA A;  4D6W A;  1WNL A;  1YIT T;  4OGE A;  3GP8 A;  1QW1 A;  4HT9 A;  3AT1 B;  4C8Q B;  1UGQ B;  5FU6 C;  3OYL A;  2QEX Q;  1MMD A;  4OF1 A;  2SEM A;  2KEA A;  3EG9 A;  1YI2 T;  2O4X A;  1YNZ A;  2ZGW A;  1K76 A;  4ELZ C;  2HNI A;  1IGU A;  4OMP A;  4XU0 A;  1UEC A;  3TSZ A;  3ZFJ A;  3N5B B;  4KH1 B;  3WVD B;  4KUL A;  3TSW A;  2HL5 C;  4M7D A;  1M8V A;  5FU7 B;  1QKX A;  2PUK B;  2CUD A;  1VYV A;  2P0K A;  1WI7 A;  3JCM f;  2AZS A;  1OYX A;  4E7S A;  2B86 A;  2HKN A;  4AG1 C;  3OYK A;  3SWN B;  4JRI A;  3CCE Q;  4F17 A;  4EPC A;  1N8R C;  2ZAE A;  3NGP A;  4C8Q G;  4HCB A;  3UWN A;  3M5A A;  1BB9 A;  3SD4 A;  3QXE B;  1OUL A;  1YIJ A;  2Y4Y A;  3ASK A;  2AIR B;  1YIJ T;  2K3X A;  2V26 A;  3PE0 A;  3JB9 D;  1T0J A;  1I81 A;  3CCS A;  1KHC A;  2HQH A;  4BD3 A;  1D3B A;  2FEI A;  2CKK A;  5FWC A;  3BY7 A;  1Q7Y C;  1A0N B;  1HXD A;  1M1G A;  1R0C B;  5EG2 A;  3CC2 Q;  4WCI A;  2ZPE B;  3H6Z A;  4JJC A;  1VQ9 T;  1VQK T;  4FYX B;  1M3C A;  2DBM A;  3DB3 A;  4LUD A;  3TRE A;  2DVJ A;  5KYU B;  1YI2 Q;  2M0O A;  4PLI A;  1MV3 A;  3E19 A;  1MND A;  1UHC A;  1I0C A;  4ZGD B;  1KC8 C;  5FRN A;  4N4H A;  9ATC B;  3OYJ A;  1W4S A;  4M78 C;  2MI6 A;  1TSF A;  2C0T A;  2L3P A;  1UEB A;  4XTZ A;  4JDS A;  5KYU A;  4LD9 K;  3CCJ A;  2K2V A;  4M7D B;  2R58 A;  3ULR B;  5L23 A;  2DL4 A;  2MAM A;  2FPF A;  4C8Q A;  5GAM h;  4J7I A;  2D8J A;  2PUO B;  2YT6 A;  1K8A U;  4AFU C;  3L2W A;  1B34 A;  2O9S A;  1SG5 A;  2FPE A;  5GAO q;  1BBZ A;  3JV3 A;  1EZZ B;  1OX8 A;  4PJO E;  1OOT A;  1D0Y A;  2QQS A;  1X75 C;  3RER A;  3M9Q A;  2XD0 A;  2ESW A;  3LH0 A;  2E3H A;  4XTX A;  1EIF A;  4ZTJ A;  3EGD A;  1NG2 A;  2OTL T;  1YJN Q;  1YFN A;  2ZZD A;  3HRS A;  1KFZ A;  2MOX A;  3JCM c;  1WYX A;  5D6W A;  3CQT A;  3MEU A;  2FVU A;  4M78 D;  1VQM A;  2P0P A;  2HBP A;  1D1B A;  1W70 A;  3L42 A;  4Q5W A;  3GNG A;  4EMK A;  1VQ7 A;  3J80 E;  1WA7 A;  3OSS C;  1NYF A;  3M54 A;  1BCO A;  1VYU A;  1W2B S;  4PJO B;  1VQ6 A;  1K0S A;  2F69 A;  4ESR A;  1S72 T;  3OYY A;  1WX6 A;  3CCL Q;  1VQO Q;  4M75 A;  1UUE A;  4M78 F;  2LQW A;  5GAM g;  3Q1J A;  2RQT A;  3I55 A;  1RUW A;  3E1S A;  4A4E A;  2O2O A;  3C95 A;  3LW5 E;  1BCM A;  2NYS A;  3MP8 A;  2M51 A;  1NEB A;  2PNI A;  3OYM A;  4PKC C;  3G4S Q;  5KYX A;  2XDD A;  2VV5 A;  4E7J A;  2QTV A;  3L1A A;  1XTD A;  3M0T A;  2QQR A;  2WSF E;  1B34 B;  4M7A E;  1T3L A;  2QDY B;  2LX7 A;  2GNC A;  2K3Y A;  1VQ8 Q;  1VQ6 Q;  3QWX X;  1AWJ A;  1ZSZ C;  2YXY A;  2KYB A;  3EG2 A;  4JRQ A;  1E7O A;  2KT8 A;  2CDT A;  3T9N A;  4R55 A;  2LQK A;  4PJL A;  3A5Z B;  3JSC A;  1TU0 B;  2DRM A;  1QVF A;  1VQN Q;  1H92 A;  2P4R A;  2JS2 A;  3G6E T;  3S3O A;  2KRO A;  2CZ7 B;  3VV0 A;  1O75 A;  2L8D A;  1T0H A;  1T3S A;  4ZTF A;  3M58 A;  3SHW A;  3VS3 A;  1IB8 A;  2F2V A;  4FM4 B;  2DF6 A;  3CCM A;  1IRE B;  2FZC B;  3V7C A;  3PVQ A;  3LLR A;  5LJ5 g;  2XDB A;  4C5I A;  4KH0 B;  1ARK A;  1S72 A;  2HL3 A;  2V8I A;  2JJ9 A;  3G71 T;  1BI0 A;  4JLI A;  1NYG A;  2E4H A;  2NUT A;  3NMZ C;  3CME T;  4AMC A;  5J26 A;  4M7A A;  4NL2 A;  1G3W A;  2ED0 A;  3M4Y A;  1NJI U;  2KAF A;  2YHT A;  1WQ7 A;  1K9A A;  3OW2 S;  1G5V A;  1D09 B;  4RTV A;  1D3B B;  1QCN A;  2MK5 A;  4RTZ A;  2X4X A;  1Z9Z A;  3NPF A;  2XIC A;  2QAS A;  3CPW A;  1GFD A;  1M2V A;  2YUN A;  3EHR A;  3RKW A;  5C0M A;  2RHZ A;  4C92 D;  1UDL A;  3ZBD A;  4F04 B;  2EKO A;  1ZA1 B;  3CCM Q;  4J9D A;  4IUU A;  1IGQ A;  1YJN A;  4X34 A;  1IHW A;  3CCR A;  1J3T A;  1LNX A;  2WSC E;  1YHQ T;  1X6G A;  4ZN1 A;  1KD1 C;  1M3B A;  2E6Z A;  1RAG B;  3V8J A;  4DBR A;  2RK2 A;  3OYA A;  2E41 A;  2YRD A;  2XHC A;  1YWO A;  3AHU A;  5GAN 8;  5IHI A;  2EQI A;  3CMA T;  5LJ5 e;  5HCK A;  2NUP A;  4M75 D;  3RMS A;  3TVT A;  2HSP A;  2HKQ B;  3CC7 T;  2CP5 A;  1JO8 A;  3SB2 A;  1UGR B;  3I35 A;  2LZ6 B;  2OTL A;  3CEY A;  1JXO A;  2RB6 A;  4M7A F;  4C92 C;  2YUQ A;  1WHH A;  2YDL A;  5GAN 4;  1Y96 B;  2YRC A;  1YJN T;  3VS2 A;  1VIE A;  3GIB A;  4L6V 5;  1WJQ A;  1M27 C;  2MMP A;  1K73 C;  2NUT B;  1TH7 A;  1WJR A;  2A0F B;  2X3W D;  3MPU B;  2XID A;  2ATC B;  2QI2 A;  2XG8 D;  2X9H A;  3OYH A;  2EJ9 A;  3DLL A;  4LE9 A;  2CT3 A;  5AYF A;  2LCC A;  4F7U F;  5CK9 A;  3OQ5 A;  3GPL A;  2QQA A;  2EAY A;  5DM7 R;  3OYF A;  1VQK A;  3R6N A;  5DY9 A;  3JCM Q;  3JCM P;  5GAM f;  5KYY B;  3NTK A;  3QDR B;  2EYW A;  1WHG A;  2JMC A;  1VQ5 T;  1AT1 B;  1RAH B;  1R8O B;  1YIT A;  5GMK m;  4IKF A;  2E1H A;  5L8R E;  1QP3 A;  2OTJ A;  5FU7 C;  1YI2 A;  3PIO A;  2RQV A;  1JEG A;  2JXB A;  1N5Z A;  5DLO A;  3EGD B;  2F1L A;  4J83 A;  1QVP A;  4KGV B;  1E6G A;  3I56 A;  2DD4 A;  4M7D C;  2EWN A;  4OVA A;  2EIF A;  1MMN A;  2M02 A;  3NTI A;  3KBG A;  2LRQ A;  1NLO C;  2JVV A;  2EQM A;  4XU1 A;  1YJ9 Q;  4C0F A;  1VQ8 A;  4JJD A;  2JT4 A;  1S72 Q;  1OPL A;  2E3I A;  3HRU A;  3HL8 A;  4J9G A;  5CO7 A;  1X43 A;  4BI4 A;  3LGF A;  1Q86 C;  2YWW A;  1M1K U;  1PRL C;  4EMG A;  3H0I A;  1X2K A;  1WIE A;  1PKS A;  3M53 A;  1Y0M A;  4M78 G;  3RES A;  4E2F B;  2LJ0 A;  1SPK A;  2YUO A;  2CRE A;  2VAS A;  4QT7 A;  1TOV A;  4PJO C;  4RKU E;  1CKA A;  4IIM A;  1PSF A;  4ELY C;  1PRM C;  4ME7 A;  5IXB A;  3JCM h;  1H64 1;  4FYV B;  4LDX A;  1ZLM A;  1KIK A;  1G3T A;  1K4U S;  4E7Z A;  2OJ2 A;  2EYY A;  3BE3 A;  4DBH A;  2F5T X;  2AZV A;  4B9W A;  4C92 E;  2FYK A;  3QYH B;  1K9M U;  1X2Q A;  4CC2 A;  3M0Q A;  1Y07 A;  4MDX A;  3SEM A;  2RA2 A;  2AKL A;  1KC8 U;  4MZP A;  2DRK A;  1OX9 A;  2KSS A;  1OU9 A;  2LCS A;  1WHM A;  5FRM A;  3E2U A;  3PNW C;  3VS6 A;  2L3Q A;  4E7K A;  3QII A;  1MMG A;  2DL7 A;  1JU5 C;  2GFU A;  4J9B A;  1ZUU A;  3EG1 A;  2DVE A;  1GFC A;  5HKC A;  3CCV A;  1AEY A;  4BB7 A;  2MYS A;  2LC4 A;  2XMF A;  3E9F A;  4M7D D;  4QQG A;  2LT1 A;  2KNB B;  5LJ5 j;  2K7A A;  1PSE A;  4OB2 B;  1RAF B;  3RUX A;  2DET A;  4L5G A;  3P8D A;  3OYI A;  3TQ7 P;  2MWP A;  4PJO F;  3EH1 A;  1PCX A;  2FL7 A;  2RHY A;  2V1Q A;  1Q81 R;  1FYN A;  5GAN d;  3QDF A;  4M7A B;  2DL3 A;  2RQR A;  1TUD A;  2KXD A;  4KRT A;  5IH2 A;  2WAC A;  4J9C A;  5I22 A;  3HSB A;  1VQ8 T;  3CCQ Q;  4C8Q D;  2KBT A;  2H3J A;  3JCM W;  4O5V A;  3O5Z A;  4XQ3 A;  2Y4X A;  2QEX A;  3OYC A;  2V8J A;  4J9I A;  3EGX B;  3CCJ Q;  3VS1 A;  2DTO A;  5A0G A;  4TVR A;  2XU8 A;  4C92 F;  2X3X D;  1HYO A;  5KE2 A;  1M90 U;  1UGS B;  1XOV A;  3CBP A;  4J7F A;  2QXF A;  1TWB A;  5GAN j;  2VUB A;  1WJS A;  2KE9 A;  4BAC A;  1HSQ A;  2P0Q A;  4FT2 A;  1VQP A;  1KQ2 A;  1V1C A;  2JM8 A;  3ER0 A;  2GQI A;  1YCS B;  1VQL A;  1RAC B;  1RI0 A;  3CPW P;  1VQL T;  2RHX A;  2C0I A;  3OA6 A;  1VQK Q;  1KQS A;  2JS0 A;  1YP5 A;  3JB9 H;  1WFW A;  2NWM A;  2V8K A;  5D6X A;  1YJ9 A;  5GAN e;  3CME A;  4IIO A;  3VS5 A;  3FRN A;  4FSX A;  4RTU A;  1VA7 A;  3PGG A;  4M7A C;  3LGL A;  2OTJ Q;  2DL5 A;  2F2W A;  5LJ3 e;  3UA7 A;  1QVF P;  2J05 A;  5KE3 A;  4C8Q E;  5GAN 7;  2HDA A;  5GAO p;  5A0D A;  1K9M C;  4JZ3 A;  4GLK A;  2A08 A;  4DBF A;  1I8F A;  1X6O A;  4Z8A A;  3I9Q A;  1ZSG A;  1ZUY A;  3I56 T;  4AFQ C;  5GAO m;  4NOY A;  2E12 A;  3PMI A;  1O9S A;  1N27 A;  3J81 E;  1AWO A;  2A3L A;  4IUQ A;  4AG2 C;  3OS1 A;  3EAE A;  1LCK A;  2GCX A;  3L2V A;  2RM4 A;  2VC8 A;  1IO6 A;  1KC8 R;  4KGX B;  5CQY A;  1KSW A;  2J06 A;  3JAM E;  2DD5 A;  2DPP B;  4M7D G;  1VQ4 Q;  3X28 B;  3QJ6 A;  1YJW A;  4R0K A;  1U1T A;  1H3H A;  3THK A;  1ZSZ B;  4HKE A;  1UGV A;  2DJQ A;  4FT4 A;  4R56 A;  3CC7 Q;  2EJF A;  3D7S B;  4RG8 A;  5CAI A;  3FDR A;  4CRI A;  3RMQ A;  1RLQ C;  2DL8 A;  3CC4 A;  3G71 Q;  3QWY A;  4HCZ A;  1Q7Y R;  1JJ2 S;  4Z89 A;  2D0N A;  5D7U A;  5CQX A;  2RF0 A;  1WXU A;  3KXT A;  3GOX A;  4WTO B;  1GXI E;  2RNA A;  2E70 A;  1D0X A;  2VVK A;  4QQ6 A;  1K1Z A;  2QDL A;  5KH6 A;  5GJV B;  2JTM A;  4FU6 A;  1OZ3 A;  4M77 A;  1G3S A;  4LDY A;  1JJ2 P;  3QO3 A;  2DTH A;  2KGT A;  1B07 A;  2JTF A;  1TS9 A;  3CCU Q;  3EG3 A;  1KJW A;  1QCF A;  2HQE A;  1D1A A;  3CXC A;  4ZNX A;  4RCB A;  5A2Q E;  4B9X A;  3BFM A;  3FJP A;  2NUP B;  4FW1 A;  3BW1 A;  1CKB A;  1WPY A;  1VQO A;  1G8X A;  2LJ3 A;  2EYX A;  3PMT A;  5CKB A;  2CT4 A;  2EVR A;  1NZ9 A;  1VQ6 T;  1F1B B;  1ZBJ A;  2DER A;  4EMK C;  4FYW B;  2E5K A;  3OBW A;  5KYW A;  2LVM A;  2XDP A;  2EGE A;  2DEU A;  5KYY A;  1AHJ B;  2BZX A;  1JJ2 A;  2JZ2 A;  2RJF A;  3LX7 A;  3C0C A;  2HQX A;  1Y57 A;  5LL6 S;  2CSQ A;  2RHI A;  1VQM Q;  2GGR A;  4FIB A;  4DOW A;  4JS4 A;  4ZGE B;  4XAX B;  1BU1 A;  2KYM A;  3X24 B;  4PJJ A;  2COY A;  3GNF B;  5GAO r;  3INZ A;  2DE0 X;  1Q81 C;  3VYG A;  3QUI A;  3C4S A;  3JCM d;  3TEE A;  5IT9 E;  5KCH A;  3CME Q;  3H0F A;  2CSI A;  2JOY A;  4BI3 A;  1AVZ C;  2X51 A;  1BIB A;  1WHL A;  3LYI A;  1VQL Q;  1CSK A;  5GMK e;  1UFF A;  1VIF A;  1OEB A;  2K9G A;  3H0H A;  1WDX A;  1K8A R;  2EPD A;  4M77 F;  1WLP B;  1AZE A;  3EHQ A;  3OYG A;  1Q82 R;  3LWH A;  3CCR T;  2CP3 A;  4Z02 A;  2X4Y A;  2CZ0 B;  5C6S A;  1K8A C;  2HZY A;  2MF2 A;  4MZT A;  3CXC P;  1MNE A;  4M77 D;  2DXT A;  1VQN T;  2DIG A;  1C6V X;  1UTI A;  4CC7 A;  1VQN A;  2LP5 A;  4PJO A;  3EFR A;  2K3B A;  2K5F A;  3VS7 A;  1NPP A;  1N9R A;  1OZ2 A;  1YWP A;  3QKJ A;  2QAZ A;  3KFV A;  4BDZ A;  4C92 B;  5LJ3 h;  1LJO A;  2ENM A;  3CMA Q;  4AT1 B;  2EJG A;  4M7A G;  1I07 A;  2BIV A;  4RTY A;  2SRC A;  2JN0 A;  5GAN h;  1Q81 U;  3CPF A;  3SWN A;  3JB9 I;  2EQU A;  4FSS A;  2OAW A;  3JCM b;  2RJC A;  3CCL T;  1SRL A;  4J6W A;  3ZEH A;  4X9D A;  5CKD A;  1GBR A;  2KRN A;  4A4G A;  1RAE B;  3EG0 A;  4RUG A;  2VWF A;  4A4H A;  3CC4 Q;  4OMQ A;  3U23 A;  3UDC A;  3V8L A;  4ZN3 A;  4M78 B;  2KMT A;  2CP6 A;  2AK5 A;  2H3E B;  5LJ3 f;  5M9O A;  2I0N A;  2I2L A;  7AT1 B;  1RL2 A;  2A37 A;  1X01 A;  4PJM A;  2RPN A;  1K9M R;  4HCK A;  4LNP A;  2EQJ A;  4M77 E;  2F5K A;  5GAO l;  4JRP A;  4F7U G;  2K5L A;  1W6X A;  1VQM T;  2P84 A;  1NJI R;  2M1H A;  4RTW A;  4BUG A;  4LDV A;  1VQP T;  3A8H B;  2ZPH B;  2FG0 A;  2KQW A;  2LQ8 A;  3PTA A;  4IUP A;  2JM9 A;  1QWE A;  3G71 A;  3DKM A;  1UG1 A;  5GMK j;  3G4S A;  1MHN A;  1YCY A;  2O88 A;  4C8Q F;  1GCQ C;  4D8K A;  1OU8 A;  5IHN A;  2IVW A;  3EH2 A;  1IHV A;  3VUB A;  1ZHI A;  1SHF A;  1V76 A;  2LNH B;  1M2V B;  3JB9 J;  1ZA2 B;  4Z88 A;  4F14 A;  4MZM A;  2QQB A;  2JTE A;  3VYH B;  3VKI A;  3CCE T;  4AFZ C;  3UAT A;  2FO0 A;  4PFO A;  2VXF A;  2DXU A;  2E64 A;  3OW2 A;  4YTL A;  3CCV Q;  3R6O A;  4Y91 A;  2KY9 A;  2D6F A;  3CCQ T;  5GAM e;  3H8Z A;  4M77 B;  3FC3 A;  2K57 A;  2QGG A;  3UF4 A;  1XJW B;  1W2B A;  1D1C A;  2O9V A;  4BDY A;  2B8A A;  1GCQ A;  2RMO A;  1KQ1 A;  2QA4 T;  3NHN A;  3JB9 F;  2DZ9 A;  4X9C A;  3BDU A;  4M75 E;  5LJ5 d;  1FX7 A;  4F7U A;  1N8R U;  1TXQ A;  3WVE B;  5KCO A;  4C92 G;  3OYE A;  2YLB A;  3X26 B;  3OS5 A;  3X25 B;  3I5R A;  4E6R A;  3OS0 A;  1E6H A;  4C5H A;  4EMK B;  4F16 A;  5LJ3 g;  1NPR A;  3OS2 A;  4HCC A;  1U8R A;  1PD0 A;  2E5Q A;  3CXC S;  2DK3 A;  4IUR A;  1WHK A;  5I21 A;  4RTX A;  4OML A;  3I55 Q;  4GLM A;  2RK1 A;  3NTH A;  3CCM T;  4X1V A;  4LUE A;  2J6O A;  2L5Q A;  1R0B G;  2HMA A;  4EDU A;  3EFS A;  1M8M A;  5D6Y A;  1TUC A;  2E65 A;  4JJN K;  5AT1 B;  2LNV A;  4BI8 B;  4XK8 E;  1I5L A;  2K6D A;  3UT1 A;  2ZCF B;  4J5Y A;  1TTH B;  2OI3 A;  3M57 A;  5KYW B;  3G6E A;  3MKD A;  1GL5 A;  1JXM A;  1LPL A;  1VQ5 A;  4QQD A;  5CR2 A;  1VQ7 Q;  2RI5 A;  1G83 A;  4JZ4 A;  2A7Y A;  2G3R A;  3WXM B;  1PG5 B;  2E10 A;  3TU4 K;  2L2P A;  3UPU A;  1U5S A;  4XTY A;  1Q95 G;  4JPB W;  4KT0 E;  5FU6 B;  4OB0 B;  3P8B B;  3A8L B;  3MET A;  1QMC A;  4JLG A;  1N8R R;  2DEQ A;  1X6B A;  2KXC A;  2MPX C;  2R57 A;  1VQO T;  3CC2 T;  1LOJ A;  2EYZ A;  1RAA B;  2GF7 A;  2DO3 A;  3RBB B;  1U06 A;  2LDM A;  5I11 A;  3OYD A;  5CKF A;  1D0Z A;  1VQ7 T;  2XKO C;  1AWX A;  3MJX A;  2JNG A;  4N4I A;  1UB4 A;  4XTV A;  2KK4 A;  4ATO A;  2JW4 A;  5GAN 6;  3HFN A;  1VQ5 Q;  3X20 B;  2KI7 A;  2K4Y A;  4A53 A;  3J7A F;  2RD1 A;  2C0O A;  4XU3 A;  3UA6 A;  3QPH A;  4C0D B;  5CIU A;  4FL6 A;  5GJW B;  4F7U E;  2EBP A;  3MEA A;  4HVV A;  2DM1 A;  2KVQ G;  2CGH A;  2K2M A;  1JQQ A;  1RAD B;  2YUP A;  4GY5 A;  4M75 C;  1OI1 A;  1FXX A;  3F70 A;  1AD5 A;  2GTO A;  2FHD A;  3V7S A;  4OMF B;  3CCS T;  3MEV A;  4C92 A;  4J8O A;  3OB9 A;  3QG1 A;  1ZUK A;  4GBQ A;  1VOM A;  3MHX A;  4PJN A;  5IN1 A;  4QVC A;  4MMK A;  3REB B;  4DQ2 A;  4M7D F;  3P8H A;  5GAN g;  2VYT A;  1UHF A;  3I56 Q;  4PFP A;  2VXE A;  2WSE E;  1PNJ A;  2BE7 D;  1BI2 A;  3G7Z A;  3JCM g;  2G6F X;  1NBE B;  3A8M B;  2EGC A;  4HVU A;  5IXF A;  1VQP Q;  3DLM A;  2W0Z A;  2D1X A;  2A28 A;  1UE9 A;  1I4K 1;  4C5E A;  4MML A;  3GBQ A;  2X35 A;  4RMO A;  4MDW A;  2FB7 A;  4CI0 C;  2RO0 A;  1V29 B;  1WZO A;  4HVW A;  1XNI A;  3CC2 A;  5ECA A;  2D8H A;  3SFM A;  1OV3 A;  4Y28 E;  3L2Z A;  4XU2 A;  3MCA B;  3PIP A;  2QA4 A;  1KQS S;  1TUG B;  1YIJ Q;  3QSU A;  1BKB A;  2YSQ A;  3JCM V;  2Z0W A;  3VUZ A;  2MWO A;  5DLQ E;  5GAM j;  4XTU A;  3JCM e;  2HEQ A;  2DIL A;  1U1S A;  3RNJ A;  2E6N A;  4LDW A;  2F2X A;  3MO8 A;  4K11 A;  2R5M A;  2QEX T;  1VQ9 A;  3M0P A;  3GF5 A;  2DYB A;  2J6K A;  1MMA A;  5IAY A;  2ABL A;  4VUB A;  5J39 A;  1HJD A;  1QVF S;  3G1J A;  1B7T A;  1QLY A;  6AT1 B;  4PK4 A;  2YLC A;  1Y71 A;  2DZC A;  1IZ6 A;  3H41 A;  1SRM A;  3JCM X;  1K73 R;  2Y90 A;  2PVG B;  4PL6 A;  2M0Y A;  4CC3 A;  1RAB B;  4E7H A;  2DXC A;  2O01 E;  4WF2 A;  2K5I A;  2LMJ A;  2GQV A;  2FZG B;  2RJE A;  5GAO n;  2C06 A;  1VQ4 A;  4M78 A;  4KUI A;  3S3N A;  3V8K A;  3EFO B;  3HP9 A;  2HAX A;  4ZGJ B;  1PD1 A;  2HSE B;  3CBO A;  2RQW A;  1S1N A;  1JRI A;  3REA B;  4L59 A;  4M75 F;  2CUB A;  2PVD B;  3C94 A;  3RIR A;  5GAN 5;  1H3Z A;  5GAN f;  3G6E Q;  4DBQ A;  4M78 E;  3SWN C;  1JBM A;  1UJ0 A;  3QJY A;  1VQ9 Q;  4PFZ A;  4CC4 B;  1M2O A;  3S6W A;  2CH4 A;  2QK0 A;  4LDU A;  2H8H A;  3A8O B;  4E7I A;  1M1F A;  1ZBX A;  2DKG A;  1Q82 C;  3GLX A;  2DIQ A;  4HT8 A;  1KD1 R;  2DAQ A;  3URG A;  5J3B A;  2NUZ A;  4RTT A;  2J7I A;  4E47 A;  1UJY A;  3HKS A;  2RN8 A;  2ZPB B;  2ROT A;  2K79 A;  4OMO A;  3MEW A;  1N9S A;  1ABO A;  3ME9 A;  4RG2 A;  4LN2 A;  2QYZ A;  3CCU A;  1M1K R;  2RHU A;  1ACM B;  1GBQ A;  1Y7X A;  1KQS P;  1SEM A;  2JUF A;  3G4S T;  4EIK A;  2V1R A;  4BE0 A;  2AHJ B;  1K0X A;  2PVO B;  4QKU A;  4QW2 A;  5CKH A;  2EKH A;  1W1F A;  2DNU A;  4A54 A;  3C12 A;  2ECZ A;  3L2R A;  4OMM A;  4BY6 B;  4C0Z A;  1PKT A;  3FEO A;  1YBY A;  4OGC A;  2ZPF B;  2O4X B;  4PLL A;  2XI9 A;  3JRZ A;  3M0R A;  3FB9 A;  3M0U A;  4HXJ A;  1BK2 A;  1H8K A;  1FMV A;  3JB9 G;  4ORZ A;  2OAU A;  4OP0 A;  3FLG A;  3FIF A;  3VRZ A;  1EX4 A;  1QWF A;  1XQH A;  5A0L A;  4M7D E;  3EGX A;  4AFS C;  5HK0 A;  2PU9 B;  1GCP A;  1ZSZ A;  2FPD A;  3M4G A;  4QVZ A;  3OYN A;  1M30 A;  2PQW A;  2LX9 A;  2HD0 A;  2BTT A;  2D9T A;  2OTL Q;  1ZQ1 A;  2BKD N;  3BDL A;  4LXC A;  2FRW A;  2ED1 A;  2FZK B;  4D8D A;  3A98 A;  4A63 B;  4Y92 A;  3CD6 T;  2BUD A;  4JUV A;  4M4Z A;  2P4T A;  1Q7Y U;  1QVG A;  2D0Q B;  2BZ8 A;  1M90 R;  1BYM A;  3CCQ A;  2EFI A;  1BIA A;  1SSF A;  1TG0 A;  1M4Z A;  5GAM d;  2LT4 A;  1HK9 A;  3HFO A;  1RI9 A;  1Z9Q A;  2LQN A;  2CZ1 B;  4C0D C;  5KYN A;  4NS5 A;  4A4F A;  2IIM A;  5HK3 A;  4OB1 B;  3A1P A;  4M77 C;  1QQJ A;  1P92 A;  2HCK A;  5GAN 3;  3V7R A;  1PHT A;  1M90 C;  3A8G B;  3M56 A;  2HBW A;  4C5G A;  2AT1 B;  1AOJ A;  2L89 A;  3L2Q A;  4JS5 A;  2NLU A;  4N4G A;  3CD6 Q;  2QG9 B;  4EMH A;  1YN8 A;  2CS7 A;  2QTX A;  2M16 A;  1G3Y A;  1FMW A;  3LWI A;  2GTJ A;  2DJZ A;  3QZ5 B;  4P5N A;  1FMK A;  3VRY A;  1NEG A;  1C0M A;  2KDS A;  5LJ5 f;  3NFC A;  2MIO A;  3CCR Q;  4PNO A;  2M9U A;  3OSV A;  5I2M A;  5FWB A;  3S3M A;  1I5O B;  1C1A A;  4IUT A;  4B6M A;  2VGN A;  1EFN A;  1WXB A;  5GMK h;  3HHT B;  1LVK A;  4V2S A;  2DMO A;  3HPW A;  4UC4 A;  4C8Q C;  3LH5 A;  2FRY A;  4J6X A;  2KR3 A;  1YHQ A;  4J9E A;  2GFA A;  1NM7 A;  4OMN A;  1W2B P;  5I2S A;  3OW2 P;  1RLP C;  1BI3 A;  3I55 T;  2IPO B;  3HRT A;  3I5S A;  3IQL A;  2DXB A;  2J6F A;  4DEY A;  1B3Q A;  3M0S A;  1X69 A;  2RJD A;  1R77 A;  4DA4 A;  1ABQ A;  3EGU A;  1VUB A;  5FW9 A;  2DTI A;  2X4J A;  2X4W A;  2GBQ A;  5GMK i;  1N6A A;  3PT9 A;  1KK7 A;  1GRI A;  3OYB A;  2OX7 A;  4M77 G;  3CCJ T;  2LJ1 A;  4M75 B;  5EC7 A;  4J9H A;  4KGZ B;  4RCC A;  4QVD A;  2COZ A;  2EQK A;  3CBM A;  4LD6 A;  1NJI C;  2QGF B;  4J9F A;  3PFS A;  1YIT Q;  1KHI A;  3PVL A;  1JB0 E;  2A36 A;  3CD6 A;  1PWT A;  4N0A C;  5LJ3 j;  2QA4 Q;  2RH2 A;  1M1K C;  2KT1 A;  4JRK A;  1PC0 A;  2CP7 A;  4FYY B;  3EFO A;  3RKY A;  1YJ9 T;  2PZ1 A;  4BE1 A;  3CC7 A;  1SHG A;  4A4K A;  5GMK l;  2EGA A;  4II1 A;  2VKN A;  1Y96 A;  4N0A A;  1SF9 A;  4HA8 A;  2VB6 A;  2DLP A;  3SDZ A;  1YJW Q;  4O6J A;  2CZ6 B;  1AWW A;  3DB4 A;  2BE9 B;  8AT1 B;  1FWZ A;  1Q82 U;  2ZPG B;  1PM3 A;  3CC4 T;  4J6Y A;  4BE2 A;  1UGP B;  3CCS Q;  4E7L A;  5CCA A;  3VS4 A;  4FCY A;  3TCJ A;  1VQ4 T;  2O31 A;  2LCL A;  3MP1 A;  4M7A D;  2KRS A;  5CVI A;  1M9S A;  4FW2 A;  3RKX A;  2PTK A;  3H9N A;  4ANJ A;  3VJP A;  1YJW T;  5LJ5 h;  3KUF A;  4JJB A;  3CCE A;  3CCV T; 
#chains in the Genus database with same CATH homology
 1VQN Q;  1Q81 R;  1Q7Y R;  3G6E Q;  1VQ7 Q;  1VQL Q;  3CCJ Q;  1VQ5 Q;  3CD6 Q;  1VQ9 Q;  3CCU Q;  1VQP Q;  3CCE Q;  1VQ8 Q;  1K8A R;  1QVG P;  1K9M R;  1YI2 Q;  1VQ6 Q;  3CPW P;  3CCV Q;  1M1K R;  1YJ9 Q;  1YJN Q;  3G71 Q;  1Q82 R;  1VQK Q;  1M90 R;  2OTJ Q;  3CCL Q;  1YIJ Q;  3CME Q;  1VQM Q;  1VQO Q;  3G4S Q;  1S72 Q;  1YIT Q;  1K73 R;  1KQS P;  1KD1 R;  1YJW Q;  3CCQ Q;  3CC7 Q;  1VQ4 Q;  1QVF P;  3CC4 Q;  1NJI R;  3CC2 Q;  1KC8 R;  2OTL Q;  2QEX Q;  1W2B P;  1N8R R;  1JJ2 P;  2QA4 Q;  3CMA Q;  1Q86 R;  3I55 Q;  3OW2 P;  1YHQ Q;  3CCM Q;  3I56 Q;  3CXC P;  3CCR Q;  3CCS Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...