3CD6V

Co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3cd6V00
3G71V 2QA4V 4WF9V 5DM6V 1YITV 1W2BU 1K8AW 1R73A 1VQ8V 3CCLV 3CCUV 1VQPV 1YHQV 1JJ2U 1QVGU 1VQ9V 1KQSU 3CCSV 1YJ9V 1S72V 2D3OW 1K73W 1N8RW 3CCQV 3I56V 1YJWV 1KD1W 3CC7V 1VQ6V 1QVFU 3OW2U 1Q7YW 3CCVV 2QEXV 3CC2V 2OTJV 3CCJV 1K9MW 2OTLV 1YJNV 1YI2V 4WCEV 1VQLV 1Q82W 1Q86W 3CD6V 3G4SV 3CCRV 3CC4V 3CMEV 3CXCU 3G6EV 1VQNV 3CMAV 1KC8W 1VQ4V 1Q81W 1VQMV 1YIJV 3CPWU 1VQKV 1VQ5V 4WFBV 1M90W 1NJIW 3CCMV 1VQ7V 1M1KW 4WFAV 1VQOV 3CCEV 3I55V
chains in the Genus database with same CATH superfamily
3JD3A 5A2QN 1YEWA 2UXCB 2Q7GA 2HHHB 1G4YB 1U97A 3K3WA 4CH5A 4B3MB 1TVKA 3JASA 1NKDA 5CA1B 3E8GA 2PZSA 3HKEB 3K04A 3RT3C 1GK9A 2JS3A 2L6LA 4FLUA 3RYHA 2CTWA 3RYIA 2HEPA 4TT3G 4FMTA 1IBKB 1P4RA 2ZE8A 2EIMC 1K33A 3C3SA 1VMGA 2E3CA 3OGCC 3HKCA 5LP6B 1Y76B 3W7TA 1XI1A 3ASOB 4IYIA 4JI2B 2Q5ZA 4JI6O 4PJ0Z 5KLVH 4D7SA 4GZRB 3OMAB 4ZKIA 5CA1A 4QPKA 1GO3F 4FM2A 3B40A 2IJKA 3PJSK 3UT5B 3HKEA 1MMMA 2G38A 3QF7A 1Q86W 1F7YA 3ABMC 4JI8B 1S76D 1Q6HA 3GVMA 2ADQB 2LGWA 2LFRA 1SKVA 5J9PC 4LF7B 1H2MA 2DMXA 2N05A 2XAHA 1NT2B 4JF3A 2E5LB 5LP6A 2GTAA 4GUNA 4DUYB 4FLZA 3T1YB 4B3RO 3B2EE 4X64O 4JTDB 4JAAA 3ETQA 4YJ2B 3UT5A 3CYOA 1S5LZ 4MSWC 2EBOA 1MABG 2JS5A 2OIEA 3I56V 2F4VO 1VQ6V 4NTXA 1N32B 2OTLV 1G8MA 1VQLV 1CPYA 3CX5F 4X62O 1J95A 1WLEA 5LA6B 2DQ0A 3TJTA 3JYCA 5EBWC 2VS0A 4DV1B 2AGAA 1R6KA 2XAFA 1OCRB 1JA8A 1W59A 2M6YA 5LGTA 4G28B 3L75H 1N8RW 4X1IB 4LFAB 1JX9A 1P7GA 1R3LC 4BIZA 1RPOA 4LH7A 1PP9H 4YJ2A 2PYLA 2XNDG 4JAUA 1U96A 2Q7HA 1VF6C 3LSSA 1E1RG 1MZFA 2X6CA 4DR7B 3CCLV 2HP8A 2Y69C 3N2GB 2A79B 1BQZA 3JAWB 1NH2B 2KQXA 4LR3A 4KHPB 2O57A 4IYHA 3LUTB 3K08A 3SPCA 3VQWA 5LA6A 3TGUH 3CCJV 1TAEA 4DK1A 2WLLB 3CRQA 4QJFB 4RQFA 3PN1A 2R70A 1HNZO 4AQYO 5KAIZ 3G6BA 2EIJB 4I9QA 3CXHF 4K0KB 2Q0AA 4B3SB 4DK0A 5GW7A 2XAGA 3CC2V 2UXCO 1XUQA 4I7ZB 3SYCA 4XDJA 1OCOB 5L3CA 5B1AC 4IHJB 3N2GA 4AILC 3TXQA 4D6TH 1AJQA 2LGQA 2RNBA 4RQEA 5EC2C 4DV7B 2ZXWB 3H9VA 2WLLA 4DV6B 4J41A 4NB5A 1ZUQA 1YVWA 3FB8C 1VQNV 1BQ0A 4OX9O 1QU7A 2IJHA 5H9CA 4JYBA 5CBGA 4B3TB 1OCCC 4XBFA 3OEHG 3GWKC 3QO8A 1SC5B 3U10A 3BABA 4IHJA 1H2GA 1R3IC 1WP8A 2YDEA 3OMIB 1BE3H 3SPGA 3ZBHA 2EIMB 2ZT9B 1YITV 1WN7A 4WBNB 2UUCO 3CRAA 2K1EA 3GWOA 4P2ZA 1JFFA 4BW5A 1R6TA 3STZC 2W6IG 4MVMA 2WAMA 2DE0X 1ZL8A 1FJGO 2XHBA 3E35A 5LYJB 1QR8A 3FD9A 3NXSA 1KBHA 4MT8A 5BR8O 3ABMB 4GX1A 5E79Z 3OW2U 4MTOA 2JVDA 3VOUA 5L3FA 4LNUB 5IE9A 4R50A 2ATKC 5KA6A 2JJ1G 2QGNA 2YS8A 5KHGA 5EIBC 3OGIB 3S3XA 2A9HA 1G6UA 4WBNA 3RYFB 2CGNA 1X59A 4DV3B 4GLXA 2LJ2A 5FNVB 3HB3B 3U11A 4DV4O 4X20B 1OJHA 4N23A 3CC4V 1DK1A 3OR7C 3SJQC 5LYJA 1FS0G 1IXBA 1BCCH 2Z3YA 2JEUA 4CC6A 4PA6A 4JI0O 5KAFZ 1NJIW 1Y67A 2JIZG 2QSAA 4UVAA 1Q5OA 3IJ4A 3SGIA 4LNUA 1FKAO 2GSMB 5IDJA 3ZRSA 1EZVH 2P90A 5JJEB 4YIOA 1VARA 5KUKA 4KL1A 3RYFA 3E22B 5LGUA 5KA5A 4L8JA 2DW4A 3BA8A 1IBMO 4WFFA 5FNVA 3THOA 1DF4A 4AHCA 2WLMA 1SQQH 3ZIAG 1FPOA 1HP8A 1L0LH 5EK0A 3RFRA 4U3JB 2Z5UA 4U3FH 2Y69B 3N2KB 3K0DA 4TV9B 4OPHA 5EC1C 5K1PA 4DR2O 1YTFB 5LBQA 1XNQO 1SA0B 4JTCB 3ABUA 5IWAO 2LFSA 4I50B 5IYCO 1Y66A 4DR4O 1XDCA 4JI6B 2FYUH 1MNGA 1N34O 1B06A 1VEWA 4UCUA 4XDKA 3JCUZ 4R6ZA 5GTHZ 3S3WA 1HR0O 3D36C 2OCCB 4I4TB 3JSNA 1YHQV 2DYRC 4K35A 4JI1O 1VF6A 4EFBA 1BS3A 5B1AB 4U3JA 2N04A 3H1JH 4TV9A 4KFMA 3QG5A 1SA0A 5FPOA 2P22C 4PHZA 3JAKA 2PF4E 3AG1C 2EIKC 4GX5A 1YF2A 4WF9V 4B08A 2VQFO 4CH6A 1BHAA 1Q8IA 4B3RB 3CB2A 2FB5A 3D8CA 4X64B 1VF5B 5EBMC 2CTRA 2QTOA 1OCCB 4MVUA 1JMKC 1R3JC 3L72H 3O65A 4FM1A 4PI2A 1URFA 1SF9A 4I4TA 3MHHC 2IM9A 3K5MA 2XAJA 5CBHA 3UO3A 2F4VB 2YIBD 1FXKC 2VWKA 1AP5A 3AK1A 3OD4A 3IGAC 5D5QA 2RCVA 2K9PA 4X62B 3LDDA 2Q68A 4TUYB 1OZ0A 2H94A 5KHJA 3SJAC 2KB1A 4BW9A 4J10A 2ZKOA 4UV9A 4Z1MG 2PTMA 5JVDB 2W0XA 4QE7A 5TISZ 1Y6XA 2DYSC 3SYAA 2YC0A 4E2LA 4JI4O 2UU9O 4LF9O 3BAAA 5JH7B 3RN4A 1GN2A 1K9MW 3FYIB 1AI4A 2QWOB 2AXTZ 2VRZA 1LR1A 3B77A 1YCIA 2E74B 3FAVB 2ZE7A 4IL6Z 3MDSA 2N74A 1V55C 4EFEA 5GONB 5DEDA 2R9IA 4TUYA 4DO2A 4TSFG 3IAYA 1EZJA 1WA8B 1MSWD 1HNZB 4I5SA 1N0JA 3F7VC 4MVZA 5CN0A 4AQYB 5JVDA 1KP2A 2ARHA 5CA0B 1DGSA 3ABTA 1VQ5V 4GKJO 2LQTA 2WPDG 3WFVA 4DW0A 5JH7A 2Q67A 4DUZO 2YICA 3C90A 1ORQC 3JSLA 2B5UA 3FAVA 3OUSA 3A8TA 2Q4PA 2WA3A 1Z2GA 1NS1A 2IJIA 1IX9A 5GONA 4DV5O 1WA8A 2OWOA 1EFRG 2BTQB 4JYAO 4LF5O 2YIAA 4OX9B 3ZN1A 3OEEG 4PA4A 4MVQA 3E8BA 4X89A 1XOUA 5CA0A 3CD6V 4CS2A 2Q0OC 4LH6A 3Q4HB 1R1BA 3HR0A 1THZA 1A32A 2QR4A 2F1MA 4GT1A 5KMGB 3EFFK 1TA8A 1P49A 4CS4A 5JCOC 3CCUV 2ZE6A 1H2LA 4X88A 3W7WA 5B1BC 2QEXV 2ZNIA 2OYQA 1Q43A 3P3NA 4UXNA 1AROP 3ZRXA 4F6RB 4X8AA 3DC5A 2QTSA 3BY6A 3ZMVA 3SYOA 2BTQA 1NVPB 2UUCB 4JZ2A 4JI5O 1N0NA 2QKAA 1D5AA 4TV8B 2X7RB 5LOVB 3Q4HA 1XQ8A 4RO2A 2UUAO 1Y76A 3BHPA 2GUZB 4CBCA 2GDSA 2PI4A 1FJGB 2DWDC 5H6RA 3OM3B 1O9HA 2EINC 5KMGA 2H3OA 2DYRB 1NR7A 5BR8B 5DECA 3CCEV 3G71V 2CDYA 4LF8O 4HNAB 2NLJC 1S72V 4LF4O 1O9GA 4LFBO 3P30A 4U7OA 4F6RA 3AG1B 2UXDO 1CXZB 2EIKB 4FZ1A 3C3TA 1XBLA 1AJPA 3ZJZA 1K5SA 3HPLC 1US6A 1AR5A 2RQ6A 4TV8A 3FFQA 4DV4B 3ZMUA 3H1HH 2EJ7A 3SJCC 2V4DA 3K03A 3L73H 1VQPV 3AK2A 1JPXA 3J81N 2GUZA 1N4CA 2ZIOA 1H8EG 2BTOA 3D36A 3WB2A 3KKYA 1RPRA 2V1DA 4JI0B 5LHHA 1SQVH 1AJNA 1R6NA 2M7WA 1FXKB 3OUFA 4HAMA 2IBZH 1AI7A 1HDJA 3M99B 4HNAA 3ETGA 3ETDA 4N21A 1CP9A 1ZSPA 3FX7A 1K73W 1GAXA 1SQGA 2QKCA 3ETEA 3ZX6A 1I0HA 4UCOA 3UQ8A 1IBMB 2CGOA 5LMNO 5JWPA 2DYSB 1T5EA 4RAIA 5K1XA 4FM0A 5LMUO 2YIBA 5L3DA 2CTQA 5CBFA 1K3EA 2ZINA 1YTFD 2IH3C 1F4NA 3JD4A 4X1IA 3T1HO 1XMOO 4NXMO 2NR5A 3M8AA 1PNMA 2GV9A 1FXKA 1V55B 1XNQB 1TUBB 4DR2B 3L70H 5B1NA 4P30A 1ENVA 4JTAB 4IT5A 1AILA 3CRRA 3VBBA 5IWAB 5IJ9B 2X6AA 1PPJH 3JAWA 1HNXO 4DR4B 3RYCB 2JEXA 1Y4MA 1N34B 3OMNB 1GH6A 3CC7V 4PDLA 5B3SC 2EULA 1HR0B 5IY5C 3A0BZ 3W7SA 3B8NA 4JI1B 1NR1A 4NTYA 5EBLC 3WB1A 3OR6C 1XL4A 4UFZA 3SPHA 3E8FA 3ZMSA 4FLWA 2NNUA 1TUBA 2W6JG 1K7DA 4UB6Z 3FB5C 5H6QA 3CCVV 3SYQA 4FIPC 1VP7A 2ZDIC 2DJVA 5IJ9A 1RSOB 4X65O 2VQFB 4UCRA 3SR2C 2V7QG 3RYCA 3WB0A 4RUEA 3K5OA 1GN6A 1YSCA 1NZ6A 3JAMN 1DLBA 3B4SA 1UJWB 3DXRB 3DTUB 1YJNV 5BZBA 5LGNA 2Y0PA 2RJZA 3QNEA 4DV2O 2WLKA 1EM1A 3BCCH 4JZGA 5KUMA 1I7FA 5B1BB 2E76B 1R73A 1LUWA 1I5YA 4JYCA 2R72A 1RSOA 4O2AB 1G1XB 4FK5C 4O4JB 4OPAA 2R9AA 1OCZC 1EBOA 4JI4B 3CCMV 1VQ7V 2UU9B 2HR3A 4LF9B 4CZZA 4JI7O 4NVPA 3DXRA 4DYLA 3BEHA 3CCSV 1XL6A 1AB3A 2LW1A 4HYOA 4MS2A 5EIBD 1WNSA 4X1KB 3K9SA 2ZR2A 1VQ4V 4X9QA 3ZEDA 1Q6UA 3STLC 5CB4B 1XNRO 1QLEC 4FZ0A 1F23A 2XOKG 3UCSC 1SQXH 4O2AA 1V54C 3M7MX 4PDVA 4ABMA 4RWUA 1SRYA 3QVNA 3J80N 4K8ZA 2P6JA 4GKJB 4LFCO 3TETA 1Q3EA 3ZHTA 1XMQO 2P4VA 4KXRA 4UCVA 4DUZB 3UKMA 1KUQA 1WB8A 3SYPA 3VQXA 2JGUA 1S0VA 4X20A 1S5JA 4J7KA 2IH1C 1WP7A 2DN9A 2ODMA 4MVRA 1H2SB 3T2MA 2IU0A 3AG4C 3KZIZ 3AK3A 1FXVA 5FLXN 4YJ3B 4W4KA 3TCUA 5CB4A 3AG2C 3HKBB 4DV5B 3CPWU 2A06H 4WFGA 4JYAB 3K5LA 4JV5O 2OT5A 3TXSA 4LF5B 2BSKB 1M1KW 1K92A 1VQOV 1XEQA 5LP6C 1VQ8V 1HNWO 1JCHA 1K34A 5KX5B 1M56C 1FFXB 4TQDA 2YUAA 1L1FA 3GB7C 3E22A 2X0LA 1GN3A 5FPRA 4X66B 1LUVA 5KHKA 1P84F 2QWRB 4PA3A 3BVOA 4CH4A 1DTOA 4BAYA 3H1IH 4DRXB 2ZD9A 1NVPD 4JAVA 1SS3A 2ILMA 3LNMB 4YJ3A 2PY5A 5BMVB 3HKBA 1ZLZA 1YI2V 1MA1A 4JI5B 2BSKA 3N2KA 1KKDA 4FLXA 1YIJV 2HG5C 4PI0A 5KX5A 3H1KH 1PNLA 4DR5O 1BZKA 1FFXA 3HKDB 1MOFA 1Q6IA 4DR1O 4I50A 2UUAB 3TK1A 5B3SB 4D7TA 2PYJA 5IY5B 4QNHB 3K9AA 5EYPB 1AP6A 2YSUB 5H5NA 4CC5A 1QBZA 3J7AU 1GM8A 1SETA 2C2AA 4DRXA 4WFEA 3KG2A 3OTOO 4Q20A 2ETNA 2KKWA 2QM4A 1H2NA 4IGGA 4LF8B 1Z5VA 4LF4B 4BIOA 3F5WC 4LFBB 1JOYA 5BMVA 1SZTA 1W0JG 2UXDB 2AZ2A 4CH3A 4DR3O 2CE4A 1KD1W 2LW7A 1SQBH 4LC1A 4PA9A 5LL6Y 3QTCA 2UXBO 3HKDA 4DV0O 1PL0A 2CUGA 4Z2WA 1WAZA 4HBNA 4L87A 3CRCA 1GKFA 4P9PA 3ZHUA 4DXWA 4ZIBA 2FTKA 2BOCC 1QVGU 1FFTB 5IYDO 2HLDG 2QE7G 1M93A 3BFRA 3R66A 4FLYA 1XHXA 3BPZA 4JYYA 2LP7A 1MZEA 1VF7A 3ZS8C 1VQMV 1S5HC 1VQKV 2Z0AA 4U7NA 1M90W 2ZDIA 1K8AW 1RFYA 2JDIG 5EZYB 3CSXA 3JD0A 5LMNB 4GX0A 3ZCCA 1OCZB 5LMUB 5HFLA 4ZBMA 4ZOLB 4O4HB 2IJJA 4P9OA 2F23A 1NTMH 4DR6O 1BT8A 3T1HB 4UUJC 1BGYH 2L35A 4J9ZB 1XMOB 4I55B 4AI8A 4NXMB 1KYOF 2VQEO 4GYCB 2GTSA 1KQSU 1YJ9V 4TOIA 1M57C 4FLTA 2HVJC 4CS3A 4K8XA 2ZXWC 1QLEB 5JQGB 4MW8A 5LHGA 3AEIA 1HNXB 2IU3A 1V54B 1YXBA 1NTKH 3B09A 3RVZA 3ZN0A 5EZYA 1AVMA 3W7XA 3O9OA 4XDLA 3WG7C 2XAQA 3CRMA 4ZOLA 3E8HA 2YXYA 2X6BA 4O4HA 1N33O 4O2BB 2QJ1A 1JR9A 2GBOA 4I55A 4YXWG 3LDCA 4ZI7B 4X66O 2NN4A 3U0ZA 3AG4B 4FFKA 2Y4UA 3ML0A 2P06A 3A0RA 1L8DA 3A0HZ 3AG2B 5JQGA 4X65B 1CEZA 1NBMG 4X1YB 5CMUA 1IBLO 1I94O 3BRCA 3K5NA 2DQ3A 2QDOA 3K58A 1FD9A 4J11A 4YY3O 5LHIA 1IDSA 2XUMA 1M56B 3ICXA 1QR9A 3OE7G 1YZBA 4LP8A 5B5EZ 4O2BA 1SZXA 3OTFA 3ASNC 4UVCA 4K3AA 1KP3A 2XT9A 1I08A 4KP4A 5L3EA 4DV2B 2RN9A 4ZI7A 1AI6A 1COWG 1B6QA 3E83A 4WFBV 1LNQA 4H37A 2CH7B 3NR7A 5DM6V 1NQTA 1B3QA 4X1YA 4PV1B 4QPJA 3L74H 1BSMA 1QHTA 1N36O 5HFMA 1SERA 4HZ3A 4I9WA 4UCTA 3ABLC 2ZM6O 4H0LB 4MVSA 4BIUA 2ZIMA 4BWAA 5BY1A 4OGQB 3G6EV 3L71H 4B7KA 5IYBO 4JI7B 2AHYA 5F2VO 1NTZH 2EILC 4LBEC 4EEQA 4E4EA 5J2UB 2A7WA 2WLNA 3F7YC 1PM9A 3ZMTA 3ZHQA 5LOVA 1K4CC 1ZWIC 1WPXA 3JATB 4LF6O 1PD3A 3CWBH 3ZRVA 5JJNB 1M9NA 1DF5A 3E86A 4JPRA 1XNRB 2YI8A 2CH7A 2ZR3A 3LSQA 1JVMA 2P4KA 2VWJA 3KCYA 1EN4A 4LFCB 1QQCA 1JJ2U 1AI5A 2RMKB 3K59A 2LO1A 1YJWV 3F5TA 2P7TC 1XMQB 3CMEV 3JARB 5J2UA 4WFHA 5FL7G 3ABKC 3APOA 4MVOA 3UO2A 2BOBC 1ZAUA 4QIWF 2UXXA 3JATA 3A2FA 2XASA 4YHHO 3DC6A 2R9RB 3D3IA 2UUBO 3R65A 5ITZB 3E89A 4JI3O 5B66Z 2QM7A 2CAZC 3WU2Z 4JV5B 4UVBA 4UB8Z 1J5EO 3SJBC 1HNWB 3X2QC 1QCEA 1NU1H 1KMIZ 3IC7A 3AG3C 4WFAV 4NXNO 4WCEV 5C93A 2B1IA 1IZ3A 2QKSA 4BR6A 3VQYA 2ZQMA 3JARA 2OCCC 1H38A 3T4DA 3K79A 2HHHO 1E1QG 5JJJB 2Q69A 4B3MO 3CHXA 3K0GA 1F4MA 2Y4TA 2WLHA 1M57B 4TWKA 2F66C 3T4ZA 1SQPH 5J2TB 5ITZA 3RVYA 4NKGB 1XREA 1TGOA 4MTFA 4C7UA 3VQVA 4FJCC 2B9ZA 4R7CA 2RDCA 1IBKO 4I0XB 4DR5B 1JFFB 4DR1B 1GM7A 2ADPA 2XTAA 3MAQA 3WG7B 1PL4A 3SDLA 1HW7A 2YXLA 1ZL8B 5A9GA 1ZX3A 4J42A 4JI2O 5L3BA 3E2EA 2H8PC 3ZHSA 2PI5A 3IFXA 3OTOB 3ZHRA 5CA3A 1SQFA 2HJDA 4A5UB 3RW0A 5KHIA 2CK3G 2UXNA 2GHYA 5J2TA 3DGEA 2EX3A 2F93B 1VIBA 2DWEC 1RM1C 4DR3B 4JI8O 3LNNA 2Q7EA 3W7UA 2D3OW 4IIJB 4ASUG 2UXBB 4I0XA 3CE2A 4LF7O 2KG7B 4DV0B 2BCCH 4G2KA 2E5LO 2MK3A 3G67A 3EVKA 4J9YB 4MW3A 4DUYO 3T1YO 3ZHVA 3ASNB 4G27B 2PUSA 2JJ2G 1S77D 3ZRWB 4UV8A 4PD4F 1OHHG 4LCUC 2EJRA 3UM7A 2QWQB 4NYKA 4MTGA 2ZNJA 2DOSA 3QO5A 1D5NA 2EINB 2AHZA 1Q82W 2QWPB 5JCOA 2F95B 2JRIA 2Q6AA 3JALB 3K57A 1N32O 4QE9A 3CS5A 1WPBA 5D5PA 2EZPA 5E1AC 1BL8A 2YIDA 5DN6G 5B1OA 1R3KC 1B04A 4R8CA 2OIGA 4IIJA 4O4IB 2ZE5A 3BA9A 1S3JA 2KG7A 4J80A 3ABLB 3SPJA 4B7EA 4F6EA 1JQ0A 2Q9LA 4DV1O 2B1GA 3MD0A 4O4JA 1XILA 1H2KA 4DR6B 2EILB 3OT7A 1IVSA 3T1CA 3CXCU 3N27A 2JGDB 2ZCEA 4LFAO 1EN5A 2AZ0A 3ZRWA 2VQEB 3RBZA 1I5XA 2FL4A 3JCZA 4EB6B 1M5IA 1KECA 5KHHA 1GM9A 1AR1B 5C8YB 1QNMA 4QGPA 4X1KA 4H13B 3FB7C 1W0KG 3JALA 2WWWA 4DR7O 4GKKB 1KU9A 4PA7A 2P5OA 3OFNG 3FB6C 1SESA 4KHPO 4EKWA 2A3QA 4YIPA 5GTIZ 4O4IA 2HFEC 1MSDA 3SPIA 1V9PA 2JK5C 3CEIA 3RGBA 2E75B 2ITCC 2ITDC 1NI8A 1L0NH 2QA4V 1N33B 3DSQA 3ASOC 4MTXA 4FFBB 1JJOA 1F51A 3ABKB 4K0KO 2JGDA 1GTOA 1FXHA 4B3SO 3FKSG 1PNKA 1Q81W 4EB6A 1AR4A 3CJHB 3OAAG 1PKXA 5C8YA 4DW1A 1UFIA 4GCZA 2WLIB 1Z5WA 3JAKB 1YDXA 3RWRD 1IBLB 4FLVA 1RP3B 1I94B 4O4LB 3G80A 3X2QB 1FYJA 4YY3B 4RUFA 2WA4A 4DV7O 3B8MA 3K06A 3CCRV 4NR1A 4NTWA 3AG3B 1KC8W 1OV9A 1ZTEA 4DV6O 4FFBA 5LXTB 4W4LA 4B3TO 4PDMA 1H8HG 4OXSA 4PDRA 2YXHA 5L3GA 1GN4A 5H2FZ 1IURA 1WB7A 5AG2A 4Q6GA 1Q7YW 1GMGA 3CJHA 1QLNA 3EHBB 4JASA 2HJFC 2BE3A 2KSDA 4ZHQB 2WLIA 2F43G 3I5DA 2QWNB 1UPGA 4F4LA 4O4LA 4ICGA 1N36B 4FPPA 3FYEB 1W2BU 3LSUA 2ZM6B 4PELA 4UCSA 1GRJA 4LWSB 2OTJV 1QVFU 2Y48A 1OCRC 3L9DA 3G4SV 2HKOA 2YI9A 3MHSC 5LXTA 3CP1A 1P7BA 4LF6B 3APQA 3JD2A 5EYPA 4H33A 4JGSA 2FKXA 5IYZB 2A0LA 5IJ0B 2Y0IA 1K5QA 3P3PA 4ZHQA 1WJZA 2YEVB 1RM1B 3AG7A 3H1LH 1EN6A 2OCHA 1M4UA 4KUMA 1XHZA 4FVMA 2D2CB 1X4TA 2EZOA 2PGGA 1D2DA 3I55V 1BMFG 3P32A 1Y74B 4LWSA 4TQFA 5BXZA 1PV0A 1VQ9V 4J7JA 1NH2D 2EIJC 5IT9N 3JD1A 1K4DC 1E79G 1KB9F 4DV3O 3ZMZA 2FMLA 1BHBA 2CTPA 1TVKB 3QO7A 2QM8A 3JASB 3H01A 2AW9A 4J7ZA 2HVKC 4YHHB 2Q73A 1ROPA 3KCXA 2UUBB 4JI3B 5IYZA 5IJ0A 1OCOC 1KKCA 1MG1A 3EXAA 3LDEA 2IW5A 3RYHB 2YEVA 3RYIB 1IXMA 3CCQV 1J5EB 1TUEB 4Z1VA 3IC9A 1HWYA 3CMAV 4NXNB 2Q8VA 2WLJA 2W0FC 1FAFA 3D3QA 1K97A 1Y74A 4GKKO 4GX2A 4H44B 1Q90D 3HKCB 2P67A 2MW2B 2WSSG
chains in the Genus database with same CATH topology
3JD3A 2OCCB 1R73A 1YHQV 1I5YA 1JJ2U 2DYRC 1G4YB 3K3WA 1AI5A 4JYCA 5B1AB 1YJWV 1NKDA 2P7TC 3E8GA 3CMEV 4FK5C 4KFMA 3K04A 1GK9A 4WFHA 5FL7G 3ABKC 1OCZC 4MVOA 1EBOA 2BOBC 4QIWF 3CCMV 3AG1C 1VQ7V 2UXXA 2HR3A 2EIKC 4GX5A 4WF9V 4CZZA 2XASA 1BHAA 3BEHA 4TT3G 4FMTA 2R9RB 1XL6A 3D3IA 3CCSV 1P4RA 3R65A 4HYOA 2EIMC 5EBMC 3E89A 2QM7A 2QTOA 1K33A 4MS2A 1OCCB 4MVUA 1R3JC 3OGCC 2ZR2A 4UVBA 1VQ4V 3W7TA 3ASOB 3X2QC 1QCEA 3MHHC 3IC7A 2XAJA 3STLC 5CBHA 1QLEC 1F23A 2XOKG 3AG3C 4WFAV 4WCEV 5C93A 3OMAB 4ZKIA 4QPKA 1FXKC 1GO3F 2B1IA 2IJKA 1V54C 3IGAC 3PJSK 2QKSA 2ZQMA 4PDVA 3LDDA 2OCCC 2Q68A 1H38A 3T4DA 1SRYA 2P6JA 1OZ0A 3K79A 1Q86W 3TETA 1E1QG 2H94A 2KB1A 2Q69A 3ABMC 3K0GA 1F4MA 1S76D 4UV9A 4Z1MG 2WLHA 2LFRA 3UKMA 1M57B 4QE7A 4TWKA 3SYPA 5J9PC 3T4ZA 2DYSC 3SYAA 1S0VA 3RVYA 4E2LA 2IH1C 2XAHA 4JF3A 4MTFA 4MVRA 3T2MA 2IU0A 4FJCC 3AG4C 1K9MW 4R7CA 1FXVA 3FYIB 1AI4A 3TCUA 3B77A 3AG2C 1GM7A 4JTDB 3CPWU 3WG7B 4WFGA 1V55C 2OT5A 1M1KW 1K92A 1VQOV 1VQ8V 3CYOA 2R9IA 1JCHA 4DO2A 4TSFG 4MSWC 1K34A 2EBOA 1M56C 1MABG 5L3BA 3E2EA 1EZJA 2H8PC 3I56V 2PI5A 3IFXA 1VQ6V 5CA3A 2OTLV 1G8MA 1MSWD 3RW0A 1VQLV 1L1FA 1CPYA 3GB7C 4I5SA 3F7VC 4MVZA 2X0LA 5CN0A 1KP2A 1J95A 1WLEA 2CK3G 2DQ0A 2UXNA 4PA3A 2GHYA 3ABTA 1VQ5V 1DTOA 3DGEA 3JYCA 4BAYA 2WPDG 5EBWC 2DWEC 1RM1C 2ZD9A 3WFVA 1NVPD 1R6KA 2XAFA 1OCRB 2Q67A 4JAVA 5LGTA 3W7UA 4G28B 2D3OW 1ORQC 4ASUG 1N8RW 3LNMB 2B5UA 1JX9A 3OUSA 1YI2V 4G2KA 1R3LC 4BIZA 1RPOA 2MK3A 1KKDA 1YIJV 2HG5C 2XNDG 4JAUA 4J9YB 4MW3A 2IJIA 3ASNB 4G27B 3LSSA 1PNLA 1E1RG 2JJ2G 1S77D 1MOFA 3ZRWB 4UV8A 2X6CA 3TK1A 1OHHG 2Y69C 4LCUC 1EFRG 2A79B 2EJRA 5B3SB 3CCLV 1NH2B 3UM7A 3ZN1A 3OEEG 5IY5B 4MTGA 4PA4A 4QNHB 3LUTB 3K08A 3SPCA 4MVQA 3QO5A 3E8BA 4X89A 3K9AA 2EINB 3CCJV 2AHZA 1Q82W 2YSUB 3CD6V 1QBZA 2WLLB 1GM8A 1SETA 4QJFB 2C2AA 2Q6AA 4WFEA 3KG2A 4RQFA 4QE9A 4Q20A 2EZPA 5E1AC 1BL8A 1THZA 5DN6G 5B1OA 1R3KC 2EIJB 3F5WC 4R8CA 4GT1A 1JOYA 3EFFK 1S3JA 3CCUV 3ABLB 1SZTA 1W0JG 3SPJA 1JQ0A 4X88A 3W7WA 2B1GA 3MD0A 1KD1W 5B1BC 5GW7A 2XAGA 2QEXV 3CC2V 2EILB 4LC1A 4PA9A 3T1CA 3CXCU 4UXNA 4XDJA 3SYCA 1AROP 3ZRXA 1OCOB 5L3CA 5B1AC 4X8AA 1PL0A 3ZRWA 3RBZA 3BY6A 3ZMVA 1I5XA 3SYOA 3JCZA 4L87A 1NVPB 1GKFA 1AJQA 4P9PA 4DXWA 1KECA 4RQEA 2FTKA 5EC2C 1GM9A 2BOCC 1AR1B 2ZXWB 1QVGU 1FFTB 2X7RB 5IYDO 2HLDG 1W0KG 2QE7G 3FB7C 2WLLA 4RO2A 2WWWA 4PA7A 2LP7A 3FB8C 3FB6C 3OFNG 4CBCA 1VQNV 1SESA 2PI4A 4EKWA 2DWDC 5H6RA 3OM3B 1VQMV 2IJHA 5H9CA 4JYBA 5CBGA 1S5HC 2EINC 1VQKV 2DYRB 1NR7A 2HFEC 3SPIA 4U7NA 1M90W 1OCCC 2JK5C 2ZDIA 3CCEV 2ITCC 3G71V 2ITDC 2QA4V 1K8AW 3ASOC 4MTXA 3OEHG 4XBFA 2JDIG 1F51A 2NLJC 3JD0A 3QO8A 1S72V 3ABKB 4GX0A 3ZCCA 3P30A 1GTOA 1FXHA 1OCZB 4U7OA 5HFLA 4ZBMA 3AG1B 2EIKB 2IJJA 3FKSG 1H2GA 1PNKA 1R3IC 4P9OA 1Q81W 1AJPA 3OMIB 3ZJZA 1K5SA 3HPLC 4UUJC 3OAAG 4J9ZB 3SPGA 1PKXA 2EIMB 3ZMUA 4GCZA 1YITV 2WLIB 1VQPV 3K03A 1JPXA 1KQSU 1YJ9V 1M57C 1H8EG 3X2QB 2HVJC 3D36A 2K1EA 3GWOA 4P2ZA 4RUFA 4BW5A 1RPRA 2V1DA 2ZXWC 3B8MA 3K06A 1QLEB 2W6IG 3STZC 3AG3B 3CCRV 5LHHA 4MVMA 1KC8W 4MW8A 1AJNA 1R6NA 5LHGA 2M7WA 3AEIA 2WAMA 1FXKB 3OUFA 2IU3A 4HAMA 1V54B 3RVZA 1AI7A 3ZN0A 3W7XA 3E35A 3M99B 1QR8A 3ETGA 4PDMA 1H8HG 3NXSA 4OXSA 4XDLA 4MT8A 4PDRA 3ETDA 3WG7C 5L3GA 4N21A 2XAQA 1CP9A 1K73W 3E8HA 2X6BA 3ABMB 4GX1A 3OW2U 1Q7YW 4MTOA 1GMGA 5L3FA 3VOUA 3ETEA 1QLNA 4R50A 2ATKC 3EHBB 4YXWG 5KA6A 2DYSB 2JJ1G 4JASA 4RAIA 2HJFC 2WLIA 3LDCA 5L3DA 2A9HA 2F43G 5CBFA 1K3EA 4F4LA 1YTFD 2IH3C 3AG4B 4FPPA 3FYEB 1F4NA 3JD4A 3ML0A 1W2BU 3A0RA 3HB3B 4PELA 3AG2B 1PNMA 2OTJV 1CEZA 1QVFU 2Y48A 1NBMG 1OCRC 1FXKA 1V55B 4N23A 5CMUA 3G4SV 3CC4V 2HKOA 2DQ3A 3MHSC 5B1NA 4P30A 1ENVA 3OR7C 5KUMA 3SJQC 4JTAB 1FS0G 5LHIA 3CP1A 2Z3YA 1M56B 1P7BA 2JEUA 4PA6A 3VBBA 1NJIW 2X6AA 2JIZG 1QR9A 3OE7G 3JD2A 4LP8A 4UVAA 4H33A 3ASNC 4JGSA 2GSMB 4UVCA 5IDJA 2JEXA 1Y4MA 2A0LA 3OMNB 1KP3A 3ZRSA 1K5QA 3CC7V 4PDLA 2P90A 4KP4A 5B3SC 5L3EA 2YEVB 1RM1B 1AI6A 5KUKA 1COWG 5IY5C 4KUMA 1B6QA 3E83A 3W7SA 5LGUA 5KA5A 3B8NA 4WFBV 2DW4A 1NR1A 1LNQA 4H37A 4WFFA 2EZOA 5EBLC 3I55V 3OR6C 1BMFG 3P32A 5DM6V 1XL4A 1NQTA 1DF4A 3SPHA 3E8FA 4QPJA 3ZMSA 1VQ9V 2NNUA 1NH2D 2W6JG 1K7DA 2EIJC 2WLMA 3FB5C 5H6QA 3ZIAG 3JD1A 1K4DC 5HFMA 3CCVV 1E79G 1SERA 4HZ3A 3ZMZA 4I9WA 5EK0A 3SYQA 3ABLC 1BHBA 4FIPC 4MVSA 4BIUA 3G6EV 3QO7A 2ZDIC 2QM8A 3H01A 2Z5UA 5IYBO 2Y69B 2HVKC 2AHYA 3K0DA 5EC1C 1YTFB 2EILC 2V7QG 4LBEC 5LBQA 1ROPA 2WLNA 3F7YC 4RUEA 3ZMTA 1K4CC 1OCOC 1ZWIC 4JTCB 1WPXA 1MG1A 3ABUA 3LDEA 1YSCA 2IW5A 2YEVA 1IXMA 1PD3A 2LFSA 5IYCO 3CCQV 1DLBA 1UJWB 1TUEB 3DTUB 1Y66A 3ZRVA 1YJNV 1M9NA 1DF5A 1HWYA 3E86A 4JPRA 3CMAV 2ZR3A 2WLJA 2W0FC 5BZBA 5LGNA 1K97A 4XDKA 4GX2A 3LSQA 3QNEA 2WLKA 1JVMA 2P67A 4R6ZA 2WSSG 5B1BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G71 V;  2QA4 V;  4WF9 V;  5DM6 V;  1YIT V;  1W2B U;  1K8A W;  1R73 A;  1VQ8 V;  3CCL V;  3CCU V;  1VQP V;  1YHQ V;  1JJ2 U;  1QVG U;  1VQ9 V;  1KQS U;  3CCS V;  1YJ9 V;  1S72 V;  2D3O W;  1K73 W;  1N8R W;  3CCQ V;  3I56 V;  1YJW V;  1KD1 W;  3CC7 V;  1VQ6 V;  1QVF U;  3OW2 U;  1Q7Y W;  3CCV V;  2QEX V;  3CC2 V;  2OTJ V;  3CCJ V;  1K9M W;  2OTL V;  1YJN V;  1YI2 V;  4WCE V;  1VQL V;  1Q82 W;  1Q86 W;  3CD6 V;  3G4S V;  3CCR V;  3CC4 V;  3CME V;  3CXC U;  3G6E V;  1VQN V;  3CMA V;  1KC8 W;  1VQ4 V;  1Q81 W;  1VQM V;  1YIJ V;  3CPW U;  1VQK V;  1VQ5 V;  4WFB V;  1M90 W;  1NJI W;  3CCM V;  1VQ7 V;  1M1K W;  4WFA V;  1VQO V;  3CCE V;  3I55 V; 
#chains in the Genus database with same CATH topology
 3JD3 A;  5A2Q N;  1YEW A;  2UXC B;  2Q7G A;  2HHH B;  1G4Y B;  1U97 A;  3K3W A;  4CH5 A;  4B3M B;  1TVK A;  3JAS A;  1NKD A;  5CA1 B;  3E8G A;  2PZS A;  3HKE B;  3K04 A;  3RT3 C;  1GK9 A;  2JS3 A;  2L6L A;  4FLU A;  3RYH A;  2CTW A;  3RYI A;  2HEP A;  4TT3 G;  4FMT A;  1IBK B;  1P4R A;  2ZE8 A;  2EIM C;  1K33 A;  3C3S A;  1VMG A;  2E3C A;  3OGC C;  3HKC A;  5LP6 B;  1Y76 B;  3W7T A;  1XI1 A;  3ASO B;  4IYI A;  4JI2 B;  2Q5Z A;  4JI6 O;  4PJ0 Z;  5KLV H;  4D7S A;  4GZR B;  3OMA B;  4ZKI A;  5CA1 A;  4QPK A;  1GO3 F;  4FM2 A;  3B40 A;  2IJK A;  3PJS K;  3UT5 B;  3HKE A;  1MMM A;  2G38 A;  3QF7 A;  1Q86 W;  1F7Y A;  3ABM C;  4JI8 B;  1S76 D;  1Q6H A;  3GVM A;  2ADQ B;  2LGW A;  2LFR A;  1SKV A;  5J9P C;  4LF7 B;  1H2M A;  2DMX A;  2N05 A;  2XAH A;  1NT2 B;  4JF3 A;  2E5L B;  5LP6 A;  2GTA A;  4GUN A;  4DUY B;  4FLZ A;  3T1Y B;  4B3R O;  3B2E E;  4X64 O;  4JTD B;  4JAA A;  3ETQ A;  4YJ2 B;  3UT5 A;  3CYO A;  1S5L Z;  4MSW C;  2EBO A;  1MAB G;  2JS5 A;  2OIE A;  3I56 V;  2F4V O;  1VQ6 V;  4NTX A;  1N32 B;  2OTL V;  1G8M A;  1VQL V;  1CPY A;  3CX5 F;  4X62 O;  1J95 A;  1WLE A;  5LA6 B;  2DQ0 A;  3TJT A;  3JYC A;  5EBW C;  2VS0 A;  4DV1 B;  2AGA A;  1R6K A;  2XAF A;  1OCR B;  1JA8 A;  1W59 A;  2M6Y A;  5LGT A;  4G28 B;  3L75 H;  1N8R W;  4X1I B;  4LFA B;  1JX9 A;  1P7G A;  1R3L C;  4BIZ A;  1RPO A;  4LH7 A;  1PP9 H;  4YJ2 A;  2PYL A;  2XND G;  4JAU A;  1U96 A;  2Q7H A;  1VF6 C;  3LSS A;  1E1R G;  1MZF A;  2X6C A;  4DR7 B;  3CCL V;  2HP8 A;  2Y69 C;  3N2G B;  2A79 B;  1BQZ A;  3JAW B;  1NH2 B;  2KQX A;  4LR3 A;  4KHP B;  2O57 A;  4IYH A;  3LUT B;  3K08 A;  3SPC A;  3VQW A;  5LA6 A;  3TGU H;  3CCJ V;  1TAE A;  4DK1 A;  2WLL B;  3CRQ A;  4QJF B;  4RQF A;  3PN1 A;  2R70 A;  1HNZ O;  4AQY O;  5KAI Z;  3G6B A;  2EIJ B;  4I9Q A;  3CXH F;  4K0K B;  2Q0A A;  4B3S B;  4DK0 A;  5GW7 A;  2XAG A;  3CC2 V;  2UXC O;  1XUQ A;  4I7Z B;  3SYC A;  4XDJ A;  1OCO B;  5L3C A;  5B1A C;  4IHJ B;  3N2G A;  4AIL C;  3TXQ A;  4D6T H;  1AJQ A;  2LGQ A;  2RNB A;  4RQE A;  5EC2 C;  4DV7 B;  2ZXW B;  3H9V A;  2WLL A;  4DV6 B;  4J41 A;  4NB5 A;  1ZUQ A;  1YVW A;  3FB8 C;  1VQN V;  1BQ0 A;  4OX9 O;  1QU7 A;  2IJH A;  5H9C A;  4JYB A;  5CBG A;  4B3T B;  1OCC C;  4XBF A;  3OEH G;  3GWK C;  3QO8 A;  1SC5 B;  3U10 A;  3BAB A;  4IHJ A;  1H2G A;  1R3I C;  1WP8 A;  2YDE A;  3OMI B;  1BE3 H;  3SPG A;  3ZBH A;  2EIM B;  2ZT9 B;  1YIT V;  1WN7 A;  4WBN B;  2UUC O;  3CRA A;  2K1E A;  3GWO A;  4P2Z A;  1JFF A;  4BW5 A;  1R6T A;  3STZ C;  2W6I G;  4MVM A;  2WAM A;  2DE0 X;  1ZL8 A;  1FJG O;  2XHB A;  3E35 A;  5LYJ B;  1QR8 A;  3FD9 A;  3NXS A;  1KBH A;  4MT8 A;  5BR8 O;  3ABM B;  4GX1 A;  5E79 Z;  3OW2 U;  4MTO A;  2JVD A;  3VOU A;  5L3F A;  4LNU B;  5IE9 A;  4R50 A;  2ATK C;  5KA6 A;  2JJ1 G;  2QGN A;  2YS8 A;  5KHG A;  5EIB C;  3OGI B;  3S3X A;  2A9H A;  1G6U A;  4WBN A;  3RYF B;  2CGN A;  1X59 A;  4DV3 B;  4GLX A;  2LJ2 A;  5FNV B;  3HB3 B;  3U11 A;  4DV4 O;  4X20 B;  1OJH A;  4N23 A;  3CC4 V;  1DK1 A;  3OR7 C;  3SJQ C;  5LYJ A;  1FS0 G;  1IXB A;  1BCC H;  2Z3Y A;  2JEU A;  4CC6 A;  4PA6 A;  4JI0 O;  5KAF Z;  1NJI W;  1Y67 A;  2JIZ G;  2QSA A;  4UVA A;  1Q5O A;  3IJ4 A;  3SGI A;  4LNU A;  1FKA O;  2GSM B;  5IDJ A;  3ZRS A;  1EZV H;  2P90 A;  5JJE B;  4YIO A;  1VAR A;  5KUK A;  4KL1 A;  3RYF A;  3E22 B;  5LGU A;  5KA5 A;  4L8J A;  2DW4 A;  3BA8 A;  1IBM O;  4WFF A;  5FNV A;  3THO A;  1DF4 A;  4AHC A;  2WLM A;  1SQQ H;  3ZIA G;  1FPO A;  1HP8 A;  1L0L H;  5EK0 A;  3RFR A;  4U3J B;  2Z5U A;  4U3F H;  2Y69 B;  3N2K B;  3K0D A;  4TV9 B;  4OPH A;  5EC1 C;  5K1P A;  4DR2 O;  1YTF B;  5LBQ A;  1XNQ O;  1SA0 B;  4JTC B;  3ABU A;  5IWA O;  2LFS A;  4I50 B;  5IYC O;  1Y66 A;  4DR4 O;  1XDC A;  4JI6 B;  2FYU H;  1MNG A;  1N34 O;  1B06 A;  1VEW A;  4UCU A;  4XDK A;  3JCU Z;  4R6Z A;  5GTH Z;  3S3W A;  1HR0 O;  3D36 C;  2OCC B;  4I4T B;  3JSN A;  1YHQ V;  2DYR C;  4K35 A;  4JI1 O;  1VF6 A;  4EFB A;  1BS3 A;  5B1A B;  4U3J A;  2N04 A;  3H1J H;  4TV9 A;  4KFM A;  3QG5 A;  1SA0 A;  5FPO A;  2P22 C;  4PHZ A;  3JAK A;  2PF4 E;  3AG1 C;  2EIK C;  4GX5 A;  1YF2 A;  4WF9 V;  4B08 A;  2VQF O;  4CH6 A;  1BHA A;  1Q8I A;  4B3R B;  3CB2 A;  2FB5 A;  3D8C A;  4X64 B;  1VF5 B;  5EBM C;  2CTR A;  2QTO A;  1OCC B;  4MVU A;  1JMK C;  1R3J C;  3L72 H;  3O65 A;  4FM1 A;  4PI2 A;  1URF A;  1SF9 A;  4I4T A;  3MHH C;  2IM9 A;  3K5M A;  2XAJ A;  5CBH A;  3UO3 A;  2F4V B;  2YIB D;  1FXK C;  2VWK A;  1AP5 A;  3AK1 A;  3OD4 A;  3IGA C;  5D5Q A;  2RCV A;  2K9P A;  4X62 B;  3LDD A;  2Q68 A;  4TUY B;  1OZ0 A;  2H94 A;  5KHJ A;  3SJA C;  2KB1 A;  4BW9 A;  4J10 A;  2ZKO A;  4UV9 A;  4Z1M G;  2PTM A;  5JVD B;  2W0X A;  4QE7 A;  5TIS Z;  1Y6X A;  2DYS C;  3SYA A;  2YC0 A;  4E2L A;  4JI4 O;  2UU9 O;  4LF9 O;  3BAA A;  5JH7 B;  3RN4 A;  1GN2 A;  1K9M W;  3FYI B;  1AI4 A;  2QWO B;  2AXT Z;  2VRZ A;  1LR1 A;  3B77 A;  1YCI A;  2E74 B;  3FAV B;  2ZE7 A;  4IL6 Z;  3MDS A;  2N74 A;  1V55 C;  4EFE A;  5GON B;  5DED A;  2R9I A;  4TUY A;  4DO2 A;  4TSF G;  3IAY A;  1EZJ A;  1WA8 B;  1MSW D;  1HNZ B;  4I5S A;  1N0J A;  3F7V C;  4MVZ A;  5CN0 A;  4AQY B;  5JVD A;  1KP2 A;  2ARH A;  5CA0 B;  1DGS A;  3ABT A;  1VQ5 V;  4GKJ O;  2LQT A;  2WPD G;  3WFV A;  4DW0 A;  5JH7 A;  2Q67 A;  4DUZ O;  2YIC A;  3C90 A;  1ORQ C;  3JSL A;  2B5U A;  3FAV A;  3OUS A;  3A8T A;  2Q4P A;  2WA3 A;  1Z2G A;  1NS1 A;  2IJI A;  1IX9 A;  5GON A;  4DV5 O;  1WA8 A;  2OWO A;  1EFR G;  2BTQ B;  4JYA O;  4LF5 O;  2YIA A;  4OX9 B;  3ZN1 A;  3OEE G;  4PA4 A;  4MVQ A;  3E8B A;  4X89 A;  1XOU A;  5CA0 A;  3CD6 V;  4CS2 A;  2Q0O C;  4LH6 A;  3Q4H B;  1R1B A;  3HR0 A;  1THZ A;  1A32 A;  2QR4 A;  2F1M A;  4GT1 A;  5KMG B;  3EFF K;  1TA8 A;  1P49 A;  4CS4 A;  5JCO C;  3CCU V;  2ZE6 A;  1H2L A;  4X88 A;  3W7W A;  5B1B C;  2QEX V;  2ZNI A;  2OYQ A;  1Q43 A;  3P3N A;  4UXN A;  1ARO P;  3ZRX A;  4F6R B;  4X8A A;  3DC5 A;  2QTS A;  3BY6 A;  3ZMV A;  3SYO A;  2BTQ A;  1NVP B;  2UUC B;  4JZ2 A;  4JI5 O;  1N0N A;  2QKA A;  1D5A A;  4TV8 B;  2X7R B;  5LOV B;  3Q4H A;  1XQ8 A;  4RO2 A;  2UUA O;  1Y76 A;  3BHP A;  2GUZ B;  4CBC A;  2GDS A;  2PI4 A;  1FJG B;  2DWD C;  5H6R A;  3OM3 B;  1O9H A;  2EIN C;  5KMG A;  2H3O A;  2DYR B;  1NR7 A;  5BR8 B;  5DEC A;  3CCE V;  3G71 V;  2CDY A;  4LF8 O;  4HNA B;  2NLJ C;  1S72 V;  4LF4 O;  1O9G A;  4LFB O;  3P30 A;  4U7O A;  4F6R A;  3AG1 B;  2UXD O;  1CXZ B;  2EIK B;  4FZ1 A;  3C3T A;  1XBL A;  1AJP A;  3ZJZ A;  1K5S A;  3HPL C;  1US6 A;  1AR5 A;  2RQ6 A;  4TV8 A;  3FFQ A;  4DV4 B;  3ZMU A;  3H1H H;  2EJ7 A;  3SJC C;  2V4D A;  3K03 A;  3L73 H;  1VQP V;  3AK2 A;  1JPX A;  3J81 N;  2GUZ A;  1N4C A;  2ZIO A;  1H8E G;  2BTO A;  3D36 A;  3WB2 A;  3KKY A;  1RPR A;  2V1D A;  4JI0 B;  5LHH A;  1SQV H;  1AJN A;  1R6N A;  2M7W A;  1FXK B;  3OUF A;  4HAM A;  2IBZ H;  1AI7 A;  1HDJ A;  3M99 B;  4HNA A;  3ETG A;  3ETD A;  4N21 A;  1CP9 A;  1ZSP A;  3FX7 A;  1K73 W;  1GAX A;  1SQG A;  2QKC A;  3ETE A;  3ZX6 A;  1I0H A;  4UCO A;  3UQ8 A;  1IBM B;  2CGO A;  5LMN O;  5JWP A;  2DYS B;  1T5E A;  4RAI A;  5K1X A;  4FM0 A;  5LMU O;  2YIB A;  5L3D A;  2CTQ A;  5CBF A;  1K3E A;  2ZIN A;  1YTF D;  2IH3 C;  1F4N A;  3JD4 A;  4X1I A;  3T1H O;  1XMO O;  4NXM O;  2NR5 A;  3M8A A;  1PNM A;  2GV9 A;  1FXK A;  1V55 B;  1XNQ B;  1TUB B;  4DR2 B;  3L70 H;  5B1N A;  4P30 A;  1ENV A;  4JTA B;  4IT5 A;  1AIL A;  3CRR A;  3VBB A;  5IWA B;  5IJ9 B;  2X6A A;  1PPJ H;  3JAW A;  1HNX O;  4DR4 B;  3RYC B;  2JEX A;  1Y4M A;  1N34 B;  3OMN B;  1GH6 A;  3CC7 V;  4PDL A;  5B3S C;  2EUL A;  1HR0 B;  5IY5 C;  3A0B Z;  3W7S A;  3B8N A;  4JI1 B;  1NR1 A;  4NTY A;  5EBL C;  3WB1 A;  3OR6 C;  1XL4 A;  4UFZ A;  3SPH A;  3E8F A;  3ZMS A;  4FLW A;  2NNU A;  1TUB A;  2W6J G;  1K7D A;  4UB6 Z;  3FB5 C;  5H6Q A;  3CCV V;  3SYQ A;  4FIP C;  1VP7 A;  2ZDI C;  2DJV A;  5IJ9 A;  1RSO B;  4X65 O;  2VQF B;  4UCR A;  3SR2 C;  2V7Q G;  3RYC A;  3WB0 A;  4RUE A;  3K5O A;  1GN6 A;  1YSC A;  1NZ6 A;  3JAM N;  1DLB A;  3B4S A;  1UJW B;  3DXR B;  3DTU B;  1YJN V;  5BZB A;  5LGN A;  2Y0P A;  2RJZ A;  3QNE A;  4DV2 O;  2WLK A;  1EM1 A;  3BCC H;  4JZG A;  5KUM A;  1I7F A;  5B1B B;  2E76 B;  1R73 A;  1LUW A;  1I5Y A;  4JYC A;  2R72 A;  1RSO A;  4O2A B;  1G1X B;  4FK5 C;  4O4J B;  4OPA A;  2R9A A;  1OCZ C;  1EBO A;  4JI4 B;  3CCM V;  1VQ7 V;  2UU9 B;  2HR3 A;  4LF9 B;  4CZZ A;  4JI7 O;  4NVP A;  3DXR A;  4DYL A;  3BEH A;  3CCS V;  1XL6 A;  1AB3 A;  2LW1 A;  4HYO A;  4MS2 A;  5EIB D;  1WNS A;  4X1K B;  3K9S A;  2ZR2 A;  1VQ4 V;  4X9Q A;  3ZED A;  1Q6U A;  3STL C;  5CB4 B;  1XNR O;  1QLE C;  4FZ0 A;  1F23 A;  2XOK G;  3UCS C;  1SQX H;  4O2A A;  1V54 C;  3M7M X;  4PDV A;  4ABM A;  4RWU A;  1SRY A;  3QVN A;  3J80 N;  4K8Z A;  2P6J A;  4GKJ B;  4LFC O;  3TET A;  1Q3E A;  3ZHT A;  1XMQ O;  2P4V A;  4KXR A;  4UCV A;  4DUZ B;  3UKM A;  1KUQ A;  1WB8 A;  3SYP A;  3VQX A;  2JGU A;  1S0V A;  4X20 A;  1S5J A;  4J7K A;  2IH1 C;  1WP7 A;  2DN9 A;  2ODM A;  4MVR A;  1H2S B;  3T2M A;  2IU0 A;  3AG4 C;  3KZI Z;  3AK3 A;  1FXV A;  5FLX N;  4YJ3 B;  4W4K A;  3TCU A;  5CB4 A;  3AG2 C;  3HKB B;  4DV5 B;  3CPW U;  2A06 H;  4WFG A;  4JYA B;  3K5L A;  4JV5 O;  2OT5 A;  3TXS A;  4LF5 B;  2BSK B;  1M1K W;  1K92 A;  1VQO V;  1XEQ A;  5LP6 C;  1VQ8 V;  1HNW O;  1JCH A;  1K34 A;  5KX5 B;  1M56 C;  1FFX B;  4TQD A;  2YUA A;  1L1F A;  3GB7 C;  3E22 A;  2X0L A;  1GN3 A;  5FPR A;  4X66 B;  1LUV A;  5KHK A;  1P84 F;  2QWR B;  4PA3 A;  3BVO A;  4CH4 A;  1DTO A;  4BAY A;  3H1I H;  4DRX B;  2ZD9 A;  1NVP D;  4JAV A;  1SS3 A;  2ILM A;  3LNM B;  4YJ3 A;  2PY5 A;  5BMV B;  3HKB A;  1ZLZ A;  1YI2 V;  1MA1 A;  4JI5 B;  2BSK A;  3N2K A;  1KKD A;  4FLX A;  1YIJ V;  2HG5 C;  4PI0 A;  5KX5 A;  3H1K H;  1PNL A;  4DR5 O;  1BZK A;  1FFX A;  3HKD B;  1MOF A;  1Q6I A;  4DR1 O;  4I50 A;  2UUA B;  3TK1 A;  5B3S B;  4D7T A;  2PYJ A;  5IY5 B;  4QNH B;  3K9A A;  5EYP B;  1AP6 A;  2YSU B;  5H5N A;  4CC5 A;  1QBZ A;  3J7A U;  1GM8 A;  1SET A;  2C2A A;  4DRX A;  4WFE A;  3KG2 A;  3OTO O;  4Q20 A;  2ETN A;  2KKW A;  2QM4 A;  1H2N A;  4IGG A;  4LF8 B;  1Z5V A;  4LF4 B;  4BIO A;  3F5W C;  4LFB B;  1JOY A;  5BMV A;  1SZT A;  1W0J G;  2UXD B;  2AZ2 A;  4CH3 A;  4DR3 O;  2CE4 A;  1KD1 W;  2LW7 A;  1SQB H;  4LC1 A;  4PA9 A;  5LL6 Y;  3QTC A;  2UXB O;  3HKD A;  4DV0 O;  1PL0 A;  2CUG A;  4Z2W A;  1WAZ A;  4HBN A;  4L87 A;  3CRC A;  1GKF A;  4P9P A;  3ZHU A;  4DXW A;  4ZIB A;  2FTK A;  2BOC C;  1QVG U;  1FFT B;  5IYD O;  2HLD G;  2QE7 G;  1M93 A;  3BFR A;  3R66 A;  4FLY A;  1XHX A;  3BPZ A;  4JYY A;  2LP7 A;  1MZE A;  1VF7 A;  3ZS8 C;  1VQM V;  1S5H C;  1VQK V;  2Z0A A;  4U7N A;  1M90 W;  2ZDI A;  1K8A W;  1RFY A;  2JDI G;  5EZY B;  3CSX A;  3JD0 A;  5LMN B;  4GX0 A;  3ZCC A;  1OCZ B;  5LMU B;  5HFL A;  4ZBM A;  4ZOL B;  4O4H B;  2IJJ A;  4P9O A;  2F23 A;  1NTM H;  4DR6 O;  1BT8 A;  3T1H B;  4UUJ C;  1BGY H;  2L35 A;  4J9Z B;  1XMO B;  4I55 B;  4AI8 A;  4NXM B;  1KYO F;  2VQE O;  4GYC B;  2GTS A;  1KQS U;  1YJ9 V;  4TOI A;  1M57 C;  4FLT A;  2HVJ C;  4CS3 A;  4K8X A;  2ZXW C;  1QLE B;  5JQG B;  4MW8 A;  5LHG A;  3AEI A;  1HNX B;  2IU3 A;  1V54 B;  1YXB A;  1NTK H;  3B09 A;  3RVZ A;  3ZN0 A;  5EZY A;  1AVM A;  3W7X A;  3O9O A;  4XDL A;  3WG7 C;  2XAQ A;  3CRM A;  4ZOL A;  3E8H A;  2YXY A;  2X6B A;  4O4H A;  1N33 O;  4O2B B;  2QJ1 A;  1JR9 A;  2GBO A;  4I55 A;  4YXW G;  3LDC A;  4ZI7 B;  4X66 O;  2NN4 A;  3U0Z A;  3AG4 B;  4FFK A;  2Y4U A;  3ML0 A;  2P06 A;  3A0R A;  1L8D A;  3A0H Z;  3AG2 B;  5JQG A;  4X65 B;  1CEZ A;  1NBM G;  4X1Y B;  5CMU A;  1IBL O;  1I94 O;  3BRC A;  3K5N A;  2DQ3 A;  2QDO A;  3K58 A;  1FD9 A;  4J11 A;  4YY3 O;  5LHI A;  1IDS A;  2XUM A;  1M56 B;  3ICX A;  1QR9 A;  3OE7 G;  1YZB A;  4LP8 A;  5B5E Z;  4O2B A;  1SZX A;  3OTF A;  3ASN C;  4UVC A;  4K3A A;  1KP3 A;  2XT9 A;  1I08 A;  4KP4 A;  5L3E A;  4DV2 B;  2RN9 A;  4ZI7 A;  1AI6 A;  1COW G;  1B6Q A;  3E83 A;  4WFB V;  1LNQ A;  4H37 A;  2CH7 B;  3NR7 A;  5DM6 V;  1NQT A;  1B3Q A;  4X1Y A;  4PV1 B;  4QPJ A;  3L74 H;  1BSM A;  1QHT A;  1N36 O;  5HFM A;  1SER A;  4HZ3 A;  4I9W A;  4UCT A;  3ABL C;  2ZM6 O;  4H0L B;  4MVS A;  4BIU A;  2ZIM A;  4BWA A;  5BY1 A;  4OGQ B;  3G6E V;  3L71 H;  4B7K A;  5IYB O;  4JI7 B;  2AHY A;  5F2V O;  1NTZ H;  2EIL C;  4LBE C;  4EEQ A;  4E4E A;  5J2U B;  2A7W A;  2WLN A;  3F7Y C;  1PM9 A;  3ZMT A;  3ZHQ A;  5LOV A;  1K4C C;  1ZWI C;  1WPX A;  3JAT B;  4LF6 O;  1PD3 A;  3CWB H;  3ZRV A;  5JJN B;  1M9N A;  1DF5 A;  3E86 A;  4JPR A;  1XNR B;  2YI8 A;  2CH7 A;  2ZR3 A;  3LSQ A;  1JVM A;  2P4K A;  2VWJ A;  3KCY A;  1EN4 A;  4LFC B;  1QQC A;  1JJ2 U;  1AI5 A;  2RMK B;  3K59 A;  2LO1 A;  1YJW V;  3F5T A;  2P7T C;  1XMQ B;  3CME V;  3JAR B;  5J2U A;  4WFH A;  5FL7 G;  3ABK C;  3APO A;  4MVO A;  3UO2 A;  2BOB C;  1ZAU A;  4QIW F;  2UXX A;  3JAT A;  3A2F A;  2XAS A;  4YHH O;  3DC6 A;  2R9R B;  3D3I A;  2UUB O;  3R65 A;  5ITZ B;  3E89 A;  4JI3 O;  5B66 Z;  2QM7 A;  2CAZ C;  3WU2 Z;  4JV5 B;  4UVB A;  4UB8 Z;  1J5E O;  3SJB C;  1HNW B;  3X2Q C;  1QCE A;  1NU1 H;  1KMI Z;  3IC7 A;  3AG3 C;  4WFA V;  4NXN O;  4WCE V;  5C93 A;  2B1I A;  1IZ3 A;  2QKS A;  4BR6 A;  3VQY A;  2ZQM A;  3JAR A;  2OCC C;  1H38 A;  3T4D A;  3K79 A;  2HHH O;  1E1Q G;  5JJJ B;  2Q69 A;  4B3M O;  3CHX A;  3K0G A;  1F4M A;  2Y4T A;  2WLH A;  1M57 B;  4TWK A;  2F66 C;  3T4Z A;  1SQP H;  5J2T B;  5ITZ A;  3RVY A;  4NKG B;  1XRE A;  1TGO A;  4MTF A;  4C7U A;  3VQV A;  4FJC C;  2B9Z A;  4R7C A;  2RDC A;  1IBK O;  4I0X B;  4DR5 B;  1JFF B;  4DR1 B;  1GM7 A;  2ADP A;  2XTA A;  3MAQ A;  3WG7 B;  1PL4 A;  3SDL A;  1HW7 A;  2YXL A;  1ZL8 B;  5A9G A;  1ZX3 A;  4J42 A;  4JI2 O;  5L3B A;  3E2E A;  2H8P C;  3ZHS A;  2PI5 A;  3IFX A;  3OTO B;  3ZHR A;  5CA3 A;  1SQF A;  2HJD A;  4A5U B;  3RW0 A;  5KHI A;  2CK3 G;  2UXN A;  2GHY A;  5J2T A;  3DGE A;  2EX3 A;  2F93 B;  1VIB A;  2DWE C;  1RM1 C;  4DR3 B;  4JI8 O;  3LNN A;  2Q7E A;  3W7U A;  2D3O W;  4IIJ B;  4ASU G;  2UXB B;  4I0X A;  3CE2 A;  4LF7 O;  2KG7 B;  4DV0 B;  2BCC H;  4G2K A;  2E5L O;  2MK3 A;  3G67 A;  3EVK A;  4J9Y B;  4MW3 A;  4DUY O;  3T1Y O;  3ZHV A;  3ASN B;  4G27 B;  2PUS A;  2JJ2 G;  1S77 D;  3ZRW B;  4UV8 A;  4PD4 F;  1OHH G;  4LCU C;  2EJR A;  3UM7 A;  2QWQ B;  4NYK A;  4MTG A;  2ZNJ A;  2DOS A;  3QO5 A;  1D5N A;  2EIN B;  2AHZ A;  1Q82 W;  2QWP B;  5JCO A;  2F95 B;  2JRI A;  2Q6A A;  3JAL B;  3K57 A;  1N32 O;  4QE9 A;  3CS5 A;  1WPB A;  5D5P A;  2EZP A;  5E1A C;  1BL8 A;  2YID A;  5DN6 G;  5B1O A;  1R3K C;  1B04 A;  4R8C A;  2OIG A;  4IIJ A;  4O4I B;  2ZE5 A;  3BA9 A;  1S3J A;  2KG7 A;  4J80 A;  3ABL B;  3SPJ A;  4B7E A;  4F6E A;  1JQ0 A;  2Q9L A;  4DV1 O;  2B1G A;  3MD0 A;  4O4J A;  1XIL A;  1H2K A;  4DR6 B;  2EIL B;  3OT7 A;  1IVS A;  3T1C A;  3CXC U;  3N27 A;  2JGD B;  2ZCE A;  4LFA O;  1EN5 A;  2AZ0 A;  3ZRW A;  2VQE B;  3RBZ A;  1I5X A;  2FL4 A;  3JCZ A;  4EB6 B;  1M5I A;  1KEC A;  5KHH A;  1GM9 A;  1AR1 B;  5C8Y B;  1QNM A;  4QGP A;  4X1K A;  4H13 B;  3FB7 C;  1W0K G;  3JAL A;  2WWW A;  4DR7 O;  4GKK B;  1KU9 A;  4PA7 A;  2P5O A;  3OFN G;  3FB6 C;  1SES A;  4KHP O;  4EKW A;  2A3Q A;  4YIP A;  5GTI Z;  4O4I A;  2HFE C;  1MSD A;  3SPI A;  1V9P A;  2JK5 C;  3CEI A;  3RGB A;  2E75 B;  2ITC C;  2ITD C;  1NI8 A;  1L0N H;  2QA4 V;  1N33 B;  3DSQ A;  3ASO C;  4MTX A;  4FFB B;  1JJO A;  1F51 A;  3ABK B;  4K0K O;  2JGD A;  1GTO A;  1FXH A;  4B3S O;  3FKS G;  1PNK A;  1Q81 W;  4EB6 A;  1AR4 A;  3CJH B;  3OAA G;  1PKX A;  5C8Y A;  4DW1 A;  1UFI A;  4GCZ A;  2WLI B;  1Z5W A;  3JAK B;  1YDX A;  3RWR D;  1IBL B;  4FLV A;  1RP3 B;  1I94 B;  4O4L B;  3G80 A;  3X2Q B;  1FYJ A;  4YY3 B;  4RUF A;  2WA4 A;  4DV7 O;  3B8M A;  3K06 A;  3CCR V;  4NR1 A;  4NTW A;  3AG3 B;  1KC8 W;  1OV9 A;  1ZTE A;  4DV6 O;  4FFB A;  5LXT B;  4W4L A;  4B3T O;  4PDM A;  1H8H G;  4OXS A;  4PDR A;  2YXH A;  5L3G A;  1GN4 A;  5H2F Z;  1IUR A;  1WB7 A;  5AG2 A;  4Q6G A;  1Q7Y W;  1GMG A;  3CJH A;  1QLN A;  3EHB B;  4JAS A;  2HJF C;  2BE3 A;  2KSD A;  4ZHQ B;  2WLI A;  2F43 G;  3I5D A;  2QWN B;  1UPG A;  4F4L A;  4O4L A;  4ICG A;  1N36 B;  4FPP A;  3FYE B;  1W2B U;  3LSU A;  2ZM6 B;  4PEL A;  4UCS A;  1GRJ A;  4LWS B;  2OTJ V;  1QVF U;  2Y48 A;  1OCR C;  3L9D A;  3G4S V;  2HKO A;  2YI9 A;  3MHS C;  5LXT A;  3CP1 A;  1P7B A;  4LF6 B;  3APQ A;  3JD2 A;  5EYP A;  4H33 A;  4JGS A;  2FKX A;  5IYZ B;  2A0L A;  5IJ0 B;  2Y0I A;  1K5Q A;  3P3P A;  4ZHQ A;  1WJZ A;  2YEV B;  1RM1 B;  3AG7 A;  3H1L H;  1EN6 A;  2OCH A;  1M4U A;  4KUM A;  1XHZ A;  4FVM A;  2D2C B;  1X4T A;  2EZO A;  2PGG A;  1D2D A;  3I55 V;  1BMF G;  3P32 A;  1Y74 B;  4LWS A;  4TQF A;  5BXZ A;  1PV0 A;  1VQ9 V;  4J7J A;  1NH2 D;  2EIJ C;  5IT9 N;  3JD1 A;  1K4D C;  1E79 G;  1KB9 F;  4DV3 O;  3ZMZ A;  2FML A;  1BHB A;  2CTP A;  1TVK B;  3QO7 A;  2QM8 A;  3JAS B;  3H01 A;  2AW9 A;  4J7Z A;  2HVK C;  4YHH B;  2Q73 A;  1ROP A;  3KCX A;  2UUB B;  4JI3 B;  5IYZ A;  5IJ0 A;  1OCO C;  1KKC A;  1MG1 A;  3EXA A;  3LDE A;  2IW5 A;  3RYH B;  2YEV A;  3RYI B;  1IXM A;  3CCQ V;  1J5E B;  1TUE B;  4Z1V A;  3IC9 A;  1HWY A;  3CMA V;  4NXN B;  2Q8V A;  2WLJ A;  2W0F C;  1FAF A;  3D3Q A;  1K97 A;  1Y74 A;  4GKK O;  4GX2 A;  4H44 B;  1Q90 D;  3HKC B;  2P67 A;  2MW2 B;  2WSS G; 
#chains in the Genus database with same CATH homology
 3JD3 A;  2OCC B;  1R73 A;  1YHQ V;  1I5Y A;  1JJ2 U;  2DYR C;  1G4Y B;  3K3W A;  1AI5 A;  4JYC A;  5B1A B;  1YJW V;  1NKD A;  2P7T C;  3E8G A;  3CME V;  4FK5 C;  4KFM A;  3K04 A;  1GK9 A;  4WFH A;  5FL7 G;  3ABK C;  1OCZ C;  4MVO A;  1EBO A;  2BOB C;  4QIW F;  3CCM V;  3AG1 C;  1VQ7 V;  2UXX A;  2HR3 A;  2EIK C;  4GX5 A;  4WF9 V;  4CZZ A;  2XAS A;  1BHA A;  3BEH A;  4TT3 G;  4FMT A;  2R9R B;  1XL6 A;  3D3I A;  3CCS V;  1P4R A;  3R65 A;  4HYO A;  2EIM C;  5EBM C;  3E89 A;  2QM7 A;  2QTO A;  1K33 A;  4MS2 A;  1OCC B;  4MVU A;  1R3J C;  3OGC C;  2ZR2 A;  4UVB A;  1VQ4 V;  3W7T A;  3ASO B;  3X2Q C;  1QCE A;  3MHH C;  3IC7 A;  2XAJ A;  3STL C;  5CBH A;  1QLE C;  1F23 A;  2XOK G;  3AG3 C;  4WFA V;  4WCE V;  5C93 A;  3OMA B;  4ZKI A;  4QPK A;  1FXK C;  1GO3 F;  2B1I A;  2IJK A;  1V54 C;  3IGA C;  3PJS K;  2QKS A;  2ZQM A;  4PDV A;  3LDD A;  2OCC C;  2Q68 A;  1H38 A;  3T4D A;  1SRY A;  2P6J A;  1OZ0 A;  3K79 A;  1Q86 W;  3TET A;  1E1Q G;  2H94 A;  2KB1 A;  2Q69 A;  3ABM C;  3K0G A;  1F4M A;  1S76 D;  4UV9 A;  4Z1M G;  2WLH A;  2LFR A;  3UKM A;  1M57 B;  4QE7 A;  4TWK A;  3SYP A;  5J9P C;  3T4Z A;  2DYS C;  3SYA A;  1S0V A;  3RVY A;  4E2L A;  2IH1 C;  2XAH A;  4JF3 A;  4MTF A;  4MVR A;  3T2M A;  2IU0 A;  4FJC C;  3AG4 C;  1K9M W;  4R7C A;  1FXV A;  3FYI B;  1AI4 A;  3TCU A;  3B77 A;  3AG2 C;  1GM7 A;  4JTD B;  3CPW U;  3WG7 B;  4WFG A;  1V55 C;  2OT5 A;  1M1K W;  1K92 A;  1VQO V;  1VQ8 V;  3CYO A;  2R9I A;  1JCH A;  4DO2 A;  4TSF G;  4MSW C;  1K34 A;  2EBO A;  1M56 C;  1MAB G;  5L3B A;  3E2E A;  1EZJ A;  2H8P C;  3I56 V;  2PI5 A;  3IFX A;  1VQ6 V;  5CA3 A;  2OTL V;  1G8M A;  1MSW D;  3RW0 A;  1VQL V;  1L1F A;  1CPY A;  3GB7 C;  4I5S A;  3F7V C;  4MVZ A;  2X0L A;  5CN0 A;  1KP2 A;  1J95 A;  1WLE A;  2CK3 G;  2DQ0 A;  2UXN A;  4PA3 A;  2GHY A;  3ABT A;  1VQ5 V;  1DTO A;  3DGE A;  3JYC A;  4BAY A;  2WPD G;  5EBW C;  2DWE C;  1RM1 C;  2ZD9 A;  3WFV A;  1NVP D;  1R6K A;  2XAF A;  1OCR B;  2Q67 A;  4JAV A;  5LGT A;  3W7U A;  4G28 B;  2D3O W;  1ORQ C;  4ASU G;  1N8R W;  3LNM B;  2B5U A;  1JX9 A;  3OUS A;  1YI2 V;  4G2K A;  1R3L C;  4BIZ A;  1RPO A;  2MK3 A;  1KKD A;  1YIJ V;  2HG5 C;  2XND G;  4JAU A;  4J9Y B;  4MW3 A;  2IJI A;  3ASN B;  4G27 B;  3LSS A;  1PNL A;  1E1R G;  2JJ2 G;  1S77 D;  1MOF A;  3ZRW B;  4UV8 A;  2X6C A;  3TK1 A;  1OHH G;  2Y69 C;  4LCU C;  1EFR G;  2A79 B;  2EJR A;  5B3S B;  3CCL V;  1NH2 B;  3UM7 A;  3ZN1 A;  3OEE G;  5IY5 B;  4MTG A;  4PA4 A;  4QNH B;  3LUT B;  3K08 A;  3SPC A;  4MVQ A;  3QO5 A;  3E8B A;  4X89 A;  3K9A A;  2EIN B;  3CCJ V;  2AHZ A;  1Q82 W;  2YSU B;  3CD6 V;  1QBZ A;  2WLL B;  1GM8 A;  1SET A;  4QJF B;  2C2A A;  2Q6A A;  4WFE A;  3KG2 A;  4RQF A;  4QE9 A;  4Q20 A;  2EZP A;  5E1A C;  1BL8 A;  1THZ A;  5DN6 G;  5B1O A;  1R3K C;  2EIJ B;  3F5W C;  4R8C A;  4GT1 A;  1JOY A;  3EFF K;  1S3J A;  3CCU V;  3ABL B;  1SZT A;  1W0J G;  3SPJ A;  1JQ0 A;  4X88 A;  3W7W A;  2B1G A;  3MD0 A;  1KD1 W;  5B1B C;  5GW7 A;  2XAG A;  2QEX V;  3CC2 V;  2EIL B;  4LC1 A;  4PA9 A;  3T1C A;  3CXC U;  4UXN A;  4XDJ A;  3SYC A;  1ARO P;  3ZRX A;  1OCO B;  5L3C A;  5B1A C;  4X8A A;  1PL0 A;  3ZRW A;  3RBZ A;  3BY6 A;  3ZMV A;  1I5X A;  3SYO A;  3JCZ A;  4L87 A;  1NVP B;  1GKF A;  1AJQ A;  4P9P A;  4DXW A;  1KEC A;  4RQE A;  2FTK A;  5EC2 C;  1GM9 A;  2BOC C;  1AR1 B;  2ZXW B;  1QVG U;  1FFT B;  2X7R B;  5IYD O;  2HLD G;  1W0K G;  2QE7 G;  3FB7 C;  2WLL A;  4RO2 A;  2WWW A;  4PA7 A;  2LP7 A;  3FB8 C;  3FB6 C;  3OFN G;  4CBC A;  1VQN V;  1SES A;  2PI4 A;  4EKW A;  2DWD C;  5H6R A;  3OM3 B;  1VQM V;  2IJH A;  5H9C A;  4JYB A;  5CBG A;  1S5H C;  2EIN C;  1VQK V;  2DYR B;  1NR7 A;  2HFE C;  3SPI A;  4U7N A;  1M90 W;  1OCC C;  2JK5 C;  2ZDI A;  3CCE V;  2ITC C;  3G71 V;  2ITD C;  2QA4 V;  1K8A W;  3ASO C;  4MTX A;  3OEH G;  4XBF A;  2JDI G;  1F51 A;  2NLJ C;  3JD0 A;  3QO8 A;  1S72 V;  3ABK B;  4GX0 A;  3ZCC A;  3P30 A;  1GTO A;  1FXH A;  1OCZ B;  4U7O A;  5HFL A;  4ZBM A;  3AG1 B;  2EIK B;  2IJJ A;  3FKS G;  1H2G A;  1PNK A;  1R3I C;  4P9O A;  1Q81 W;  1AJP A;  3OMI B;  3ZJZ A;  1K5S A;  3HPL C;  4UUJ C;  3OAA G;  4J9Z B;  3SPG A;  1PKX A;  2EIM B;  3ZMU A;  4GCZ A;  1YIT V;  2WLI B;  1VQP V;  3K03 A;  1JPX A;  1KQS U;  1YJ9 V;  1M57 C;  1H8E G;  3X2Q B;  2HVJ C;  3D36 A;  2K1E A;  3GWO A;  4P2Z A;  4RUF A;  4BW5 A;  1RPR A;  2V1D A;  2ZXW C;  3B8M A;  3K06 A;  1QLE B;  2W6I G;  3STZ C;  3AG3 B;  3CCR V;  5LHH A;  4MVM A;  1KC8 W;  4MW8 A;  1AJN A;  1R6N A;  5LHG A;  2M7W A;  3AEI A;  2WAM A;  1FXK B;  3OUF A;  2IU3 A;  4HAM A;  1V54 B;  3RVZ A;  1AI7 A;  3ZN0 A;  3W7X A;  3E35 A;  3M99 B;  1QR8 A;  3ETG A;  4PDM A;  1H8H G;  3NXS A;  4OXS A;  4XDL A;  4MT8 A;  4PDR A;  3ETD A;  3WG7 C;  5L3G A;  4N21 A;  2XAQ A;  1CP9 A;  1K73 W;  3E8H A;  2X6B A;  3ABM B;  4GX1 A;  3OW2 U;  1Q7Y W;  4MTO A;  1GMG A;  5L3F A;  3VOU A;  3ETE A;  1QLN A;  4R50 A;  2ATK C;  3EHB B;  4YXW G;  5KA6 A;  2DYS B;  2JJ1 G;  4JAS A;  4RAI A;  2HJF C;  2WLI A;  3LDC A;  5L3D A;  2A9H A;  2F43 G;  5CBF A;  1K3E A;  4F4L A;  1YTF D;  2IH3 C;  3AG4 B;  4FPP A;  3FYE B;  1F4N A;  3JD4 A;  3ML0 A;  1W2B U;  3A0R A;  3HB3 B;  4PEL A;  3AG2 B;  1PNM A;  2OTJ V;  1CEZ A;  1QVF U;  2Y48 A;  1NBM G;  1OCR C;  1FXK A;  1V55 B;  4N23 A;  5CMU A;  3G4S V;  3CC4 V;  2HKO A;  2DQ3 A;  3MHS C;  5B1N A;  4P30 A;  1ENV A;  3OR7 C;  5KUM A;  3SJQ C;  4JTA B;  1FS0 G;  5LHI A;  3CP1 A;  2Z3Y A;  1M56 B;  1P7B A;  2JEU A;  4PA6 A;  3VBB A;  1NJI W;  2X6A A;  2JIZ G;  1QR9 A;  3OE7 G;  3JD2 A;  4LP8 A;  4UVA A;  4H33 A;  3ASN C;  4JGS A;  2GSM B;  4UVC A;  5IDJ A;  2JEX A;  1Y4M A;  2A0L A;  3OMN B;  1KP3 A;  3ZRS A;  1K5Q A;  3CC7 V;  4PDL A;  2P90 A;  4KP4 A;  5B3S C;  5L3E A;  2YEV B;  1RM1 B;  1AI6 A;  5KUK A;  1COW G;  5IY5 C;  4KUM A;  1B6Q A;  3E83 A;  3W7S A;  5LGU A;  5KA5 A;  3B8N A;  4WFB V;  2DW4 A;  1NR1 A;  1LNQ A;  4H37 A;  4WFF A;  2EZO A;  5EBL C;  3I55 V;  3OR6 C;  1BMF G;  3P32 A;  5DM6 V;  1XL4 A;  1NQT A;  1DF4 A;  3SPH A;  3E8F A;  4QPJ A;  3ZMS A;  1VQ9 V;  2NNU A;  1NH2 D;  2W6J G;  1K7D A;  2EIJ C;  2WLM A;  3FB5 C;  5H6Q A;  3ZIA G;  3JD1 A;  1K4D C;  5HFM A;  3CCV V;  1E79 G;  1SER A;  4HZ3 A;  3ZMZ A;  4I9W A;  5EK0 A;  3SYQ A;  3ABL C;  1BHB A;  4FIP C;  4MVS A;  4BIU A;  3G6E V;  3QO7 A;  2ZDI C;  2QM8 A;  3H01 A;  2Z5U A;  5IYB O;  2Y69 B;  2HVK C;  2AHY A;  3K0D A;  5EC1 C;  1YTF B;  2EIL C;  2V7Q G;  4LBE C;  5LBQ A;  1ROP A;  2WLN A;  3F7Y C;  4RUE A;  3ZMT A;  1K4C C;  1OCO C;  1ZWI C;  4JTC B;  1WPX A;  1MG1 A;  3ABU A;  3LDE A;  1YSC A;  2IW5 A;  2YEV A;  1IXM A;  1PD3 A;  2LFS A;  5IYC O;  3CCQ V;  1DLB A;  1UJW B;  1TUE B;  3DTU B;  1Y66 A;  3ZRV A;  1YJN V;  1M9N A;  1DF5 A;  1HWY A;  3E86 A;  4JPR A;  3CMA V;  2ZR3 A;  2WLJ A;  2W0F C;  5BZB A;  5LGN A;  1K97 A;  4XDK A;  4GX2 A;  3LSQ A;  3QNE A;  2WLK A;  1JVM A;  2P67 A;  4R6Z A;  2WSS G;  5B1B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...