3CD6V

Co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3cd6V00
1VQOV 1VQ6V 1K9MW 4WFBV 3G71V 1KC8W 1N8RW 3CCQV 2OTLV 3CCLV 4WF9V 1M1KW 1VQ5V 3I55V 4WCEV 1VQLV 1JJ2U 1YITV 1K73W 3CPWU 3CC4V 1Q7YW 3CCVV 3CMAV 2D3OW 1R73A 4WFAV 3CC7V 1VQ8V 1YI2V 3CCUV 2QA4V 1KD1W 2QEXV 1VQKV 1M90W 3CC2V 1W2BU 1Q82W 1NJIW 1YJNV 1YJ9V 1VQ4V 3I56V 3G6EV 1S72V 3CCJV 1Q81W 3CCEV 1VQ7V 1YIJV 1QVGU 3CCSV 3OW2U 1VQ9V 1QVFU 3CD6V 3CCMV 1YJWV 1YHQV 1KQSU 1VQPV 1VQMV 2OTJV 1K8AW 3G4SV 1VQNV 3CXCU 3CMEV 3CCRV 5DM6V 1Q86W
chains in the Genus database with same CATH superfamily
2DYSC 3CCQV 2QJ1A 3BRCA 2QKAA 2UXBO 2KSDA 3E89A 5KUMA 1S0VA 2JEUA 4W4LA 1Y6XA 3ZMTA 4ZHQA 1W2BU 4PA6A 2BOBC 1EBOA 4RO2A 3ZRWB 3CRAA 5B3SB 1QVGU 1YIJV 2PYJA 3DGEA 2P06A 3B40A 3JD2A 1QR8A 4L87A 4I0XB 1KBHA 3KKYA 1ENVA 5K1XA 4YJ2A 1S5LZ 4G27B 2P6JA 2ZDIA 2EJ7A 4J42A 4JAAA 2EZPA 2E75B 1FXHA 4OX9O 2G38A 4EFBA 2W6JG 1L1FA 4DV6O 4YJ3A 4X64O 4MSWC 3SJQC 1EN4A 1L8DA 1Q5OA 4DR4O 4CS4A 3DC5A 4UV9A 5TISZ 3CB2A 1JVMA 3STLC 2QR4A 3B2EE 2PTMA 4FMTA 3OR6C 5BY1A 5IYZB 1YI2V 2DYSB 4MW8A 4UVBA 1IX9A 4PA4A 3MAQA 4J9ZB 1GKFA 2ZCEA 2Q8VA 5GTHZ 3HKCB 3JD3A 3O9OA 2QGNA 1VF6A 4UB8Z 5CBGA 4EEQA 3G6BA 5CA1B 1T5EA 1AP5A 2HR3A 3A0BZ 4O4HA 4FM0A 1OJHA 3RGBA 1M9NA 1ZSPA 2UU9B 4XDKA 3FB7C 2VS0A 2YC0A 5L3EA 1SQVH 2XNDG 1URFA 5LMNO 2R9IA 1FFXB 1YDXA 1AP6A 4U7NA 4OPAA 5JQGB 3ZIAG 2WLLA 1YITV 1WP7A 3KCXA 3LUTB 4ICGA 5BXZA 5KMGA 1IXBA 1M4UA 3JATA 1UFIA 4D6TH 1EZJA 4DR6B 2UXXA 3BFRA 5EC1C 5EYPB 4P9OA 1H2GA 5KAIZ 5A2QN 3IGAC 3AEIA 2XAJA 2GDSA 1SETA 1M1KW 1MZEA 1VQLV 1AB3A 3G67A 1KYOF 2ZE6A 2W0FC 3RVZA 1ZL8B 2QWQB 2PZSA 4GUNA 3S3XA 2GTSA 3BA8A 2H3OA 1Y76A 1KKDA 4B7KA 3L74H 3L73H 1SESA 1BL8A 3WFVA 3CRMA 4JI2B 2KG7A 1SQXH 1M56C 2Y0PA 2JEXA 2HFEC 4JI6B 3CWBH 4H0LB 3ZEDA 1RSOB 3PN1A 2LW7A 1P7BA 2QA4V 1M5IA 4RWUA 4DO2A 1PP9H 4DV0B 2PYLA 4R7CA 1JFFA 4DRXA 4LFAO 1H2LA 3W7UA 1XMQB 2CH7A 5J2UA 1MMMA 3FB5C 2DWDC 1K9MW 1MOFA 2LP7A 3P32A 3FB8C 3GWKC 3ZRVA 4UFZA 4FZ0A 3FAVB 1H2NA 1M57B 3ZX6A 2YSUB 3JALA 5IE9A 1COWG 2MW2B 4TUYB 5DEDA 2EIMC 2UXBB 3HKBB 3CS5A 1MZFA 2KB1A 3OMAB 4K3AA 4QE7A 5EZYA 2GSMB 3ABMC 3DXRA 4JGSA 5LA6A 1ZAUA 3LNMB 2NNUA 1K5QA 4FVMA 4IGGA 1AJNA 3LNNA 3MHHC 3N2KA 1EFRG 2QWOB 3K5OA 3Q4HB 4E4EA 4JI0O 2Q7HA 4OX9B 4UCOA 4I55B 4GYCB 4DV6B 4ABMA 2Q67A 3SJCC 2JS3A 2E3CA 2VQEO 2E76B 4X64B 1R6NA 2Q6AA 2FMLA 3K9SA 3J81N 3ZHSA 1BSMA 3VOUA 2ZXWB 4WFHA 3SPCA 2AZ2A 3SJBC 4F6RB 2GV9A 3K9AA 2YEVB 3K03A 3ZRWA 1K7DA 4U3FH 5IJ0B 3RT3C 5EC2C 4AQYO 3VQWA 2ZDIC 1DTOA 5LGNA 4LFBB 3ABMB 4I0XA 1VF5B 2ZNJA 1YJ9V 2WLIB 4MVMA 1CPYA 3ASOC 3DTUB 2FKXA 2ADPA 2Y4UA 1LR1A 4CBCA 3CPWU 1VEWA 1HDJA 1WB8A 2Z3YA 1HNWO 3DSQA 4XBFA 4KP4A 4UVAA 3ABTA 3AG1C 1WA8B 2AZ0A 2ZR3A 1XI1A 5LMNB 4DW0A 3OGCC 1VF6C 3CCRV 3C3SA 2K9PA 1MABG 1VQ5V 5JJNB 5JCOA 5KX5B 4UV8A 1V55C 3HKCA 2WLJA 1Q3EA 1I7FA 1GN3A 2ETNA 3QF7A 4J80A 3ZMVA 5CA1A 1YXBA 4YJ2B 4BIZA 2CTPA 1DF4A 1QBZA 1X4TA 1IBLO 3CEIA 3QO7A 4JAUA 4LBEC 4ZIBA 1PNLA 4I9QA 2ILMA 4QPKA 4JYAB 4LNUB 2WLKA 3ZHQA 3E8GA 1HP8A 3K79A 4H13B 4ZKIA 5JQGA 4D7TA 2YIDA 2OCHA 2UUAO 4PDRA 5B66Z 1YVWA 2ITCC 3CCSV 1Q90D 1I5YA 1GMGA 4DUYO 3MHSC 4FK5C 3H1JH 4O2BB 1I0HA 4ZBMA 5H6RA 1N0NA 4ZI7A 5EYPA 3OTOO 4DK0A 1IURA 4RQFA 4UUJC 1R3KC 1CXZB 4MVZA 2IM9A 4FZ1A 1NR7A 5DECA 1AI5A 4DK1A 4NXMO 1GM7A 1QQCA 1V55B 2GUZA 1IBMO 1N32O 4O4HB 1RPOA 3OW2U 2OTJV 1ZL8A 3G4SV 2XASA 4B3TO 3FB6C 3OR7C 2VQFO 2NR5A 3APQA 1DF5A 4IT5A 1QHTA 2AXTZ 2YIAA 3O65A 2Q9LA 3TXQA 2HVKC 4QPJA 1PL4A 1RSOA 3K0DA 2IJKA 4WCEV 3JATB 2Y4TA 3EHBB 2UUBO 4U7OA 3QO8A 5LYJB 4LFCB 3CCUV 3ZMSA 3SGIA 1S5HC 2DW4A 4JI4O 1ZUQA 4I9WA 4LWSB 4JI5O 4JI0B 4LH7A 3FAVA 4NVPA 3K57A 2YXHA 2VQEB 2R70A 3RW0A 1Y76B 5FLXN 3FX7A 3JAWA 3HKBA 4BAYA 2KG7B 1EN6A 1XOUA 1YJNV 1F4NA 3A0HZ 3EFFK 1WPXA 2HG5C 1VQ9V 2IJJA 3WB0A 3T4ZA 3U0ZA 5LMUB 4AQYB 4X88A 5B1BB 1SQQH 1JFFB 2OIEA 2WLHA 3CX5F 4PI2A 1L0NH 4WFGA 1QNMA 2IU3A 1XREA 3Q4HA 4GKJB 2XUMA 1IVSA 2YIBA 3KCYA 4GX2A 4I55A 2HJDA 4CH4A 1SKVA 4P30A 2H8PC 4UB6Z 1CEZA 2ARHA 3BPZA 1TUBB 1J5EO 2YXYA 1VQOV 1HNWB 2A7WA 2XHBA 4X1YA 1XMOO 2ZM6B 1AVMA 3JALB 4NTXA 2N05A 3F5WC 4DW1A 4NKGB 5CBHA 4CZZA 1KUQA 3JYCA 4GX5A 1OV9A 4KUMA 4JZGA 4HNAB 3UCSC 5IJ0A 5B1NA 4K8ZA 1YF2A 1NKDA 1PM9A 2HLDG 1MNGA 1NS1A 3SPJA 3NXSA 2WLIA 2DMXA 4KFMA 2CE4A 4W4KA 4YHHO 2AHZA 2GTAA 3AK1A 4BIUA 2X7RB 4DYLA 4LH6A 5KHHA 5LHGA 1IBLB 3WU2Z 3BHPA 2HEPA 3ZS8C 1Q81W 2N74A 1PL0A 1R3IC 1KP2A 3ETDA 1WA8A 4DR5O 1D5AA 4FLWA 4QNHB 3AG7A 5F2VO 1IXMA 1Q6HA 5JCOC 2UUAB 2ZIOA 4O4LB 3S3WA 1NR1A 2QDOA 5KX5A 3K08A 4LF8O 3VQVA 2IJIA 3AG2C 1QLEB 3CP1A 4MVQA 4LP8A 1VMGA 4BW5A 3OTOB 3W7WA 1WB7A 2PI5A 4DV7O 3QVNA 4G2KA 2EINB 4DV5O 2V1DA 4B3RO 4NXMB 2UUCO 1IBMB 1N32B 1ROPA 3NR7A 2OCCC 1YCIA 4FJCC 3T1HB 2XAHA 4B3TB 4DV1O 1S76D 4LNUA 2LGQA 3E35A 2VQFB 2UXDB 1FS0G 4I4TB 4KHPB 3CRRA 5C8YB 1P84F 3H9VA 2CUGA 4DR2O 4BIOA 3OUFA 4CC6A 1K92A 4Q20A 4MTGA 2R9AA 4HAMA 5KA5A 4O2BA 1TVKB 2XAQA 4X66O 5GONB 1XQ8A 4NTYA 1XEQA 2UUBB 5CB4A 1SQPH 1HWYA 1Y67A 4CH3A 2UXCO 2FL4A 3AG2B 4LR3A 4JI4B 4B3SO 1HR0O 4JI5B 3D3QA 2BTQA 2XAGA 1FPOA 3LDCA 2F43G 2OT5A 3OMIB 3K04A 4WBNB 4X89A 1Q8IA 5CN0A 1BHBA 1RP3B 2OCCB 4DV4O 1JX9A 3JD0A 2PY5A 2DQ3A 4HYOA 3OFNG 2M6YA 2WPDG 2Q5ZA 3B8MA 2EBOA 2H94A 2B9ZA 5H5NA 1N0JA 4JPRA 4PA9A 2F93B 2Q69A 5LYJA 2ATKC 4ZI7B 4PDVA 4JI1B 3T2MA 1HNZO 1JPXA 1PNKA 2ZD9A 4WFBV 5HFMA 1M57C 1K34A 5B1AB 2GUZB 2DE0X 4LWSA 1V54B 4J7JA 2KQXA 1XL6A 4JV5B 1PPJH 1J5EB 1Z2GA 3D36A 4XDLA 4GKKO 3W7TA 4JI8O 4TQDA 4LCUC 1WLEA 5EIBD 2DWEC 2RMKB 4UCTA 3HKEA 3E8HA 5FPOA 2AHYA 1R6TA 2EULA 4TSFG 1M90W 3ICXA 3L70H 1NH2B 3ML0A 4X20A 4AILC 1BE3H 2HKOA 5EK0A 4YXWG 5KLVH 3CCEV 4DUZB 4NR1A 3QTCA 4J41A 1XBLA 4DR3O 1M93A 3U10A 1S3JA 5LXTB 4AI8A 4YHHB 1Q7YW 2PGGA 3CCVV 1ZWIC 3RFRA 2ZXWC 1SS3A 1TUBA 4U3JB 3BY6A 1PNMA 3RYFA 2JGUA 3CHXA 2WA3A 2QKCA 3HR0A 1I94O 3ZN0A 4DR5B 3U11A 1XNRO 2ZIMA 2Q68A 3JAWB 2E74B 3SPIA 2Y0IA 1OZ0A 1IZ3A 3QO5A 5HFLA 4HNAA 3FYIB 2UXNA 3H1HH 4LF8B 2YXLA 2ZE7A 4LF9O 3K3WA 4FFBB 5BR8O 1PV0A 3N27A 4P2ZA 1QLNA 3CCMV 3L75H 4Z1VA 1R6KA 3JAKA 3OGIB 1KMIZ 5GTIZ 4DV7B 1B6QA 1B06A 2XOKG 4DV5B 4B3RB 3SYCA 4I50B 2UUCB 4LF7O 4R6ZA 2F1MA 4DV3O 5GW7A 2WWWA 3UT5B 3JARA 3MD0A 2DOSA 3BVOA 1VQ4V 4X1YB 1MA1A 1FXKB 2XTAA 3BEHA 1KECA 3F7VC 3SYOA 5LP6A 4TV9B 4DR4B 1VQ7V 4JYCA 1WPBA 2EX3A 4O4JB 1Q6UA 2NN4A 4DR2B 4JAVA 3T4DA 4K8XA 4O4LA 1GN6A 4BWAA 1DK1A 1NBMG 2VRZA 1FKAO 2HHHO 1JJ2U 2DN9A 4LF5O 1K4CC 4K35A 2XT9A 2V4DA 2ZKOA 4XDJA 1NJIW 3SYPA 1Y74B 1XNQO 5L3GA 2PI4A 1AILA 2Q73A 2F95B 1VQPV 2UXCB 1GM9A 2JK5C 4B3MO 4B3SB 1LNQA 1HR0B 3VQXA 5L3CA 1AR4A 3VQYA 3CC7V 5D5QA 1Z5VA 5CBFA 5BZBA 3J80N 2JDIG 4I4TA 4UXNA 1NI8A 2E5LO 2QM8A 5C8YA 4X8AA 2LQTA 1LUWA 1GN2A 2K1EA 1SQBH 3BA9A 3OAAG 4PV1B 4WF9V 1TVKA 5GONA 3H01A 2WA4A 1E79G 1GAXA 3K59A 2CK3G 1NTZH 4EB6B 2BSKB 3ZMUA 2O57A 1S72V 5CA3A 1HNZB 1ZX3A 1W0KG 1FFTB 3JSLA 3G80A 1IBKO 5H9CA 3K0GA 4J11A 3QG5A 1SERA 4WBNA 4J7KA 3ZHVA 2CTWA 4GKKB 4LF4O 4JI8B 1KU9A 5KHIA 3B4SA 3E22B 5B5EZ 3LSUA 4K0KO 5JJJB 4DV2O 3RVYA 2KKWA 1I08A 4Z1MG 4YY3O 2YUAA 2FTKA 4CH6A 3M7MX 2R72A 1FAFA 2F66C 1F51A 2QM7A 4LFAB 3OEHG 1XDCA 5CB4B 2YDEA 2YS8A 4OXSA 4IHJB 5H2FZ 3OM3B 3PJSK 5CA0A 5H6QA 2Q7EA 3D36C 2EIJB 3UQ8A 1UPGA 3BABA 2CTRA 4R50A 2BTQB 4CS3A 4J9YB 3ABKC 1W0JG 1XNRB 3I56V 1RM1B 5B1BC 1FXVA 3GWOA 1QU7A 2N04A 1FJGO 3ABLC 2QSAA 4WFFA 2WSSG 3ZHTA 4JI7O 5EBMC 2P7TC 4LF9B 3CMAV 3OUSA 5BR8B 3ABUA 2F4VO 5KAFZ 5LXTA 5IT9N 1YTFB 4MVSA 4O4IB 3TK1A 2Y48A 3C3TA 3CSXA 5A9GA 4LF7B 1K8AW 4U3JA 5JVDB 5AG2A 1MSDA 5LHIA 4DV3B 3E8BA 5FL7G 3ZRSA 4IL6Z 2QM4A 1SQGA 1KP3A 2ZR2A 1AI7A 1DLBA 2IJHA 2QTOA 3MDSA 4H37A 3W7XA 3UKMA 3JSNA 3ASNB 5E1AC 5KHKA 2JJ2G 2OIGA 3K5LA 3I5DA 2ADQB 1EM1A 1H8HG 3HKEB 3FYEB 4NXNO 3ABKB 4BW9A 4LF5B 4A5UB 4FFBA 3D3IA 4DR1O 3RWRD 4X20B 1B3QA 3H1KH 4FLYA 2B5UA 2D3OW 1R73A 1XNQB 1G6UA 3ABLB 3OD4A 4GX0A 1IDSA 2EZOA 4I50A 2EJRA 3B09A 3ZBHA 4B3MB 3OMNB 3A2FA 3B8NA 5LP6C 3UT5A 3RYFB 5L3BA 1FXKA 4TV9A 1SZXA 1Z5WA 4O4JA 1QLEC 2QWRB 3STZC 1RFYA 5EBLC 3ETQA 1EZVH 4X62O 2EINC 4JYBA 2VWJA 1R3LC 5KA6A 3JASA 2FYUH 1UJWB 3BAAA 1Y74A 4JI2O 3RYCB 2HJFC 3CRCA 4MS2A 4JI6O 3A8TA 1N34O 2QEXV 3JAKB 1JMKC 2X6CA 2BTOA 1ZLZA 4EKWA 1O9HA 1BZKA 1S5JA 1H8EG 2A3QA 1GN4A 4DR7O 4RUEA 1IBKB 1ZTEA 1K5SA 1XMQO 3JARB 3R66A 2CGOA 2W6IG 5LBQA 5J2TB 3AG4B 1N33O 4JTDB 1GM8A 1QCEA 3JAMN 1BGYH 5LP6B 4LF4B 3B77A 4J7ZA 3CYOA 5FPRA 1N36O 1AR5A 3THOA 2GBOA 4K0KB 4DV2B 2P4VA 4DUYB 2YICA 4EB6A 2BSKA 1SRYA 4UVCA 3ZN1A 3ZHUA 4X65O 2QWNB 3FKSG 2LW1A 1SQFA 2M7WA 4JF3A 1OCOC 4WFEA 1A32A 2IH3C 1D5NA 5J9PC 3IJ4A 4LC1A 3CE2A 2X6AA 1Q6IA 1MSWD 5L3FA 5ITZB 1GRJA 1WP8A 2ZNIA 2Y69B 1D2DA 3X2QB 4P9PA 2XAFA 3E22A 3SJAC 3ZRXA 1THZA 3T1YO 1NVPD 1K4DC 4IIJB 4PHZA 1Q82W 1FJGB 1JCHA 3SDLA 2VWKA 2JIZG 1XHXA 1J95A 2P22C 5B1AC 4FLZA 4JI7B 1KQSU 3IFXA 2ZE5A 3M8AA 3AK2A 4UCSA 1XUQA 1V54C 4IHJA 2Q7GA 2IU0A 2JS5A 2F4VB 1KD1W 4MW3A 1JOYA 2HP8A 4LF6O 2Q4PA 1WJZA 4LFBO 4MTFA 3GB7C 1OCOB 3JCZA 2PUSA 3AG3C 3CXCU 3OE7G 3IC9A 3SYQA 5JH7B 1VP7A 3JCUZ 2P4KA 1JR9A 2YI8A 4L8JA 3LSSA 3VBBA 1QR9A 5LOVB 2YI9A 1SF9A 4NXNB 4GZRB 4I5SA 5LHHA 2Q0OC 1H38A 2AW9A 4H44B 4DR1B 1YHQV 1S77D 4QE9A 2AGAA 3N2GB 3W7SA 1Y4MA 4O4IA 3K58A 1OCCC 3CXHF 5CA0B 4UCUA 5CMUA 5JVDA 2GHYA 2ZE8A 2IBZH 2HVJC 4RUFA 5FNVB 1H2MA 4Q6GA 2P67A 1XMOB 3C90A 1SZTA 2LGWA 3SR2C 2OYQA 2C2AA 5C93A 4PDMA 3FD9A 3E2EA 4KL1A 4X1KB 3AG3B 1WN7A 4QJFB 4FLTA 4JYAO 1AI4A 4X62B 1DGSA 2BE3A 1BQZA 4D7SA 1G8MA 2ITDC 1F23A 1NQTA 5IY5C 5LGUA 4TV8B 4RAIA 1NZ6A 1Q43A 1N34B 4ZOLB 4JZ2A 4GLXA 1FXKC 3E83A 1XHZA 4PI0A 2JGDA 4MVUA 5K1PA 4DR7B 3ETGA 1WAZA 4JI3O 4F6EA 4R8CA 2EILC 1OCCB 1N33B 2DQ0A 4RQEA 4ASUG 1N8RW 3WB1A 3H1LH 1SA0B 4TOIA 3OEEG 1N36B 4F4LA 2WLMA 2DYRC 4B7EA 4O2AB 1P7GA 4JTCB 2LFRA 2QTSA 3JD1A 3RYCA 3UO2A 2X6BA 1HNXO 1JJOA 3RYHA 1CP9A 1GO3F 1PD3A 3TXSA 4X65B 1PKXA 1JA8A 4C7UA 3CCLV 4EFEA 2RN9A 3KZIZ 4Z2WA 5LGTA 4MTOA 1L0LH 3WG7C 3RYIB 5IY5B 4IYIA 4YIPA 1M56B 4KXRA 4DV1B 5IJ9B 5J2TA 4LFCO 3OTFA 1TAEA 1E1RG 3RN4A 3P3NA 1VQMV 4TQFA 3SYAA 1AJPA 4JYYA 2JVDA 3T1YB 2EILB 3IAYA 2L6LA 3CC4V 1AI6A 3LSQA 3RBZA 4X1IB 4X66B 2P5OA 3L72H 1BT8A 3ZHRA 1O9GA 3JASB 2DYRB 2PF4E 1R1BA 3TCUA 2JJ1G 3HKDB 1VQNV 2EIKC 1VQ6V 4FFKA 2OTLV 1GTOA 1Y66A 5BMVB 5LMUO 2OWOA 2A9HA 2EIMB 5IYBO 3HPLC 5IWAO 4LF6B 4FLVA 3E8FA 1VIBA 2RCVA 3P30A 3LDEA 1BS3A 1FD9A 1NH2D 1YZBA 1NT2B 5ITZA 1XILA 3CCJV 4HZ3A 4GKJO 3L9DA 3UO3A 3WG7B 1KB9F 4DV4B 3CJHB 2LO1A 4MVRA 4IIJA 2QE7G 1FYJA 4CS2A 1U96A 1SC5B 3FFQA 1AR1B 3I55V 5D5PA 3ZCCA 3LDDA 1GH6A 2CTQA 2CAZC 5IYCO 4PA3A 2ZM6O 1US6A 2EIJC 2RJZA 3BCCH 3G6EV 3E86A 1AJQA 4BR6A 5IYZA 1P4RA 4GT1A 2B1IA 4ZHQB 4UCRA 2W0XA 1AROP 1K73W 3HB3B 1RM1C 4DXWA 5KHGA 2EIKB 5JWPA 1VQKV 2NLJC 4CH5A 4OGQB 1RPRA 5JH7A 4OPHA 5JJEB 3TJTA 4JTAB 4PA7A 5LOVA 2Q0AA 4J10A 4YJ3B 2YIBD 2B1GA 1FFXA 1G4YB 3ASOB 3DC6A 4I7ZB 5IYDO 4AHCA 3N2GA 2RNBA 2V7QG 1GK9A 4DR3B 4PD4F 4MVOA 2P90A 1QVFU 3M99B 3AG1B 4FLUA 3TETA 3K5NA 2X0LA 1W59A 3ASNC 5FNVA 4JI3B 2LJ2A 2ZQMA 1E1QG 3SPHA 4TT3G 1I94B 3CC2V 3SPGA 1P49A 1BHAA 5LL6Y 1U97A 2R9RB 4X1KA 1H2SB 1NU1H 1BCCH 5DN6G 1NTKH 3T1HO 3R65A 1HW7A 3OT7A 3K5MA 3P3PA 1H2KA 1WNSA 1TGOA 2UXDO 2A0LA 4FM1A 1B04A 3ZJZA 4KHPO 3WB2A 1HNXB 1I5XA 4TV8A 2WLLB 4NYKA 2F23A 4ZOLA 1TUEB 5KMGB 1OCRC 2RDCA 1F4MA 3AK3A 2DJVA 4G28B 3UM7A 1EN5A 2Z0AA 1VARA 2CDYA 2IH1C 1R3JC 1SA0A 1G1XB 1BMFG 1YEWA 4GCZA 2UU9O 1K97A 1V9PA 3EVKA 4O2AA 2WAMA 2HHHB 3IC7A 3G71V 1KC8W 4QGPA 4GX1A 4TUYA 3K06A 4FM2A 2QKSA 4X9QA 2Z5UA 4QIWF 1F7YA 3T1CA 4N21A 4MT8A 1K3EA 3A0RA 2BCCH 5L3DA 4HBNA 2ZT9B 3AG4C 4PELA 1OHHG 2WLNA 3RYIA 2JGDB 5E79Z 3CMEV 2CGNA 5IWAB 4DR6O 5KHJA 5IJ9A 4TWKA 4MTXA 4JI1O 3APOA 1OCZC 4IYHA 4DRXB 2ZINA 1NVPB 2CH7B 1OCRB 3F5TA 5J2UB 4N23A 2QWPB 2E5LB 3J7AU 3EXAA 1XL4A 3L71H 3CRQA 3F7YC 3JD4A 2IW5A 3KG2A 2D2CB 3ETEA 1LUVA 4JASA 4X1IA 4JV5O 1Q86W 2A06H 4B08A 1N4CA 4NTWA 5B3SC 3RYHB 3H1IH 4F6RA 1VQ8V 5EIBC 3HKDA 2ODMA 5EZYB 1JQ0A 2BOCC 4H33A 2YEVA 3DXRB 2A79B 5BMVA 5LA6B 4NB5A 4E2LA 2Y69C 4DV0O 3X2QC 1YSCA 4PJ0Z 3CD6V 5DM6V 2JRIA 1BQ0A 4DUZO 3N2KB 5EBWC 1TA8A 4FLXA 1X59A 1ORQC 1VF7A 3D8CA 2LFSA 3ZMZA 4WFAV 5IDJA 3CJHA 3GVMA 1MG1A 4PDLA 3TGUH 5KUKA 4YIOA 4UCVA 5B1OA 2FB5A 1OCZB 2RQ6A 4YY3B 1YJWV 1K33A 3QNEA 2MK3A 1YTFD 1NTMH 1KKCA 2L35A 4FIPC 4CC5A 4FPPA
chains in the Genus database with same CATH topology
2DYSC 2C2AA 3EHBB 3CCQV 5C93A 4PDMA 1LNQA 5L3CA 3E89A 3E2EA 5KUMA 1S0VA 4U7OA 3QO8A 3CC7V 2JEUA 3AG3B 3CCUV 5CBFA 3ZMSA 3ZMTA 4QJFB 5BZBA 1AI4A 2JDIG 1W2BU 4PA6A 4UXNA 2BOBC 1EBOA 1S5HC 2DW4A 4RO2A 2QM8A 3ZRWB 4X8AA 5B3SB 1QVGU 1YIJV 1G8MA 4I9WA 2ITDC 1F23A 1NQTA 2K1EA 3DGEA 3JD2A 5IY5C 1QR8A 3OAAG 4L87A 5LGUA 1ENVA 4RAIA 4WF9V 3H01A 1E79G 4G27B 2P6JA 2ZDIA 3RW0A 1FXKC 3E83A 2CK3G 2EZPA 1FXHA 4MVUA 4BAYA 2W6JG 3ETGA 1L1FA 3ZMUA 1YJNV 1F4NA 4R8CA 1S72V 2EILC 5CA3A 3EFFK 1WPXA 2HG5C 4MSWC 3SJQC 1VQ9V 1OCCB 2IJJA 3T4ZA 2DQ0A 4RQEA 1W0KG 1FFTB 4ASUG 4UV9A 1N8RW 4X88A 1JVMA 5B1BB 3STLC 3OEEG 4F4LA 5H9CA 2WLMA 2DYRC 2WLHA 3K0GA 4FMTA 4WFGA 3OR6C 1YI2V 2IU3A 1SERA 2DYSB 4JTCB 4MW8A 4UVBA 2LFRA 4PA4A 4J9ZB 1GKFA 3JD1A 4GX2A 2X6BA 4P30A 2H8PC 1CEZA 3JD3A 1CP9A 1GO3F 1PD3A 5CBGA 3RVYA 1PKXA 4Z1MG 1VQOV 2FTKA 3CCLV 2HR3A 3F5WC 1F51A 5LGTA 4MTOA 3WG7C 1M9NA 5IY5B 5CBHA 2QM7A 4CZZA 3OEHG 1M56B 4XDKA 3JYCA 4OXSA 4GX5A 3FB7C 4KUMA 3OM3B 1E1RG 3PJSK 5L3EA 2XNDG 5H6QA 1VQMV 2R9IA 2EIJB 5B1NA 3SYAA 1AJPA 4U7NA 1NKDA 2HLDG 3ZIAG 2WLLA 2EILB 4R50A 3SPJA 3NXSA 1YITV 3LUTB 2WLIA 3CC4V 1AI6A 3LSQA 4KFMA 3RBZA 4J9YB 3ABKC 2AHZA 1W0JG 4BIUA 2X7RB 5LHGA 3I56V 1RM1B 2DYRB 5B1BC 1EZJA 1FXVA 1Q81W 3GWOA 2UXXA 3TCUA 5EC1C 2JJ1G 4P9OA 1PL0A 1H2GA 3ABLC 1R3IC 1VQNV 3IGAC 2EIKC 1KP2A 3ETDA 4WFFA 1VQ6V 3AEIA 2XAJA 2OTLV 1GTOA 1Y66A 1SETA 2WSSG 4QNHB 1M1KW 5EBMC 1VQLV 2A9HA 2P7TC 1IXMA 2EIMB 5IYBO 3HPLC 2W0FC 3RVZA 3CMAV 3OUSA 3ABUA 3E8FA 3P30A 1NR1A 3LDEA 1NH2D 1YTFB 3CCJV 4HZ3A 4MVSA 1KKDA 3K08A 3TK1A 2IJIA 3AG2C 1QLEB 2Y48A 1SESA 1BL8A 3WG7B 3WFVA 1K8AW 3CP1A 4MVQA 4MVRA 4LP8A 2QE7G 5LHIA 3E8BA 5FL7G 3ZRSA 4BW5A 3W7WA 1M56C 2PI5A 1AR1B 2JEXA 2HFEC 1KP3A 3I55V 2ZR2A 3ZCCA 3LDDA 1AI7A 1DLBA 4G2KA 5IYCO 2EINB 2IJHA 2QTOA 1P7BA 2V1DA 4PA3A 2QA4V 4H37A 3W7XA 3UKMA 4DO2A 2EIJC 1ROPA 3ASNB 2OCCC 5E1AC 3E86A 4R7CA 4FJCC 1AJQA 2JJ2G 3W7UA 3G6EV 2XAHA 1H8HG 1S76D 1P4RA 3FYEB 3ABKB 3FB5C 4GT1A 2B1IA 3E35A 2DWDC 1K9MW 1AROP 1FS0G 1MOFA 2LP7A 3D3IA 3P32A 3FB8C 1K73W 3HB3B 3OUFA 1RM1C 2B5UA 2D3OW 1R73A 4DXWA 1K92A 3ABLB 4Q20A 3ZRVA 2EIKB 4MTGA 4HAMA 1VQKV 2NLJC 1M57B 1RPRA 5KA5A 4GX0A 2EZOA 2XAQA 2YSUB 2EJRA 1COWG 3OMNB 3B8NA 2EIMC 4JTAB 4PA7A 4QE7A 2KB1A 3OMAB 2GSMB 3ABMC 5L3BA 1HWYA 4JGSA 3LNMB 1FXKA 2NNUA 3AG2B 1K5QA 2B1GA 1G4YB 3ASOB 1QLEC 5IYDO 1AJNA 2V7QG 3MHHC 3STZC 2XAGA 1EFRG 1GK9A 5EBLC 3LDCA 4MVOA 2P90A 1QVFU 2F43G 2OT5A 3M99B 3AG1B 3OMIB 2EINC 3K04A 4JYBA 1R3LC 5KA6A 4X89A 5CN0A 1BHBA 3TETA 1UJWB 2OCCB 2X0LA 1JX9A 2HJFC 3ASNC 3JD0A 2ZQMA 2DQ3A 2Q67A 4MS2A 4HYOA 1R6NA 2QEXV 2Q6AA 3OFNG 1E1QG 2X6CA 4TT3G 3SPHA 3CC2V 2WPDG 3SPGA 3B8MA 2EBOA 2H94A 4EKWA 1BHAA 1H8EG 3VOUA 2ZXWB 2R9RB 4JPRA 4PA9A 4WFHA 4RUEA 2Q69A 3SPCA 2ATKC 1K5SA 4PDVA 5DN6G 3K9AA 3T2MA 3R65A 1JPXA 1PNKA 2ZD9A 4WFBV 2W6IG 5LBQA 5HFMA 3AG4B 1M57C 2YEVB 4JTDB 3K03A 1K34A 1GM8A 1QCEA 1K7DA 2A0LA 5B1AB 3ZRWA 3ZJZA 5EC2C 2ZDIC 1V54B 3B77A 1DTOA 3CYOA 5LGNA 1I5XA 3ABMB 2WLLB 1XL6A 1YJ9V 2WLIB 1TUEB 3D36A 4XDLA 1OCRC 4MVMA 3W7TA 1F4MA 1CPYA 1SRYA 4LCUC 1WLEA 3ASOC 3DTUB 4UVCA 3ZN1A 2DWEC 4CBCA 4G28B 3CPWU 3FKSG 3E8HA 3UM7A 2Z3YA 2AHYA 2M7WA 4JF3A 4XBFA 1OCOC 4KP4A 4TSFG 4UVAA 3ABTA 4WFEA 3AG1C 1NH2B 2IH3C 1M90W 5J9PC 3ML0A 2IH1C 2ZR3A 1R3JC 4LC1A 1BMFG 3OGCC 4GCZA 2HKOA 3CCEV 5EK0A 4YXWG 1K97A 2X6AA 2WAMA 3CCRV 3IC7A 3G71V 1KC8W 1MABG 1S3JA 1VQ5V 1MSWD 5L3FA 4GX1A 3K06A 2Y69B 4UV8A 1Q7YW 3CCVV 1V55C 3X2QB 1ZWIC 2QKSA 4P9PA 2XAFA 2Z5UA 4QIWF 2WLJA 1THZA 2ZXWC 3ZRXA 3T1CA 4N21A 4MT8A 1NVPD 1K3EA 3BY6A 1K4DC 1PNMA 3A0RA 5L3DA 1Q82W 3ZMVA 1JCHA 4BIZA 3AG4C 2JIZG 3ZN0A 4PELA 1OHHG 1J95A 5B1AC 1DF4A 1QBZA 1KQSU 3IFXA 2WLNA 2Q68A 3CMEV 3QO7A 3SPIA 4JAUA 1V54C 4LBEC 1OZ0A 1PNLA 3QO5A 4MTXA 4TWKA 2IU0A 1OCZC 1NVPB 5HFLA 4QPKA 1OCRB 3FYIB 4N23A 2WLKA 1KD1W 2UXNA 4MW3A 1JOYA 3E8GA 3K79A 1XL4A 4ZKIA 3K3WA 3F7YC 3JD4A 4PDRA 2IW5A 3KG2A 4P2ZA 3ETEA 2ITCC 4MTFA 3CCSV 1QLNA 3CCMV 1I5YA 3GB7C 4JASA 1OCOB 1R6KA 1GMGA 3AG3C 3JCZA 3CXCU 3OE7G 1B6QA 3SYQA 1Q86W 3MHSC 4FK5C 2XOKG 3SYCA 4ZBMA 4R6ZA 5H6RA 3LSSA 5B3SC 3VBBA 5GW7A 1QR9A 1VQ8V 2WWWA 4RQFA 4UUJC 1R3KC 3MD0A 1JQ0A 2BOCC 4H33A 4MVZA 2YEVA 2A79B 1NR7A 1AI5A 1VQ4V 1FXKB 3BEHA 1GM7A 1KECA 1V55B 3F7VC 4I5SA 3SYOA 5LHHA 4E2LA 4JYCA 1VQ7V 1RPOA 3OW2U 1H38A 2Y69C 1YHQV 3X2QC 1S77D 1YSCA 2OTJV 4QE9A 3G4SV 3CD6V 4JAVA 3T4DA 5DM6V 2XASA 3W7SA 5EBWC 1NBMG 1Y4MA 3FB6C 1JJ2U 3OR7C 1ORQC 2LFSA 1K4CC 3ZMZA 4WFAV 5IDJA 1OCCC 1DF5A 1MG1A 5CMUA 4PDLA 2GHYA 5KUKA 4XDJA 1NJIW 5B1OA 3SYPA 5L3GA 1OCZB 2PI4A 2HVJC 2HVKC 4RUFA 4QPJA 1YJWV 1K33A 3K0DA 2IJKA 2MK3A 3QNEA 1VQPV 1YTFD 2P67A 4FIPC 4WCEV 1GM9A 2JK5C 1SZTA 4FPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQO V;  1VQ6 V;  1K9M W;  4WFB V;  3G71 V;  1KC8 W;  1N8R W;  3CCQ V;  2OTL V;  3CCL V;  4WF9 V;  1M1K W;  1VQ5 V;  3I55 V;  4WCE V;  1VQL V;  1JJ2 U;  1YIT V;  1K73 W;  3CPW U;  3CC4 V;  1Q7Y W;  3CCV V;  3CMA V;  2D3O W;  1R73 A;  4WFA V;  3CC7 V;  1VQ8 V;  1YI2 V;  3CCU V;  2QA4 V;  1KD1 W;  2QEX V;  1VQK V;  1M90 W;  3CC2 V;  1W2B U;  1Q82 W;  1NJI W;  1YJN V;  1YJ9 V;  1VQ4 V;  3I56 V;  3G6E V;  1S72 V;  3CCJ V;  1Q81 W;  3CCE V;  1VQ7 V;  1YIJ V;  1QVG U;  3CCS V;  3OW2 U;  1VQ9 V;  1QVF U;  3CD6 V;  3CCM V;  1YJW V;  1YHQ V;  1KQS U;  1VQP V;  1VQM V;  2OTJ V;  1K8A W;  3G4S V;  1VQN V;  3CXC U;  3CME V;  3CCR V;  5DM6 V;  1Q86 W; 
#chains in the Genus database with same CATH topology
 2DYS C;  3CCQ V;  2QJ1 A;  3BRC A;  2QKA A;  2UXB O;  2KSD A;  3E89 A;  5KUM A;  1S0V A;  2JEU A;  4W4L A;  1Y6X A;  3ZMT A;  4ZHQ A;  1W2B U;  4PA6 A;  2BOB C;  1EBO A;  4RO2 A;  3ZRW B;  3CRA A;  5B3S B;  1QVG U;  1YIJ V;  2PYJ A;  3DGE A;  2P06 A;  3B40 A;  3JD2 A;  1QR8 A;  4L87 A;  4I0X B;  1KBH A;  3KKY A;  1ENV A;  5K1X A;  4YJ2 A;  1S5L Z;  4G27 B;  2P6J A;  2ZDI A;  2EJ7 A;  4J42 A;  4JAA A;  2EZP A;  2E75 B;  1FXH A;  4OX9 O;  2G38 A;  4EFB A;  2W6J G;  1L1F A;  4DV6 O;  4YJ3 A;  4X64 O;  4MSW C;  3SJQ C;  1EN4 A;  1L8D A;  1Q5O A;  4DR4 O;  4CS4 A;  3DC5 A;  4UV9 A;  5TIS Z;  3CB2 A;  1JVM A;  3STL C;  2QR4 A;  3B2E E;  2PTM A;  4FMT A;  3OR6 C;  5BY1 A;  5IYZ B;  1YI2 V;  2DYS B;  4MW8 A;  4UVB A;  1IX9 A;  4PA4 A;  3MAQ A;  4J9Z B;  1GKF A;  2ZCE A;  2Q8V A;  5GTH Z;  3HKC B;  3JD3 A;  3O9O A;  2QGN A;  1VF6 A;  4UB8 Z;  5CBG A;  4EEQ A;  3G6B A;  5CA1 B;  1T5E A;  1AP5 A;  2HR3 A;  3A0B Z;  4O4H A;  4FM0 A;  1OJH A;  3RGB A;  1M9N A;  1ZSP A;  2UU9 B;  4XDK A;  3FB7 C;  2VS0 A;  2YC0 A;  5L3E A;  1SQV H;  2XND G;  1URF A;  5LMN O;  2R9I A;  1FFX B;  1YDX A;  1AP6 A;  4U7N A;  4OPA A;  5JQG B;  3ZIA G;  2WLL A;  1YIT V;  1WP7 A;  3KCX A;  3LUT B;  4ICG A;  5BXZ A;  5KMG A;  1IXB A;  1M4U A;  3JAT A;  1UFI A;  4D6T H;  1EZJ A;  4DR6 B;  2UXX A;  3BFR A;  5EC1 C;  5EYP B;  4P9O A;  1H2G A;  5KAI Z;  5A2Q N;  3IGA C;  3AEI A;  2XAJ A;  2GDS A;  1SET A;  1M1K W;  1MZE A;  1VQL V;  1AB3 A;  3G67 A;  1KYO F;  2ZE6 A;  2W0F C;  3RVZ A;  1ZL8 B;  2QWQ B;  2PZS A;  4GUN A;  3S3X A;  2GTS A;  3BA8 A;  2H3O A;  1Y76 A;  1KKD A;  4B7K A;  3L74 H;  3L73 H;  1SES A;  1BL8 A;  3WFV A;  3CRM A;  4JI2 B;  2KG7 A;  1SQX H;  1M56 C;  2Y0P A;  2JEX A;  2HFE C;  4JI6 B;  3CWB H;  4H0L B;  3ZED A;  1RSO B;  3PN1 A;  2LW7 A;  1P7B A;  2QA4 V;  1M5I A;  4RWU A;  4DO2 A;  1PP9 H;  4DV0 B;  2PYL A;  4R7C A;  1JFF A;  4DRX A;  4LFA O;  1H2L A;  3W7U A;  1XMQ B;  2CH7 A;  5J2U A;  1MMM A;  3FB5 C;  2DWD C;  1K9M W;  1MOF A;  2LP7 A;  3P32 A;  3FB8 C;  3GWK C;  3ZRV A;  4UFZ A;  4FZ0 A;  3FAV B;  1H2N A;  1M57 B;  3ZX6 A;  2YSU B;  3JAL A;  5IE9 A;  1COW G;  2MW2 B;  4TUY B;  5DED A;  2EIM C;  2UXB B;  3HKB B;  3CS5 A;  1MZF A;  2KB1 A;  3OMA B;  4K3A A;  4QE7 A;  5EZY A;  2GSM B;  3ABM C;  3DXR A;  4JGS A;  5LA6 A;  1ZAU A;  3LNM B;  2NNU A;  1K5Q A;  4FVM A;  4IGG A;  1AJN A;  3LNN A;  3MHH C;  3N2K A;  1EFR G;  2QWO B;  3K5O A;  3Q4H B;  4E4E A;  4JI0 O;  2Q7H A;  4OX9 B;  4UCO A;  4I55 B;  4GYC B;  4DV6 B;  4ABM A;  2Q67 A;  3SJC C;  2JS3 A;  2E3C A;  2VQE O;  2E76 B;  4X64 B;  1R6N A;  2Q6A A;  2FML A;  3K9S A;  3J81 N;  3ZHS A;  1BSM A;  3VOU A;  2ZXW B;  4WFH A;  3SPC A;  2AZ2 A;  3SJB C;  4F6R B;  2GV9 A;  3K9A A;  2YEV B;  3K03 A;  3ZRW A;  1K7D A;  4U3F H;  5IJ0 B;  3RT3 C;  5EC2 C;  4AQY O;  3VQW A;  2ZDI C;  1DTO A;  5LGN A;  4LFB B;  3ABM B;  4I0X A;  1VF5 B;  2ZNJ A;  1YJ9 V;  2WLI B;  4MVM A;  1CPY A;  3ASO C;  3DTU B;  2FKX A;  2ADP A;  2Y4U A;  1LR1 A;  4CBC A;  3CPW U;  1VEW A;  1HDJ A;  1WB8 A;  2Z3Y A;  1HNW O;  3DSQ A;  4XBF A;  4KP4 A;  4UVA A;  3ABT A;  3AG1 C;  1WA8 B;  2AZ0 A;  2ZR3 A;  1XI1 A;  5LMN B;  4DW0 A;  3OGC C;  1VF6 C;  3CCR V;  3C3S A;  2K9P A;  1MAB G;  1VQ5 V;  5JJN B;  5JCO A;  5KX5 B;  4UV8 A;  1V55 C;  3HKC A;  2WLJ A;  1Q3E A;  1I7F A;  1GN3 A;  2ETN A;  3QF7 A;  4J80 A;  3ZMV A;  5CA1 A;  1YXB A;  4YJ2 B;  4BIZ A;  2CTP A;  1DF4 A;  1QBZ A;  1X4T A;  1IBL O;  3CEI A;  3QO7 A;  4JAU A;  4LBE C;  4ZIB A;  1PNL A;  4I9Q A;  2ILM A;  4QPK A;  4JYA B;  4LNU B;  2WLK A;  3ZHQ A;  3E8G A;  1HP8 A;  3K79 A;  4H13 B;  4ZKI A;  5JQG A;  4D7T A;  2YID A;  2OCH A;  2UUA O;  4PDR A;  5B66 Z;  1YVW A;  2ITC C;  3CCS V;  1Q90 D;  1I5Y A;  1GMG A;  4DUY O;  3MHS C;  4FK5 C;  3H1J H;  4O2B B;  1I0H A;  4ZBM A;  5H6R A;  1N0N A;  4ZI7 A;  5EYP A;  3OTO O;  4DK0 A;  1IUR A;  4RQF A;  4UUJ C;  1R3K C;  1CXZ B;  4MVZ A;  2IM9 A;  4FZ1 A;  1NR7 A;  5DEC A;  1AI5 A;  4DK1 A;  4NXM O;  1GM7 A;  1QQC A;  1V55 B;  2GUZ A;  1IBM O;  1N32 O;  4O4H B;  1RPO A;  3OW2 U;  2OTJ V;  1ZL8 A;  3G4S V;  2XAS A;  4B3T O;  3FB6 C;  3OR7 C;  2VQF O;  2NR5 A;  3APQ A;  1DF5 A;  4IT5 A;  1QHT A;  2AXT Z;  2YIA A;  3O65 A;  2Q9L A;  3TXQ A;  2HVK C;  4QPJ A;  1PL4 A;  1RSO A;  3K0D A;  2IJK A;  4WCE V;  3JAT B;  2Y4T A;  3EHB B;  2UUB O;  4U7O A;  3QO8 A;  5LYJ B;  4LFC B;  3CCU V;  3ZMS A;  3SGI A;  1S5H C;  2DW4 A;  4JI4 O;  1ZUQ A;  4I9W A;  4LWS B;  4JI5 O;  4JI0 B;  4LH7 A;  3FAV A;  4NVP A;  3K57 A;  2YXH A;  2VQE B;  2R70 A;  3RW0 A;  1Y76 B;  5FLX N;  3FX7 A;  3JAW A;  3HKB A;  4BAY A;  2KG7 B;  1EN6 A;  1XOU A;  1YJN V;  1F4N A;  3A0H Z;  3EFF K;  1WPX A;  2HG5 C;  1VQ9 V;  2IJJ A;  3WB0 A;  3T4Z A;  3U0Z A;  5LMU B;  4AQY B;  4X88 A;  5B1B B;  1SQQ H;  1JFF B;  2OIE A;  2WLH A;  3CX5 F;  4PI2 A;  1L0N H;  4WFG A;  1QNM A;  2IU3 A;  1XRE A;  3Q4H A;  4GKJ B;  2XUM A;  1IVS A;  2YIB A;  3KCY A;  4GX2 A;  4I55 A;  2HJD A;  4CH4 A;  1SKV A;  4P30 A;  2H8P C;  4UB6 Z;  1CEZ A;  2ARH A;  3BPZ A;  1TUB B;  1J5E O;  2YXY A;  1VQO V;  1HNW B;  2A7W A;  2XHB A;  4X1Y A;  1XMO O;  2ZM6 B;  1AVM A;  3JAL B;  4NTX A;  2N05 A;  3F5W C;  4DW1 A;  4NKG B;  5CBH A;  4CZZ A;  1KUQ A;  3JYC A;  4GX5 A;  1OV9 A;  4KUM A;  4JZG A;  4HNA B;  3UCS C;  5IJ0 A;  5B1N A;  4K8Z A;  1YF2 A;  1NKD A;  1PM9 A;  2HLD G;  1MNG A;  1NS1 A;  3SPJ A;  3NXS A;  2WLI A;  2DMX A;  4KFM A;  2CE4 A;  4W4K A;  4YHH O;  2AHZ A;  2GTA A;  3AK1 A;  4BIU A;  2X7R B;  4DYL A;  4LH6 A;  5KHH A;  5LHG A;  1IBL B;  3WU2 Z;  3BHP A;  2HEP A;  3ZS8 C;  1Q81 W;  2N74 A;  1PL0 A;  1R3I C;  1KP2 A;  3ETD A;  1WA8 A;  4DR5 O;  1D5A A;  4FLW A;  4QNH B;  3AG7 A;  5F2V O;  1IXM A;  1Q6H A;  5JCO C;  2UUA B;  2ZIO A;  4O4L B;  3S3W A;  1NR1 A;  2QDO A;  5KX5 A;  3K08 A;  4LF8 O;  3VQV A;  2IJI A;  3AG2 C;  1QLE B;  3CP1 A;  4MVQ A;  4LP8 A;  1VMG A;  4BW5 A;  3OTO B;  3W7W A;  1WB7 A;  2PI5 A;  4DV7 O;  3QVN A;  4G2K A;  2EIN B;  4DV5 O;  2V1D A;  4B3R O;  4NXM B;  2UUC O;  1IBM B;  1N32 B;  1ROP A;  3NR7 A;  2OCC C;  1YCI A;  4FJC C;  3T1H B;  2XAH A;  4B3T B;  4DV1 O;  1S76 D;  4LNU A;  2LGQ A;  3E35 A;  2VQF B;  2UXD B;  1FS0 G;  4I4T B;  4KHP B;  3CRR A;  5C8Y B;  1P84 F;  3H9V A;  2CUG A;  4DR2 O;  4BIO A;  3OUF A;  4CC6 A;  1K92 A;  4Q20 A;  4MTG A;  2R9A A;  4HAM A;  5KA5 A;  4O2B A;  1TVK B;  2XAQ A;  4X66 O;  5GON B;  1XQ8 A;  4NTY A;  1XEQ A;  2UUB B;  5CB4 A;  1SQP H;  1HWY A;  1Y67 A;  4CH3 A;  2UXC O;  2FL4 A;  3AG2 B;  4LR3 A;  4JI4 B;  4B3S O;  1HR0 O;  4JI5 B;  3D3Q A;  2BTQ A;  2XAG A;  1FPO A;  3LDC A;  2F43 G;  2OT5 A;  3OMI B;  3K04 A;  4WBN B;  4X89 A;  1Q8I A;  5CN0 A;  1BHB A;  1RP3 B;  2OCC B;  4DV4 O;  1JX9 A;  3JD0 A;  2PY5 A;  2DQ3 A;  4HYO A;  3OFN G;  2M6Y A;  2WPD G;  2Q5Z A;  3B8M A;  2EBO A;  2H94 A;  2B9Z A;  5H5N A;  1N0J A;  4JPR A;  4PA9 A;  2F93 B;  2Q69 A;  5LYJ A;  2ATK C;  4ZI7 B;  4PDV A;  4JI1 B;  3T2M A;  1HNZ O;  1JPX A;  1PNK A;  2ZD9 A;  4WFB V;  5HFM A;  1M57 C;  1K34 A;  5B1A B;  2GUZ B;  2DE0 X;  4LWS A;  1V54 B;  4J7J A;  2KQX A;  1XL6 A;  4JV5 B;  1PPJ H;  1J5E B;  1Z2G A;  3D36 A;  4XDL A;  4GKK O;  3W7T A;  4JI8 O;  4TQD A;  4LCU C;  1WLE A;  5EIB D;  2DWE C;  2RMK B;  4UCT A;  3HKE A;  3E8H A;  5FPO A;  2AHY A;  1R6T A;  2EUL A;  4TSF G;  1M90 W;  3ICX A;  3L70 H;  1NH2 B;  3ML0 A;  4X20 A;  4AIL C;  1BE3 H;  2HKO A;  5EK0 A;  4YXW G;  5KLV H;  3CCE V;  4DUZ B;  4NR1 A;  3QTC A;  4J41 A;  1XBL A;  4DR3 O;  1M93 A;  3U10 A;  1S3J A;  5LXT B;  4AI8 A;  4YHH B;  1Q7Y W;  2PGG A;  3CCV V;  1ZWI C;  3RFR A;  2ZXW C;  1SS3 A;  1TUB A;  4U3J B;  3BY6 A;  1PNM A;  3RYF A;  2JGU A;  3CHX A;  2WA3 A;  2QKC A;  3HR0 A;  1I94 O;  3ZN0 A;  4DR5 B;  3U11 A;  1XNR O;  2ZIM A;  2Q68 A;  3JAW B;  2E74 B;  3SPI A;  2Y0I A;  1OZ0 A;  1IZ3 A;  3QO5 A;  5HFL A;  4HNA A;  3FYI B;  2UXN A;  3H1H H;  4LF8 B;  2YXL A;  2ZE7 A;  4LF9 O;  3K3W A;  4FFB B;  5BR8 O;  1PV0 A;  3N27 A;  4P2Z A;  1QLN A;  3CCM V;  3L75 H;  4Z1V A;  1R6K A;  3JAK A;  3OGI B;  1KMI Z;  5GTI Z;  4DV7 B;  1B6Q A;  1B06 A;  2XOK G;  4DV5 B;  4B3R B;  3SYC A;  4I50 B;  2UUC B;  4LF7 O;  4R6Z A;  2F1M A;  4DV3 O;  5GW7 A;  2WWW A;  3UT5 B;  3JAR A;  3MD0 A;  2DOS A;  3BVO A;  1VQ4 V;  4X1Y B;  1MA1 A;  1FXK B;  2XTA A;  3BEH A;  1KEC A;  3F7V C;  3SYO A;  5LP6 A;  4TV9 B;  4DR4 B;  1VQ7 V;  4JYC A;  1WPB A;  2EX3 A;  4O4J B;  1Q6U A;  2NN4 A;  4DR2 B;  4JAV A;  3T4D A;  4K8X A;  4O4L A;  1GN6 A;  4BWA A;  1DK1 A;  1NBM G;  2VRZ A;  1FKA O;  2HHH O;  1JJ2 U;  2DN9 A;  4LF5 O;  1K4C C;  4K35 A;  2XT9 A;  2V4D A;  2ZKO A;  4XDJ A;  1NJI W;  3SYP A;  1Y74 B;  1XNQ O;  5L3G A;  2PI4 A;  1AIL A;  2Q73 A;  2F95 B;  1VQP V;  2UXC B;  1GM9 A;  2JK5 C;  4B3M O;  4B3S B;  1LNQ A;  1HR0 B;  3VQX A;  5L3C A;  1AR4 A;  3VQY A;  3CC7 V;  5D5Q A;  1Z5V A;  5CBF A;  5BZB A;  3J80 N;  2JDI G;  4I4T A;  4UXN A;  1NI8 A;  2E5L O;  2QM8 A;  5C8Y A;  4X8A A;  2LQT A;  1LUW A;  1GN2 A;  2K1E A;  1SQB H;  3BA9 A;  3OAA G;  4PV1 B;  4WF9 V;  1TVK A;  5GON A;  3H01 A;  2WA4 A;  1E79 G;  1GAX A;  3K59 A;  2CK3 G;  1NTZ H;  4EB6 B;  2BSK B;  3ZMU A;  2O57 A;  1S72 V;  5CA3 A;  1HNZ B;  1ZX3 A;  1W0K G;  1FFT B;  3JSL A;  3G80 A;  1IBK O;  5H9C A;  3K0G A;  4J11 A;  3QG5 A;  1SER A;  4WBN A;  4J7K A;  3ZHV A;  2CTW A;  4GKK B;  4LF4 O;  4JI8 B;  1KU9 A;  5KHI A;  3B4S A;  3E22 B;  5B5E Z;  3LSU A;  4K0K O;  5JJJ B;  4DV2 O;  3RVY A;  2KKW A;  1I08 A;  4Z1M G;  4YY3 O;  2YUA A;  2FTK A;  4CH6 A;  3M7M X;  2R72 A;  1FAF A;  2F66 C;  1F51 A;  2QM7 A;  4LFA B;  3OEH G;  1XDC A;  5CB4 B;  2YDE A;  2YS8 A;  4OXS A;  4IHJ B;  5H2F Z;  3OM3 B;  3PJS K;  5CA0 A;  5H6Q A;  2Q7E A;  3D36 C;  2EIJ B;  3UQ8 A;  1UPG A;  3BAB A;  2CTR A;  4R50 A;  2BTQ B;  4CS3 A;  4J9Y B;  3ABK C;  1W0J G;  1XNR B;  3I56 V;  1RM1 B;  5B1B C;  1FXV A;  3GWO A;  1QU7 A;  2N04 A;  1FJG O;  3ABL C;  2QSA A;  4WFF A;  2WSS G;  3ZHT A;  4JI7 O;  5EBM C;  2P7T C;  4LF9 B;  3CMA V;  3OUS A;  5BR8 B;  3ABU A;  2F4V O;  5KAF Z;  5LXT A;  5IT9 N;  1YTF B;  4MVS A;  4O4I B;  3TK1 A;  2Y48 A;  3C3T A;  3CSX A;  5A9G A;  4LF7 B;  1K8A W;  4U3J A;  5JVD B;  5AG2 A;  1MSD A;  5LHI A;  4DV3 B;  3E8B A;  5FL7 G;  3ZRS A;  4IL6 Z;  2QM4 A;  1SQG A;  1KP3 A;  2ZR2 A;  1AI7 A;  1DLB A;  2IJH A;  2QTO A;  3MDS A;  4H37 A;  3W7X A;  3UKM A;  3JSN A;  3ASN B;  5E1A C;  5KHK A;  2JJ2 G;  2OIG A;  3K5L A;  3I5D A;  2ADQ B;  1EM1 A;  1H8H G;  3HKE B;  3FYE B;  4NXN O;  3ABK B;  4BW9 A;  4LF5 B;  4A5U B;  4FFB A;  3D3I A;  4DR1 O;  3RWR D;  4X20 B;  1B3Q A;  3H1K H;  4FLY A;  2B5U A;  2D3O W;  1R73 A;  1XNQ B;  1G6U A;  3ABL B;  3OD4 A;  4GX0 A;  1IDS A;  2EZO A;  4I50 A;  2EJR A;  3B09 A;  3ZBH A;  4B3M B;  3OMN B;  3A2F A;  3B8N A;  5LP6 C;  3UT5 A;  3RYF B;  5L3B A;  1FXK A;  4TV9 A;  1SZX A;  1Z5W A;  4O4J A;  1QLE C;  2QWR B;  3STZ C;  1RFY A;  5EBL C;  3ETQ A;  1EZV H;  4X62 O;  2EIN C;  4JYB A;  2VWJ A;  1R3L C;  5KA6 A;  3JAS A;  2FYU H;  1UJW B;  3BAA A;  1Y74 A;  4JI2 O;  3RYC B;  2HJF C;  3CRC A;  4MS2 A;  4JI6 O;  3A8T A;  1N34 O;  2QEX V;  3JAK B;  1JMK C;  2X6C A;  2BTO A;  1ZLZ A;  4EKW A;  1O9H A;  1BZK A;  1S5J A;  1H8E G;  2A3Q A;  1GN4 A;  4DR7 O;  4RUE A;  1IBK B;  1ZTE A;  1K5S A;  1XMQ O;  3JAR B;  3R66 A;  2CGO A;  2W6I G;  5LBQ A;  5J2T B;  3AG4 B;  1N33 O;  4JTD B;  1GM8 A;  1QCE A;  3JAM N;  1BGY H;  5LP6 B;  4LF4 B;  3B77 A;  4J7Z A;  3CYO A;  5FPR A;  1N36 O;  1AR5 A;  3THO A;  2GBO A;  4K0K B;  4DV2 B;  2P4V A;  4DUY B;  2YIC A;  4EB6 A;  2BSK A;  1SRY A;  4UVC A;  3ZN1 A;  3ZHU A;  4X65 O;  2QWN B;  3FKS G;  2LW1 A;  1SQF A;  2M7W A;  4JF3 A;  1OCO C;  4WFE A;  1A32 A;  2IH3 C;  1D5N A;  5J9P C;  3IJ4 A;  4LC1 A;  3CE2 A;  2X6A A;  1Q6I A;  1MSW D;  5L3F A;  5ITZ B;  1GRJ A;  1WP8 A;  2ZNI A;  2Y69 B;  1D2D A;  3X2Q B;  4P9P A;  2XAF A;  3E22 A;  3SJA C;  3ZRX A;  1THZ A;  3T1Y O;  1NVP D;  1K4D C;  4IIJ B;  4PHZ A;  1Q82 W;  1FJG B;  1JCH A;  3SDL A;  2VWK A;  2JIZ G;  1XHX A;  1J95 A;  2P22 C;  5B1A C;  4FLZ A;  4JI7 B;  1KQS U;  3IFX A;  2ZE5 A;  3M8A A;  3AK2 A;  4UCS A;  1XUQ A;  1V54 C;  4IHJ A;  2Q7G A;  2IU0 A;  2JS5 A;  2F4V B;  1KD1 W;  4MW3 A;  1JOY A;  2HP8 A;  4LF6 O;  2Q4P A;  1WJZ A;  4LFB O;  4MTF A;  3GB7 C;  1OCO B;  3JCZ A;  2PUS A;  3AG3 C;  3CXC U;  3OE7 G;  3IC9 A;  3SYQ A;  5JH7 B;  1VP7 A;  3JCU Z;  2P4K A;  1JR9 A;  2YI8 A;  4L8J A;  3LSS A;  3VBB A;  1QR9 A;  5LOV B;  2YI9 A;  1SF9 A;  4NXN B;  4GZR B;  4I5S A;  5LHH A;  2Q0O C;  1H38 A;  2AW9 A;  4H44 B;  4DR1 B;  1YHQ V;  1S77 D;  4QE9 A;  2AGA A;  3N2G B;  3W7S A;  1Y4M A;  4O4I A;  3K58 A;  1OCC C;  3CXH F;  5CA0 B;  4UCU A;  5CMU A;  5JVD A;  2GHY A;  2ZE8 A;  2IBZ H;  2HVJ C;  4RUF A;  5FNV B;  1H2M A;  4Q6G A;  2P67 A;  1XMO B;  3C90 A;  1SZT A;  2LGW A;  3SR2 C;  2OYQ A;  2C2A A;  5C93 A;  4PDM A;  3FD9 A;  3E2E A;  4KL1 A;  4X1K B;  3AG3 B;  1WN7 A;  4QJF B;  4FLT A;  4JYA O;  1AI4 A;  4X62 B;  1DGS A;  2BE3 A;  1BQZ A;  4D7S A;  1G8M A;  2ITD C;  1F23 A;  1NQT A;  5IY5 C;  5LGU A;  4TV8 B;  4RAI A;  1NZ6 A;  1Q43 A;  1N34 B;  4ZOL B;  4JZ2 A;  4GLX A;  1FXK C;  3E83 A;  1XHZ A;  4PI0 A;  2JGD A;  4MVU A;  5K1P A;  4DR7 B;  3ETG A;  1WAZ A;  4JI3 O;  4F6E A;  4R8C A;  2EIL C;  1OCC B;  1N33 B;  2DQ0 A;  4RQE A;  4ASU G;  1N8R W;  3WB1 A;  3H1L H;  1SA0 B;  4TOI A;  3OEE G;  1N36 B;  4F4L A;  2WLM A;  2DYR C;  4B7E A;  4O2A B;  1P7G A;  4JTC B;  2LFR A;  2QTS A;  3JD1 A;  3RYC A;  3UO2 A;  2X6B A;  1HNX O;  1JJO A;  3RYH A;  1CP9 A;  1GO3 F;  1PD3 A;  3TXS A;  4X65 B;  1PKX A;  1JA8 A;  4C7U A;  3CCL V;  4EFE A;  2RN9 A;  3KZI Z;  4Z2W A;  5LGT A;  4MTO A;  1L0L H;  3WG7 C;  3RYI B;  5IY5 B;  4IYI A;  4YIP A;  1M56 B;  4KXR A;  4DV1 B;  5IJ9 B;  5J2T A;  4LFC O;  3OTF A;  1TAE A;  1E1R G;  3RN4 A;  3P3N A;  1VQM V;  4TQF A;  3SYA A;  1AJP A;  4JYY A;  2JVD A;  3T1Y B;  2EIL B;  3IAY A;  2L6L A;  3CC4 V;  1AI6 A;  3LSQ A;  3RBZ A;  4X1I B;  4X66 B;  2P5O A;  3L72 H;  1BT8 A;  3ZHR A;  1O9G A;  3JAS B;  2DYR B;  2PF4 E;  1R1B A;  3TCU A;  2JJ1 G;  3HKD B;  1VQN V;  2EIK C;  1VQ6 V;  4FFK A;  2OTL V;  1GTO A;  1Y66 A;  5BMV B;  5LMU O;  2OWO A;  2A9H A;  2EIM B;  5IYB O;  3HPL C;  5IWA O;  4LF6 B;  4FLV A;  3E8F A;  1VIB A;  2RCV A;  3P30 A;  3LDE A;  1BS3 A;  1FD9 A;  1NH2 D;  1YZB A;  1NT2 B;  5ITZ A;  1XIL A;  3CCJ V;  4HZ3 A;  4GKJ O;  3L9D A;  3UO3 A;  3WG7 B;  1KB9 F;  4DV4 B;  3CJH B;  2LO1 A;  4MVR A;  4IIJ A;  2QE7 G;  1FYJ A;  4CS2 A;  1U96 A;  1SC5 B;  3FFQ A;  1AR1 B;  3I55 V;  5D5P A;  3ZCC A;  3LDD A;  1GH6 A;  2CTQ A;  2CAZ C;  5IYC O;  4PA3 A;  2ZM6 O;  1US6 A;  2EIJ C;  2RJZ A;  3BCC H;  3G6E V;  3E86 A;  1AJQ A;  4BR6 A;  5IYZ A;  1P4R A;  4GT1 A;  2B1I A;  4ZHQ B;  4UCR A;  2W0X A;  1ARO P;  1K73 W;  3HB3 B;  1RM1 C;  4DXW A;  5KHG A;  2EIK B;  5JWP A;  1VQK V;  2NLJ C;  4CH5 A;  4OGQ B;  1RPR A;  5JH7 A;  4OPH A;  5JJE B;  3TJT A;  4JTA B;  4PA7 A;  5LOV A;  2Q0A A;  4J10 A;  4YJ3 B;  2YIB D;  2B1G A;  1FFX A;  1G4Y B;  3ASO B;  3DC6 A;  4I7Z B;  5IYD O;  4AHC A;  3N2G A;  2RNB A;  2V7Q G;  1GK9 A;  4DR3 B;  4PD4 F;  4MVO A;  2P90 A;  1QVF U;  3M99 B;  3AG1 B;  4FLU A;  3TET A;  3K5N A;  2X0L A;  1W59 A;  3ASN C;  5FNV A;  4JI3 B;  2LJ2 A;  2ZQM A;  1E1Q G;  3SPH A;  4TT3 G;  1I94 B;  3CC2 V;  3SPG A;  1P49 A;  1BHA A;  5LL6 Y;  1U97 A;  2R9R B;  4X1K A;  1H2S B;  1NU1 H;  1BCC H;  5DN6 G;  1NTK H;  3T1H O;  3R65 A;  1HW7 A;  3OT7 A;  3K5M A;  3P3P A;  1H2K A;  1WNS A;  1TGO A;  2UXD O;  2A0L A;  4FM1 A;  1B04 A;  3ZJZ A;  4KHP O;  3WB2 A;  1HNX B;  1I5X A;  4TV8 A;  2WLL B;  4NYK A;  2F23 A;  4ZOL A;  1TUE B;  5KMG B;  1OCR C;  2RDC A;  1F4M A;  3AK3 A;  2DJV A;  4G28 B;  3UM7 A;  1EN5 A;  2Z0A A;  1VAR A;  2CDY A;  2IH1 C;  1R3J C;  1SA0 A;  1G1X B;  1BMF G;  1YEW A;  4GCZ A;  2UU9 O;  1K97 A;  1V9P A;  3EVK A;  4O2A A;  2WAM A;  2HHH B;  3IC7 A;  3G71 V;  1KC8 W;  4QGP A;  4GX1 A;  4TUY A;  3K06 A;  4FM2 A;  2QKS A;  4X9Q A;  2Z5U A;  4QIW F;  1F7Y A;  3T1C A;  4N21 A;  4MT8 A;  1K3E A;  3A0R A;  2BCC H;  5L3D A;  4HBN A;  2ZT9 B;  3AG4 C;  4PEL A;  1OHH G;  2WLN A;  3RYI A;  2JGD B;  5E79 Z;  3CME V;  2CGN A;  5IWA B;  4DR6 O;  5KHJ A;  5IJ9 A;  4TWK A;  4MTX A;  4JI1 O;  3APO A;  1OCZ C;  4IYH A;  4DRX B;  2ZIN A;  1NVP B;  2CH7 B;  1OCR B;  3F5T A;  5J2U B;  4N23 A;  2QWP B;  2E5L B;  3J7A U;  3EXA A;  1XL4 A;  3L71 H;  3CRQ A;  3F7Y C;  3JD4 A;  2IW5 A;  3KG2 A;  2D2C B;  3ETE A;  1LUV A;  4JAS A;  4X1I A;  4JV5 O;  1Q86 W;  2A06 H;  4B08 A;  1N4C A;  4NTW A;  5B3S C;  3RYH B;  3H1I H;  4F6R A;  1VQ8 V;  5EIB C;  3HKD A;  2ODM A;  5EZY B;  1JQ0 A;  2BOC C;  4H33 A;  2YEV A;  3DXR B;  2A79 B;  5BMV A;  5LA6 B;  4NB5 A;  4E2L A;  2Y69 C;  4DV0 O;  3X2Q C;  1YSC A;  4PJ0 Z;  3CD6 V;  5DM6 V;  2JRI A;  1BQ0 A;  4DUZ O;  3N2K B;  5EBW C;  1TA8 A;  4FLX A;  1X59 A;  1ORQ C;  1VF7 A;  3D8C A;  2LFS A;  3ZMZ A;  4WFA V;  5IDJ A;  3CJH A;  3GVM A;  1MG1 A;  4PDL A;  3TGU H;  5KUK A;  4YIO A;  4UCV A;  5B1O A;  2FB5 A;  1OCZ B;  2RQ6 A;  4YY3 B;  1YJW V;  1K33 A;  3QNE A;  2MK3 A;  1YTF D;  1NTM H;  1KKC A;  2L35 A;  4FIP C;  4CC5 A;  4FPP A; 
#chains in the Genus database with same CATH homology
 2DYS C;  2C2A A;  3EHB B;  3CCQ V;  5C93 A;  4PDM A;  1LNQ A;  5L3C A;  3E89 A;  3E2E A;  5KUM A;  1S0V A;  4U7O A;  3QO8 A;  3CC7 V;  2JEU A;  3AG3 B;  3CCU V;  5CBF A;  3ZMS A;  3ZMT A;  4QJF B;  5BZB A;  1AI4 A;  2JDI G;  1W2B U;  4PA6 A;  4UXN A;  2BOB C;  1EBO A;  1S5H C;  2DW4 A;  4RO2 A;  2QM8 A;  3ZRW B;  4X8A A;  5B3S B;  1QVG U;  1YIJ V;  1G8M A;  4I9W A;  2ITD C;  1F23 A;  1NQT A;  2K1E A;  3DGE A;  3JD2 A;  5IY5 C;  1QR8 A;  3OAA G;  4L87 A;  5LGU A;  1ENV A;  4RAI A;  4WF9 V;  3H01 A;  1E79 G;  4G27 B;  2P6J A;  2ZDI A;  3RW0 A;  1FXK C;  3E83 A;  2CK3 G;  2EZP A;  1FXH A;  4MVU A;  4BAY A;  2W6J G;  3ETG A;  1L1F A;  3ZMU A;  1YJN V;  1F4N A;  4R8C A;  1S72 V;  2EIL C;  5CA3 A;  3EFF K;  1WPX A;  2HG5 C;  4MSW C;  3SJQ C;  1VQ9 V;  1OCC B;  2IJJ A;  3T4Z A;  2DQ0 A;  4RQE A;  1W0K G;  1FFT B;  4ASU G;  4UV9 A;  1N8R W;  4X88 A;  1JVM A;  5B1B B;  3STL C;  3OEE G;  4F4L A;  5H9C A;  2WLM A;  2DYR C;  2WLH A;  3K0G A;  4FMT A;  4WFG A;  3OR6 C;  1YI2 V;  2IU3 A;  1SER A;  2DYS B;  4JTC B;  4MW8 A;  4UVB A;  2LFR A;  4PA4 A;  4J9Z B;  1GKF A;  3JD1 A;  4GX2 A;  2X6B A;  4P30 A;  2H8P C;  1CEZ A;  3JD3 A;  1CP9 A;  1GO3 F;  1PD3 A;  5CBG A;  3RVY A;  1PKX A;  4Z1M G;  1VQO V;  2FTK A;  3CCL V;  2HR3 A;  3F5W C;  1F51 A;  5LGT A;  4MTO A;  3WG7 C;  1M9N A;  5IY5 B;  5CBH A;  2QM7 A;  4CZZ A;  3OEH G;  1M56 B;  4XDK A;  3JYC A;  4OXS A;  4GX5 A;  3FB7 C;  4KUM A;  3OM3 B;  1E1R G;  3PJS K;  5L3E A;  2XND G;  5H6Q A;  1VQM V;  2R9I A;  2EIJ B;  5B1N A;  3SYA A;  1AJP A;  4U7N A;  1NKD A;  2HLD G;  3ZIA G;  2WLL A;  2EIL B;  4R50 A;  3SPJ A;  3NXS A;  1YIT V;  3LUT B;  2WLI A;  3CC4 V;  1AI6 A;  3LSQ A;  4KFM A;  3RBZ A;  4J9Y B;  3ABK C;  2AHZ A;  1W0J G;  4BIU A;  2X7R B;  5LHG A;  3I56 V;  1RM1 B;  2DYR B;  5B1B C;  1EZJ A;  1FXV A;  1Q81 W;  3GWO A;  2UXX A;  3TCU A;  5EC1 C;  2JJ1 G;  4P9O A;  1PL0 A;  1H2G A;  3ABL C;  1R3I C;  1VQN V;  3IGA C;  2EIK C;  1KP2 A;  3ETD A;  4WFF A;  1VQ6 V;  3AEI A;  2XAJ A;  2OTL V;  1GTO A;  1Y66 A;  1SET A;  2WSS G;  4QNH B;  1M1K W;  5EBM C;  1VQL V;  2A9H A;  2P7T C;  1IXM A;  2EIM B;  5IYB O;  3HPL C;  2W0F C;  3RVZ A;  3CMA V;  3OUS A;  3ABU A;  3E8F A;  3P30 A;  1NR1 A;  3LDE A;  1NH2 D;  1YTF B;  3CCJ V;  4HZ3 A;  4MVS A;  1KKD A;  3K08 A;  3TK1 A;  2IJI A;  3AG2 C;  1QLE B;  2Y48 A;  1SES A;  1BL8 A;  3WG7 B;  3WFV A;  1K8A W;  3CP1 A;  4MVQ A;  4MVR A;  4LP8 A;  2QE7 G;  5LHI A;  3E8B A;  5FL7 G;  3ZRS A;  4BW5 A;  3W7W A;  1M56 C;  2PI5 A;  1AR1 B;  2JEX A;  2HFE C;  1KP3 A;  3I55 V;  2ZR2 A;  3ZCC A;  3LDD A;  1AI7 A;  1DLB A;  4G2K A;  5IYC O;  2EIN B;  2IJH A;  2QTO A;  1P7B A;  2V1D A;  4PA3 A;  2QA4 V;  4H37 A;  3W7X A;  3UKM A;  4DO2 A;  2EIJ C;  1ROP A;  3ASN B;  2OCC C;  5E1A C;  3E86 A;  4R7C A;  4FJC C;  1AJQ A;  2JJ2 G;  3W7U A;  3G6E V;  2XAH A;  1H8H G;  1S76 D;  1P4R A;  3FYE B;  3ABK B;  3FB5 C;  4GT1 A;  2B1I A;  3E35 A;  2DWD C;  1K9M W;  1ARO P;  1FS0 G;  1MOF A;  2LP7 A;  3D3I A;  3P32 A;  3FB8 C;  1K73 W;  3HB3 B;  3OUF A;  1RM1 C;  2B5U A;  2D3O W;  1R73 A;  4DXW A;  1K92 A;  3ABL B;  4Q20 A;  3ZRV A;  2EIK B;  4MTG A;  4HAM A;  1VQK V;  2NLJ C;  1M57 B;  1RPR A;  5KA5 A;  4GX0 A;  2EZO A;  2XAQ A;  2YSU B;  2EJR A;  1COW G;  3OMN B;  3B8N A;  2EIM C;  4JTA B;  4PA7 A;  4QE7 A;  2KB1 A;  3OMA B;  2GSM B;  3ABM C;  5L3B A;  1HWY A;  4JGS A;  3LNM B;  1FXK A;  2NNU A;  3AG2 B;  1K5Q A;  2B1G A;  1G4Y B;  3ASO B;  1QLE C;  5IYD O;  1AJN A;  2V7Q G;  3MHH C;  3STZ C;  2XAG A;  1EFR G;  1GK9 A;  5EBL C;  3LDC A;  4MVO A;  2P90 A;  1QVF U;  2F43 G;  2OT5 A;  3M99 B;  3AG1 B;  3OMI B;  2EIN C;  3K04 A;  4JYB A;  1R3L C;  5KA6 A;  4X89 A;  5CN0 A;  1BHB A;  3TET A;  1UJW B;  2OCC B;  2X0L A;  1JX9 A;  2HJF C;  3ASN C;  3JD0 A;  2ZQM A;  2DQ3 A;  2Q67 A;  4MS2 A;  4HYO A;  1R6N A;  2QEX V;  2Q6A A;  3OFN G;  1E1Q G;  2X6C A;  4TT3 G;  3SPH A;  3CC2 V;  2WPD G;  3SPG A;  3B8M A;  2EBO A;  2H94 A;  4EKW A;  1BHA A;  1H8E G;  3VOU A;  2ZXW B;  2R9R B;  4JPR A;  4PA9 A;  4WFH A;  4RUE A;  2Q69 A;  3SPC A;  2ATK C;  1K5S A;  4PDV A;  5DN6 G;  3K9A A;  3T2M A;  3R65 A;  1JPX A;  1PNK A;  2ZD9 A;  4WFB V;  2W6I G;  5LBQ A;  5HFM A;  3AG4 B;  1M57 C;  2YEV B;  4JTD B;  3K03 A;  1K34 A;  1GM8 A;  1QCE A;  1K7D A;  2A0L A;  5B1A B;  3ZRW A;  3ZJZ A;  5EC2 C;  2ZDI C;  1V54 B;  3B77 A;  1DTO A;  3CYO A;  5LGN A;  1I5X A;  3ABM B;  2WLL B;  1XL6 A;  1YJ9 V;  2WLI B;  1TUE B;  3D36 A;  4XDL A;  1OCR C;  4MVM A;  3W7T A;  1F4M A;  1CPY A;  1SRY A;  4LCU C;  1WLE A;  3ASO C;  3DTU B;  4UVC A;  3ZN1 A;  2DWE C;  4CBC A;  4G28 B;  3CPW U;  3FKS G;  3E8H A;  3UM7 A;  2Z3Y A;  2AHY A;  2M7W A;  4JF3 A;  4XBF A;  1OCO C;  4KP4 A;  4TSF G;  4UVA A;  3ABT A;  4WFE A;  3AG1 C;  1NH2 B;  2IH3 C;  1M90 W;  5J9P C;  3ML0 A;  2IH1 C;  2ZR3 A;  1R3J C;  4LC1 A;  1BMF G;  3OGC C;  4GCZ A;  2HKO A;  3CCE V;  5EK0 A;  4YXW G;  1K97 A;  2X6A A;  2WAM A;  3CCR V;  3IC7 A;  3G71 V;  1KC8 W;  1MAB G;  1S3J A;  1VQ5 V;  1MSW D;  5L3F A;  4GX1 A;  3K06 A;  2Y69 B;  4UV8 A;  1Q7Y W;  3CCV V;  1V55 C;  3X2Q B;  1ZWI C;  2QKS A;  4P9P A;  2XAF A;  2Z5U A;  4QIW F;  2WLJ A;  1THZ A;  2ZXW C;  3ZRX A;  3T1C A;  4N21 A;  4MT8 A;  1NVP D;  1K3E A;  3BY6 A;  1K4D C;  1PNM A;  3A0R A;  5L3D A;  1Q82 W;  3ZMV A;  1JCH A;  4BIZ A;  3AG4 C;  2JIZ G;  3ZN0 A;  4PEL A;  1OHH G;  1J95 A;  5B1A C;  1DF4 A;  1QBZ A;  1KQS U;  3IFX A;  2WLN A;  2Q68 A;  3CME V;  3QO7 A;  3SPI A;  4JAU A;  1V54 C;  4LBE C;  1OZ0 A;  1PNL A;  3QO5 A;  4MTX A;  4TWK A;  2IU0 A;  1OCZ C;  1NVP B;  5HFL A;  4QPK A;  1OCR B;  3FYI B;  4N23 A;  2WLK A;  1KD1 W;  2UXN A;  4MW3 A;  1JOY A;  3E8G A;  3K79 A;  1XL4 A;  4ZKI A;  3K3W A;  3F7Y C;  3JD4 A;  4PDR A;  2IW5 A;  3KG2 A;  4P2Z A;  3ETE A;  2ITC C;  4MTF A;  3CCS V;  1QLN A;  3CCM V;  1I5Y A;  3GB7 C;  4JAS A;  1OCO B;  1R6K A;  1GMG A;  3AG3 C;  3JCZ A;  3CXC U;  3OE7 G;  1B6Q A;  3SYQ A;  1Q86 W;  3MHS C;  4FK5 C;  2XOK G;  3SYC A;  4ZBM A;  4R6Z A;  5H6R A;  3LSS A;  5B3S C;  3VBB A;  5GW7 A;  1QR9 A;  1VQ8 V;  2WWW A;  4RQF A;  4UUJ C;  1R3K C;  3MD0 A;  1JQ0 A;  2BOC C;  4H33 A;  4MVZ A;  2YEV A;  2A79 B;  1NR7 A;  1AI5 A;  1VQ4 V;  1FXK B;  3BEH A;  1GM7 A;  1KEC A;  1V55 B;  3F7V C;  4I5S A;  3SYO A;  5LHH A;  4E2L A;  4JYC A;  1VQ7 V;  1RPO A;  3OW2 U;  1H38 A;  2Y69 C;  1YHQ V;  3X2Q C;  1S77 D;  1YSC A;  2OTJ V;  4QE9 A;  3G4S V;  3CD6 V;  4JAV A;  3T4D A;  5DM6 V;  2XAS A;  3W7S A;  5EBW C;  1NBM G;  1Y4M A;  3FB6 C;  1JJ2 U;  3OR7 C;  1ORQ C;  2LFS A;  1K4C C;  3ZMZ A;  4WFA V;  5IDJ A;  1OCC C;  1DF5 A;  1MG1 A;  5CMU A;  4PDL A;  2GHY A;  5KUK A;  4XDJ A;  1NJI W;  5B1O A;  3SYP A;  5L3G A;  1OCZ B;  2PI4 A;  2HVJ C;  2HVK C;  4RUF A;  4QPJ A;  1YJW V;  1K33 A;  3K0D A;  2IJK A;  2MK3 A;  3QNE A;  1VQP V;  1YTF D;  2P67 A;  4FIP C;  4WCE V;  1GM9 A;  2JK5 C;  1SZT A;  4FPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...