3CD6V

Co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 21
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3cd6V00
3OW2U 1QVGU 3I56V 3G4SV 2QEXV 1K73W 3G6EV 3CD6V 4WF9V 2OTLV 1VQMV 1VQ4V 1QVFU 2OTJV 1S72V 1VQ8V 1VQPV 1YJNV 1M90W 3CMAV 3CPWU 1VQKV 1K8AW 3CCMV 1VQLV 1KC8W 1K9MW 3CCSV 1YITV 3CCUV 4WCEV 1W2BU 4WFAV 1M1KW 1JJ2U 1KQSU 3CMEV 1YJ9V 1N8RW 1Q7YW 1VQ5V 1VQ9V 1YHQV 3CC2V 1VQ6V 1VQ7V 1VQOV 5DM6V 1R73A 2D3OW 1Q86W 3CC4V 3CXCU 1VQNV 3CCVV 4WFBV 3CCQV 1YIJV 1Q82W 1NJIW 3I55V 1KD1W 2QA4V 3CCLV 1YJWV 3CC7V 3CCJV 3G71V 1YI2V 1Q81W 3CCEV 3CCRV
chains in the Genus database with same CATH superfamily
4KFMA 3L74H 3L9DA 4I7ZB 4FM2A 1K34A 3OR6C 1S72V 2KG7A 1O9HA 3N2GB 5BY1A 4O2BB 4K0KO 2P06A 2XTAA 4O4HA 1QCEA 4ZHQA 3GB7C 1TGOA 2DYSB 3ZN0A 1ZUQA 2RCVA 2DYSC 3K08A 4UVBA 3CX5F 2IJJA 5E1AC 3AG3C 4CC5A 1YITV 4EB6B 4JZGA 1DF5A 1RPRA 3VOUA 3ZHUA 4JYCA 4MVMA 4LNUB 1NVPB 1BQ0A 2OCCB 1O9GA 3FB5C 3FB7C 1EFRG 4MSWC 2UUBO 4ZKIA 4F4LA 5L3DA 1V9PA 5L3CA 4PI0A 1AP6A 4DV5O 4IYHA 4DR3B 3R66A 1R6TA 1AJNA 2WA3A 3ZMSA 5CBGA 1FXVA 5LXTB 5KUMA 1F4MA 1DK1A 5EBMC 4RUFA 1YSCA 2AZ0A 1IURA 3OUFA 4O4JA 4UXNA 5JJJB 4I5SA 2Z3YA 1DGSA 2QM8A 1R3JC 4NYKA 4ZBMA 4TQDA 2FTKA 1ROPA 4CC6A 3K57A 3WG7C 4I55B 3H1LH 1M57B 4W4KA 1OCOC 3ZMZA 3H1HH 5CA0A 2Y48A 3SYQA 2OTJV 4Z1MG 4NXNO 4KP4A 2EJ7A 4CS2A 1AVMA 3JATB 2G38A 1V55B 4JZ2A 1Y6XA 1H38A 1VQ6V 2ZQMA 2RQ6A 4JI1B 5CBFA 5GONB 1NVPD 3ZHSA 2JS3A 2HG5C 3ABKB 3UM7A 2ZIOA 4O4JB 3P30A 2BSKB 1N32O 3PN1A 3T4ZA 4R8CA 2Q6AA 3A2FA 5KX5B 1BS3A 1YJ9V 1P49A 3GVMA 2BTOA 1LUVA 3D36C 1XUQA 2EIMB 4NXMO 1PP9H 2ZNIA 4MTXA 3VQXA 5LHHA 4LF8B 3ZRSA 5EK0A 2XAFA 5EYPB 3CJHB 2AW9A 3D8CA 5EIBC 2WAMA 3FB6C 3AG7A 4JF3A 3KG2A 2FMLA 5J2UA 4YJ2A 5LP6A 2Y4TA 5J2TB 2RDCA 5LA6A 3RYCB 4FZ1A 2GTSA 2H94A 4PI2A 5EYPA 3ZHVA 1Q6HA 4I50B 3K9SA 3OR7C 4J9ZB 4JI3B 1LR1A 1Q6IA 1ZL8B 5J2UB 1KKCA 4GLXA 1AI6A 2A9HA 3Q4HB 4B3SO 4YHHB 1SC5B 1Q5OA 5BMVA 5EC1C 4I9QA 1SQVH 1GTOA 1Q8IA 2W6JG 3KCYA 3CJHA 4PELA 2R9RB 1WLEA 3T1HB 2WLLA 4DR6B 3FAVB 4FLZA 2HVJC 4DR7O 3L72H 2JGDA 4X88A 5TISZ 5JQGB 4QE7A 2DWEC 4UUJC 1GM7A 5IYCO 4OXSA 4LF9B 2C2AA 4GT1A 4DV5B 1Q43A 4JI3O 1JFFA 4DW1A 1B06A 3HPLC 4LFAB 2UUCO 2A79B 3UQ8A 2VWJA 4I0XB 3ASNB 4DV3O 5GONA 3ABMC 2UXDO 4CBCA 3BCCH 2W6IG 3OD4A 4P2ZA 4YJ3B 3JASA 3F7VC 3CCQV 1S3JA 4FLUA 3BAAA 1FFXA 1HNWO 4K8XA 3OMIB 5LL6Y 1M56C 3ZS8C 1P4RA 1M90W 3HKDB 1H2SB 4DV4O 1NU1H 1Y74A 4LH7A 4JAVA 5JCOA 4C7UA 2KB1A 4JYAB 1ENVA 1URFA 3AK3A 4PDRA 4B3RO 1EN5A 4DV1B 3CCVV 2BTQB 1VMGA 1AJPA 1MNGA 5DEDA 3CHXA 4R50A 2ETNA 2OIEA 3RW0A 2LO1A 2QM7A 4MW3A 4X62O 2F95B 4PA9A 1VQ8V 2FL4A 5LGUA 3K04A 2OWOA 4FM0A 1CEZA 2CUGA 2YXYA 4K3AA 3ASOB 1SA0A 4MT8A 5AG2A 4JTDB 2OIGA 2WLMA 1Q81W 1SESA 5KAFZ 2BE3A 1H8HG 4F6RB 1XNQO 5L3BA 4DV1O 3BA9A 1VQ4V 4LCUC 4DV0O 3FX7A 1PNKA 1W0JG 5IDJA 5IT9N 4O4IB 2ZXWB 2HP8A 4FLWA 1GRJA 5EIBD 2JK5C 3WB1A 5LOVB 1KECA 2AXTZ 4O2BA 3H1IH 2ZXWC 3THOA 1M93A 3F5TA 1RPOA 4UB8Z 1IZ3A 3X2QB 2Q8VA 1PNMA 3JD3A 3RT3C 4NVPA 1AP5A 1M1KW 4GKKO 2EIMC 2AGAA 4TSFG 2P4VA 4JI8O 1WPBA 2QA4V 1KMIZ 2NN4A 4X1KB 4QE9A 1SQPH 4BIOA 1GN6A 1FJGO 3BFRA 1JA8A 2DQ3A 3ZHTA 3DTUB 1Q90D 1F7YA 4IT5A 3VQVA 3CB2A 3CXCU 2EZPA 2PF4E 3AG1B 4J41A 5IWAB 3K59A 1V54C 2OYQA 3CCEV 3VQYA 4YHHO 4L8JA 1X59A 1R3LC 1NR1A 5KHKA 1DLBA 4GX5A 3ZX6A 1M57C 3BHPA 4I4TA 2NLJC 2ILMA 1VQ9V 4WFFA 4BAYA 1VIBA 1ZTEA 2Q4PA 3EVKA 4FLXA 3CCLV 1XREA 3JAWB 4LF7B 3LSUA 4WBNA 3KKYA 2CAZC 3ABTA 3CXHF 2Q68A 1I94B 1W59A 4JYAO 4R7CA 1H2GA 1OHHG 4B3TO 2UU9B 3HKDA 2DQ0A 2LP7A 1OJHA 2VS0A 1HR0B 4FLTA 4BW9A 2CH7B 2DOSA 1GM9A 2F4VO 1YXBA 3HKEB 3T4DA 4P9PA 2PZSA 1I5YA 2R72A 2GSMB 1EBOA 4EFEA 3JASB 3G4SV 4PDVA 1I7FA 3CEIA 3CP1A 3J81N 3JARA 2DN9A 3R65A 1J5EB 2LFRA 3TXQA 1TUBA 2UXXA 3LUTB 4NTYA 2AHYA 3CYOA 2Q7GA 3QVNA 1JFFB 4U3FH 3JAMN 2BCCH 1YJWV 3EFFK 3H01A 5HFLA 1G6UA 1ZSPA 4X20A 1HP8A 2UXBB 1Q6UA 2Q0OC 1NZ6A 3APQA 3NXSA 3UT5A 1HW7A 1TVKB 3STZC 1VQPV 1IX9A 3OGIB 2GTAA 3K0GA 4ZIBA 4KHPO 2D2CB 3DXRB 2Y0PA 4X65O 4LF7O 5B1NA 3OAAG 5BMVB 1XNRB 4LF8O 2ZNJA 3IFXA 2QEXV 4HNAB 4NTWA 2DYRC 2VRZA 1MZEA 3OGCC 2QWOB 2AHZA 2VQFO 4WCEV 1LNQA 1SZXA 1H2MA 1PL4A 1US6A 2YSUB 1MZFA 1T5EA 1YF2A 3CRQA 3M99B 4FPPA 5LA6B 3QO5A 5GTIZ 1K97A 2EILB 4X1KA 3RYCA 2EINC 3UKMA 2CTRA 3MHHC 4J7JA 3ZHRA 5C8YB 2DMXA 4DUZO 4G27B 5IYZB 3JCUZ 1Z5VA 2LQTA 1S5HC 2YXLA 3N2KB 4PV1B 4N23A 4MVUA 2LJ2A 1AB3A 4GUNA 2YIBD 1SERA 1V55C 3SPCA 1S76D 1K3EA 1XMQO 4B3MO 3B4SA 4X20B 1CPYA 1K73W 2XHBA 4MVZA 4LFCO 1XI1A 1BQZA 5LOVA 1QHTA 2QJ1A 1N36O 1JJ2U 5H5NA 4QJFB 5JCOC 2W0FC 4FLVA 1PNLA 1FXKC 2X6CA 2IBZH 2EIJB 1D5AA 3OTOB 4XBFA 2DYRB 2X0LA 3G67A 3X2QC 2R9IA 2LFSA 3BEHA 1VQKV 4PA6A 2ADQB 2CGOA 2YS8A 1N33B 3BABA 2Q9LA 1Q7YW 3SGIA 1WB8A 5KMGA 1Y66A 2IM9A 1N0JA 3H9VA 3CC7V 4FFBB 4B3TB 4NKGB 2P6JA 1FFXB 3H1KH 3LDDA 1MSWD 4LF5O 2Y4UA 4U3JA 1M9NA 3OTOO 4K35A 3CCUV 4LR3A 2UUAO 3B2EE 3CMEV 5E79Z 1HNZO 2A7WA 2LW7A 2IH3C 5CA1A 2KKWA 2UUCB 5CMUA 5LHGA 2QWNB 2EZOA 1ORQC 1S0VA 4JTCB 3APOA 4LFCB 1VF5B 2EILC 2JS5A 4YJ3A 3QG5A 1AR1B 3JAKB 2VQFB 1R6NA 1L0NH 4QPJA 4FLYA 4H13B 3K5MA 3E2EA 4OPHA 4G28B 4QNHB 4J11A 1Z2GA 4HZ3A 3E22A 4DR7B 1M56B 3B8NA 2ZE5A 3KZIZ 2UXBO 4GX0A 4UCSA 4JV5O 2WLLB 4LH6A 3UO2A 2P4KA 1YTFD 4HAMA 4CH6A 5LMNB 1XMOO 2FYUH 4X66B 4JGSA 1M4UA 5CN0A 1IBLB 4B3SB 3N27A 5GW7A 1AJQA 4LWSB 4AQYB 2WLIB 1NTMH 1EN4A 4JV5B 1KU9A 1PL0A 4HYOA 2UUAB 3E89A 1TA8A 3N2GA 4X1IB 2WLIA 1VP7A 1NT2B 4E2LA 5JJNB 3JD4A 4LWSA 3BY6A 3VQWA 1JQ0A 4H37A 1KKDA 2HEPA 2F93B 3M7MX 1B04A 5GTHZ 1WP8A 1SZTA 4YY3O 4MTGA 3MHSC 3E22B 5B5EZ 1IVSA 3CMAV 2X6AA 3C3TA 3B40A 3HB3B 3CSXA 4TV9B 3E83A 4OGQB 2UXNA 2F1MA 4ZOLA 1XEQA 4PA7A 3AG2B 3RYIA 4LF4B 4PDMA 4J7KA 2DWDC 4WF9V 2MK3A 1RM1C 3ZCCA 4U7OA 1JVMA 2XUMA 3CPWU 5FPOA 3WFVA 1ZX3A 1YZBA 1CXZB 1JJOA 3KCXA 1TUBB 3DSQA 1K5QA 2QSAA 2XASA 3C3SA 2DE0X 3CCJV 3RFRA 2QM4A 5BXZA 4UCTA 3CCRV 3FYIB 5KHGA 4G2KA 5B1BC 1V54B 2XAJA 3ABLB 1BZKA 3E8GA 4JYBA 1F23A 3AG1C 4JI1O 2QKAA 2IJHA 3IC9A 3P3NA 4RQFA 2A0LA 3NR7A 1XILA 3ASOC 4YIPA 4HBNA 1R73A 2ZD9A 2YEVA 2CTQA 2ZKOA 3ZJZA 2UXCO 1EZVH 1QR8A 3RVZA 4W4LA 2HHHO 1WB7A 5LGNA 2GDSA 4JAUA 4X8AA 5KHHA 3K3WA 5H9CA 2N05A 2B9ZA 1XMQB 2JRIA 4FMTA 3SPJA 1UFIA 3E35A 1G8MA 3K79A 2ZR3A 4LF9O 1YTFB 4A5UB 2JIZG 1NBMG 5CA3A 5L3EA 5B1BB 5K1PA 1IBMO 2A06H 3SJBC 3SPHA 4YIOA 2H3OA 2WLKA 2QWPB 5H6RA 2R9AA 3Q4HA 1OCOB 5EBWC 4DR3O 1L1FA 4PD4F 2PUSA 5KA5A 4I50A 1PPJH 1RM1B 4Q6GA 4ZHQB 2ZM6B 2UXCB 2UXDB 2CE4A 3ZRWB 3LDEA 4PDLA 1R3IC 4HNAA 1QR9A 2XOKG 4EB6A 2KG7B 2WPDG 2Z0AA 1WAZA 3CC2V 3QNEA 2ITCC 4JASA 4D7SA 1WPXA 1D5NA 2M6YA 3ZMVA 3SYPA 3I55V 1FXKA 1QLEB 2RNBA 1IBKB 4GX1A 1MG1A 2F43G 1QLEC 3UT5B 4D7TA 2PYLA 3CCSV 1W2BU 5JH7A 1WA8A 3JSLA 2OCCC 5K1XA 4BIZA 3G80A 2JGUA 3A0BZ 4N21A 2KQXA 1GMGA 1GK9A 1FPOA 1ZWIC 1JPXA 5FL7G 1WNSA 4GYCB 3AG3B 2K1EA 4AHCA 2E5LB 4XDKA 5HFMA 4AI8A 4GZRB 4UVCA 2XT9A 1N34O 5LGTA 3SJAC 1S5JA 4FFBA 3E8HA 5LMUB 4CZZA 2WSSG 3ASNC 4H33A 3RN4A 2ZE6A 5KHJA 1AILA 1P7GA 5FNVB 5CA0B 3D3QA 4RUEA 1AR5A 1GN4A 1RSOB 4QIWF 2IJIA 2GV9A 3CE2A 3ETQA 1Y4MA 3JARB 3S3WA 3BA8A 2P7TC 1KC8W 2UU9O 1HNWB 2UUBB 3OFNG 4CH3A 4WBNB 3CRMA 5EZYB 4DV4B 3IGAC 4U7NA 1F4NA 2PGGA 1KUQA 5KMGB 3JCZA 1SQBH 5JJEB 4DXWA 1G4YB 4ICGA 3SDLA 3ABKC 4IGGA 4AILC 3CRCA 5IJ9B 3AEIA 2P90A 1TAEA 2ZIMA 2ARHA 4DW0A 1SS3A 1VQOV 4JI0O 2H8PC 2JVDA 4F6EA 3JAWA 1FFTB 3MD0A 4B08A 3ABLC 3N2KA 3LSSA 2ZM6O 3E8FA 2X6BA 1FYJA 1CP9A 4FM1A 1QVFU 3RYHA 5BZBA 4LNUA 1JCHA 1WP7A 4FFKA 2ZR2A 3T2MA 3I5DA 2X7RB 5IJ0A 4JPRA 1Q86W 4ASUG 4DV6O 3F5WC 5JQGA 1KBHA 4GCZA 3B77A 3T1YB 3SJCC 3FYEB 1G1XB 3I56V 3PJSK 2YDEA 1QNMA 2EIJC 4R6ZA 1K5SA 1U97A 2DW4A 4JI8B 5LBQA 5C8YA 1L8DA 3AG2C 4QPKA 3DC6A 3BRCA 2DJVA 2JJ1G 4MTFA 5L3FA 3AG4B 1QU7A 4K0KB 3L75H 2XNDG 3ML0A 4RWUA 1IXMA 3ZMTA 4DR1O 3SYOA 1BHBA 2Y69B 4LP8A 1BMFG 1NQTA 1A32A 1NR7A 4PJ0Z 5IY5B 5CB4A 5LP6B 2Q67A 4DR6O 3HR0A 2IJKA 3QO7A 4B7KA 1N33O 3OTFA 5IE9A 1X4TA 2YIDA 4DV7B 1NH2B 3J80N 3WG7B 1SQQH 4F6RA 1NKDA 1R6KA 4JYYA 3LNNA 1K4CC 1KB9F 2ADPA 3TJTA 3SYAA 3ABMB 3SR2C 3F7YC 4DV6B 3ZRXA 5IJ9A 2WWWA 3P32A 1H2NA 1YDXA 3LNMB 1NTZH 2V4DA 3FB8C 5KX5A 2WLHA 2B1IA 4GKJB 1SQGA 3RYHB 4UV8A 1BE3H 2PY5A 2PTMA 3VBBA 1MA1A 1FAFA 2N74A 1YEWA 1BGYH 1MMMA 2BOCC 4UCUA 1KP2A 1Y76B 1Y74B 4DV2B 1FS0G 4JI6B 4DR2O 1EN6A 4WFGA 4UCRA 1E1RG 3DC5A 5LHIA 1HDJA 1I94O 1KP3A 4X9QA 5EZYA 2V1DA 5KLVH 4TUYA 3GWOA 5CBHA 3D36A 1NJIW 3ICXA 4X64O 4J42A 1QBZA 1J5EO 2F23A 4LFBB 1QVGU 1I08A 3G6EV 4UFZA 4O2AA 1S5LZ 5KA6A 1GM8A 4IIJA 3WB2A 1D2DA 2QTSA 3RYIB 4IHJA 4I0XA 3JD1A 5B1AB 4B3MB 4DUZB 2YC0A 4DV0B 1WA8B 5JH7B 3STLC 5LP6C 2LGQA 4TV9A 4QGPA 1R1BA 4GKJO 1OCZB 2WLNA 3U11A 1IBMB 1ZAUA 2ODMA 2Y69C 1HWYA 1XQ8A 2JGDB 1FXKB 4FJCC 5F2VO 3C90A 2VWKA 3OEHG 1NI8A 3QTCA 2JEUA 2F66C 3T1CA 5EC2C 4DRXB 1AI4A 3W7SA 1JMKC 4X1IA 1OCCC 1YHQV 5J2TA 3JALB 2EIKB 3AK2A 1ZL8A 3RBZA 2ZCEA 1FD9A 3CRRA 3ZIAG 4BR6A 5ITZA 2VQEO 1OCZC 2YI8A 2GBOA 4JI4B 1VARA 5B66Z 3CS5A 1BHAA 1VQ5V 2XAQA 1I5XA 3RWRD 1YVWA 4UCVA 4DYLA 1WN7A 4LFBO 2YIAA 3JALA 4MS2A 3ZRWA 2N04A 1K92A 2EINB 2WA4A 4DRXA 1XL6A 4E4EA 4JI2B 4CH4A 2ZT9B 4EEQA 4LF5B 2CTWA 3EHBB 2RMKB 1XOUA 3UCSC 2CTPA 2EX3A 1VQNV 1F51A 2HJFC 4O4LB 3QF7A 4FK5C 1MABG 1GO3F 2HKOA 2EBOA 3TETA 2BSKA 3ZBHA 3K9AA 5FPRA 2YXHA 4DV7O 3TK1A 2KSDA 1TUEB 3ZHQA 1UJWB 4DR5B 3ZN1A 1VQ7V 4PHZA 4EFBA 4ABMA 3A0RA 2IW5A 4CS3A 3OM3B 1SQXH 3DGEA 3JAKA 3JATA 3HKBA 4TOIA 1DF4A 2R70A 3HKCB 3O9OA 1XBLA 2OTLV 3BVOA 1IBKO 2GUZA 2ZINA 4OX9O 4JI5B 4LF6O 1PD3A 1B3QA 3RVYA 1VQLV 2QKCA 1IBLO 1SKVA 2GUZB 2K9PA 4FVMA 2QDOA 3CC4V 4TT3G 4X64B 1Y76A 2E75B 4I55A 3HKBB 2IU3A 3W7XA 1NTKH 3U0ZA 2ZE7A 3G71V 2XAGA 3E8BA 3FFQA 1S77D 2GHYA 2Q0AA 3K0DA 4TUYB 4CH5A 5H6QA 2L6LA 1E79G 4DR2B 5BR8O 1H2KA 3J7AU 1FKAO 3JD0A 4ZOLB 1GAXA 3K06A 1AI5A 2B5UA 3FD9A 3ZEDA 3L71H 4DK1A 4KHPB 1XNQB 3WU2Z 2EULA 5LXTA 2QWRB 3HKCA 2LGWA 2HLDG 2QGNA 1VQMV 4H44B 1NS1A 2FKXA 2RN9A 3JD2A 3O65A 2P22C 2QWQB 2YI9A 1DTOA 2IH1C 1N8RW 3AG4C 3UO3A 2E5LO 1EZJA 2Q5ZA 1YI2V 1OZ0A 5FLXN 2JJ2G 2OCHA 3B09A 4J80A 1N34B 2ITDC 5LMNO 1XMOB 4JI5O 4LF6B 2Q7HA 3OEEG 4LFAO 1VF6A 2YUAA 4UCOA 4JAAA 3P3PA 4DV2O 1Z5WA 1K7DA 4O4HB 4NXNB 4CS4A 5DM6V 1VEWA 4DK0A 5ITZB 1OCRB 4YJ2B 5IYZA 2PYJA 4TWKA 5L3GA 4B3RB 3IC7A 3K5LA 1K4DC 4Z1VA 3RGBA 4AQYO 4KXRA 4MVOA 2CK3G 5CB4B 5A2QN 1XL4A 3DXRA 1MSDA 1MOFA 4XDLA 2Y0IA 1W0KG 3AK1A 3W7TA 1KD1W 5D5PA 4DR4O 3FKSG 5J9PC 2HFEC 5JVDB 3OE7G 5IJ0B 1P7BA 1N4CA 2LW1A 4LF4O 1P84F 2OT5A 2P67A 5B3SB 5CA1B 4MTOA 3B8MA 4RAIA 3W7UA 1KYOF 1PKXA 3SJQC 4IHJB 4DR1B 3QO8A 4ZI7B 3ZMUA 3CWBH 3ZRVA 2IU0A 3MDSA 1BT8A 4X89A 3T1HO 2YICA 2BOBC 1OV9A 4JI4O 3TXSA 5IWAO 2QTOA 1B6QA 4BW5A 4TQFA 3GWKC 5D5QA 4TV8B 1U96A 1HR0O 3LDCA 4XDJA 2MW2B 4OPAA 2EIKC 4KUMA 5BR8B 2M7WA 3RYFB 4IIJB 1IXBA 2NNUA 5B3SC 3OUSA 4O2AB 3L70H 3OT7A 4RO2A 1HNZB 2WLJA 1SQFA 4U3JB 2EJRA 1HNXO 3OMAB 3SPIA 4DR4B 1JOYA 5KUKA 1XHXA 3JYCA 4JI6O 3A0HZ 1N0NA 1AR4A 5LYJB 1GN3A 1PM9A 5A9GA 2Q73A 4WFAV 4PA4A 4JI7O 1BL8A 1XHZA 4EKWA 1IDSA 1RSOA 1Y67A 3SPGA 2QE7G 1SF9A 5EBLC 4GX2A 2JDIG 5FNVA 1H2LA 3OW2U 4NXMB 4MVRA 3CD6V 3A8TA 4RQEA 4O4LA 1OCRC 4MVQA 1GKFA 1YJNV 5IYBO 2HR3A 1K9MW 3WB0A 2ZDIC 3K03A 4NB5A 2Q7EA 4ZI7A 4K8ZA 1EM1A 4BIUA 4FIPC 1LUWA 2V7QG 2QR4A 1AI7A 2ATKC 4KL1A 2HHHB 2E3CA 1FXHA 3ETEA 4B7EA 2E74B 4X66O 2W0XA 1WJZA 3ETGA 4L87A 3L73H 3K58A 3BPZA 1L0LH 1UPGA 4LBEC 4DO2A 4FZ0A 2L35A 1BSMA 1ZLZA 4OX9B 1GN2A 3OMNB 1SRYA 4WFEA 1RP3B 1M5IA 3S3XA 3G6BA 5KHIA 2Z5UA 4P30A 4I9WA 4X65B 4J7ZA 4UB6Z 2F4VB 3M8AA 3JSNA 3ETDA 4MVSA 4NTXA 4JI7B 2YIBA 4DR5O 4YY3B 5IYDO 4O4IA 2XAHA 4PA3A 2FB5A 1SETA 4WFBV 1TVKA 2JEXA 3U10A 1VF7A 4WFHA 4J10A 3IAYA 1BCCH 1QQCA 1N36B 1K8AW 1SA0B 4JI2O 4IL6Z 4DV3B 4J9YB 3H1JH 5DECA 3T1YO 4X1YA 1YIJV 5IY5C 1VF6C 4Q20A 2CGNA 1E1QG 4Z2WA 2QKSA 4DUYB 5LYJA 1Q3EA 3E86A 3HKEA 1PV0A 3D3IA 1KQSU 4LC1A 1GH6A 2E76B 1JR9A 1K33A 4JTAB 1OCCB 1HNXB 5LMUO 1FJGB 3TGUH 3SYCA 4GKKB 2RJZA 1XDCA 3K5NA 2Q69A 1COWG 4NR1A 4UV9A 4P9OA 5JWPA 1QLNA 4X62B 4UVAA 2PI4A 4MW8A 2BTQA 2CH7A 4DUYO 3TCUA 2D3OW 5KAIZ 1Q82W 5B1AC 1XNRO 3CRAA 1RFYA 1R3KC 3RYFA 4TV8A 2AZ2A 4JI0B 2YEVB 3K5OA 4D6TH 4IYIA 2P5OA 2NR5A 3MAQA 2HJDA 2VQEB 2HVKC 1NH2D 5H2FZ 3EXAA 2CDYA 3LSQA 4I4TB 4X1YB 3W7WA 3IJ4A 1YCIA 1H8EG 5DN6G 3ABUA 4H0LB 1JX9A 3CCMV 4BWAA 1N32B 4YXWG 5B1OA 5C93A 1J95A 2PI5A 2A3QA 2B1GA 1I0HA 5JVDA 1AROP 1THZA 2ZE8A 2ZDIA 2O57A 3FAVA
chains in the Genus database with same CATH topology
3ABTA 4KFMA 2Q68A 1K34A 3OR6C 2OTLV 3ZRWB 3LDEA 1S72V 1PD3A 4PDLA 3RVYA 1VQLV 4R7CA 1H2GA 1OHHG 1R3IC 1QR9A 2XOKG 2DQ0A 2WPDG 2LP7A 3CC2V 3QNEA 2ITCC 4JASA 4TT3G 1WPXA 3CC4V 3ZMVA 1GM9A 3SYPA 1QCEA 3I55V 2IU3A 3W7XA 3T4DA 1FXKA 1QLEB 3GB7C 3G71V 2XAGA 4P9PA 2DYSB 1I5YA 3ZN0A 2GSMB 3E8BA 1EBOA 4GX1A 3G4SV 1MG1A 4PDVA 2F43G 2DYSC 1S77D 2GHYA 1QLEC 3K08A 3CP1A 3K0DA 4UVBA 2IJJA 5H6QA 5E1AC 3AG3C 3CCSV 1YITV 1W2BU 1E79G 3R65A 1DF5A 1RPRA 3VOUA 2OCCC 3JD0A 2LFRA 4BIZA 4JYCA 4MVMA 2UXXA 3K06A 3LUTB 1AI5A 4N21A 2AHYA 2B5UA 3CYOA 1NVPB 1GMGA 1GK9A 2OCCB 3FB5C 1YJWV 3FB7C 3EFFK 1ZWIC 3H01A 1JPXA 5FL7G 5HFLA 3AG3B 1EFRG 4MSWC 2HLDG 4ZKIA 4F4LA 5L3DA 2K1EA 4XDKA 1VQMV 5HFMA 3NXSA 5L3CA 3STZC 1VQPV 3JD2A 4UVCA 3K0GA 5LGTA 1DTOA 2IH1C 1N8RW 1AJNA 3E8HA 4CZZA 2WSSG 3AG4C 3ASNC 4H33A 3ZMSA 5CBGA 1FXVA 5KUMA 1EZJA 1F4MA 5EBMC 4RUFA 5B1NA 3OAAG 1YI2V 1YSCA 4RUEA 1OZ0A 2JJ2G 3IFXA 4QIWF 2IJIA 2QEXV 3OUFA 2ITDC 4UXNA 2DYRC 3OEEG 1Y4MA 4I5SA 3OGCC 2P7TC 2Z3YA 1KC8W 2QM8A 2AHZA 1R3JC 4WCEV 1LNQA 4ZBMA 3OFNG 1K7DA 2YSUB 2FTKA 1ROPA 5DM6V 3IGAC 3M99B 4FPPA 4U7NA 3QO5A 1K97A 2EILB 3WG7C 1OCRB 1F4NA 2EINC 1M57B 3UKMA 3JCZA 1OCOC 4TWKA 5L3GA 3ZMZA 3MHHC 3IC7A 2Y48A 4DXWA 1G4YB 3SYQA 2OTJV 4Z1MG 1K4DC 4G27B 3ABKC 4KP4A 4MVOA 2CK3G 1S5HC 1XL4A 3AEIA 2P90A 1V55B 4N23A 1H38A 4MVUA 1VQ6V 1MOFA 1VQOV 2ZQMA 5CBFA 4XDLA 2H8PC 1SERA 1FFTB 1W0KG 3MD0A 1V55C 3W7TA 1KD1W 1NVPD 3SPCA 1S76D 3ABLC 1K3EA 3FKSG 5J9PC 2HFEC 2HG5C 3ABKB 3LSSA 3UM7A 3OE7G 1CPYA 1K73W 3E8FA 2X6BA 3P30A 1P7BA 4MVZA 1CP9A 1QVFU 2OT5A 2P67A 5BZBA 1JCHA 3T4ZA 5B3SB 4R8CA 2Q6AA 4MTOA 3B8MA 4RAIA 3W7UA 1JJ2U 4QJFB 3T2MA 2ZR2A 1YJ9V 1PKXA 3SJQC 2X7RB 2W0FC 3QO8A 4JPRA 1Q86W 4ASUG 1PNLA 3F5WC 2EIMB 1FXKC 2X6CA 3ZMUA 4GCZA 2EIJB 3B77A 4MTXA 5LHHA 3ZRVA 3FYEB 3ZRSA 2IU0A 4XBFA 4X89A 3I56V 2DYRB 2XAFA 5EK0A 2BOBC 3PJSK 2X0LA 3X2QC 2R9IA 2EIJC 4R6ZA 2QTOA 1B6QA 2LFSA 4BW5A 1K5SA 2WAMA 2DW4A 3BEHA 4PA6A 1VQKV 3LDCA 4XDJA 5LBQA 3AG2C 4QPKA 3FB6C 4JF3A 2EIKC 4KUMA 3KG2A 2JJ1G 1Q7YW 2M7WA 4MTFA 5L3FA 3AG4B 2NNUA 1Y66A 5B3SC 3OUSA 4RO2A 3CC7V 2WLJA 2EJRA 2H94A 3OMAB 3SPIA 1JOYA 2XNDG 3ML0A 3ZMTA 1IXMA 2P6JA 5KUKA 3SYOA 1BHBA 3JYCA 2Y69B 3LDDA 1MSWD 4LP8A 1BMFG 1NQTA 1M9NA 3OR7C 4J9ZB 1NR7A 3CCUV 4WFAV 4PA4A 5IY5B 3CMEV 1BL8A 2IH3C 4EKWA 2Q67A 1AI6A 2A9HA 5CMUA 3SPGA 2QE7G 5EBLC 5LHGA 2IJKA 5EC1C 4GX2A 3QO7A 2EZOA 2JDIG 1ORQC 1GTOA 2W6JG 3OW2U 1S0VA 4PELA 4MVRA 4JTCB 3CD6V 4RQEA 1NH2B 1OCRC 4MVQA 1GKFA 2EILC 2R9RB 3WG7B 1WLEA 1YJNV 5IYBO 2WLLA 2HR3A 1K9MW 2HVJC 1NKDA 1R6KA 1AR1B 2ZDIC 3K03A 1R6NA 1K4CC 4X88A 3SYAA 4QE7A 3ABMB 4FIPC 4QPJA 2DWEC 2V7QG 1GM7A 3F7YC 4UUJC 4BIUA 4OXSA 3ZRXA 5IYCO 2WWWA 3P32A 3LNMB 2C2AA 1AI7A 4GT1A 3FB8C 2ATKC 2WLHA 2B1IA 3E2EA 4G28B 1FXHA 3ETEA 4UV8A 4QNHB 3HPLC 4HZ3A 2A79B 1M56B 3B8NA 3ETGA 4L87A 3VBBA 3ASNB 3ABMC 4GX0A 4CBCA 4P2ZA 2W6IG 4LBEC 4DO2A 2WLLB 1YTFD 4HAMA 3F7VC 3OMNB 1S3JA 1SRYA 3CCQV 2BOCC 4JGSA 4WFEA 5CN0A 1KP2A 5GW7A 1AJQA 2Z5UA 3OMIB 4P30A 1FS0G 4I9WA 1M56C 2WLIB 1P4RA 4WFGA 1E1RG 5LHIA 1M90W 3ETDA 4MVSA 1PL0A 4HYOA 1KP3A 3E89A 4JAVA 2WLIA 2KB1A 1ENVA 2V1DA 4PDRA 4E2LA 3JD4A 3GWOA 5IYDO 2XAHA 3BY6A 4PA3A 5CBHA 1JQ0A 4H37A 1KKDA 3CCVV 3D36A 1SETA 4WFBV 1AJPA 1NJIW 4R50A 3RW0A 1QBZA 2JEXA 1SZTA 1QVGU 2QM7A 4MW3A 3G6EV 4WFHA 4MTGA 4PA9A 5KA6A 3MHSC 1GM8A 1VQ8V 3CMAV 2X6AA 3HB3B 5LGUA 1K8AW 3E83A 3K04A 3JD1A 2UXNA 5B1AB 4PA7A 1CEZA 3AG2B 4J9YB 3STLC 3ASOB 4MT8A 1YIJV 4JTDB 5IY5C 2WLMA 4PDMA 1Q81W 1SESA 4Q20A 1H8HG 1OCZB 2WLNA 2DWDC 5L3BA 1E1QG 1HWYA 2MK3A 2Y69C 4WF9V 2QKSA 1RM1C 1VQ4V 4LCUC 3E86A 3ZCCA 4U7OA 1JVMA 1FXKB 4FJCC 3CPWU 1PNKA 1W0JG 3WFVA 3OEHG 5IDJA 2JEUA 3T1CA 5EC2C 3D3IA 2ZXWB 4LC1A 1KQSU 1AI4A 3W7SA 2JK5C 1OCCC 1YHQV 1K33A 4JTAB 1OCCB 1KECA 2EIKB 1K5QA 2XASA 3SYCA 2ZXWC 3RBZA 3CCJV 3CCRV 2Q69A 1RPOA 3ZIAG 3FYIB 4G2KA 5B1BC 1COWG 1V54B 2XAJA 3ABLB 4P9OA 4UV9A 3X2QB 3E8GA 4JYBA 1F23A 1OCZC 1PNMA 3JD3A 1QLNA 3AG1C 4UVAA 2IJHA 2PI4A 4MW8A 1M1KW 2EIMC 4RQFA 2A0LA 4TSFG 1BHAA 3ASOC 1VQ5V 3TCUA 2XAQA 1I5XA 1R73A 2D3OW 2ZD9A 2YEVA 1Q82W 5B1AC 2QA4V 3ZJZA 1QR8A 3RVZA 4MS2A 1R3KC 4QE9A 3ZRWA 1K92A 2YEVB 5LGNA 2EINB 4JAUA 4X8AA 3K3WA 5H9CA 1XL6A 2DQ3A 3DTUB 4FMTA 3SPJA 3E35A 1G8MA 3K79A 2ZR3A 3EHBB 2HVKC 1NH2D 1YTFB 3CXCU 2JIZG 2EZPA 1F51A 1VQNV 2HJFC 3AG1B 3LSQA 1NBMG 5CA3A 5L3EA 1V54C 4FK5C 1MABG 5B1BB 3CCEV 1GO3F 3W7WA 1H8EG 3SPHA 2HKOA 5DN6G 2WLKA 3ABUA 2EBOA 3TETA 1R3LC 1NR1A 5H6RA 1DLBA 4GX5A 1OCOB 1JX9A 3K9AA 1M57C 5EBWC 3CCMV 1L1FA 4YXWG 3TK1A 5B1OA 1TUEB 2NLJC 1UJWB 5C93A 1J95A 2PI5A 1VQ9V 2B1GA 3ZN1A 1VQ7V 4WFFA 4BAYA 5KA5A 3A0RA 2IW5A 1AROP 3OM3B 3DGEA 3CCLV 1THZA 2ZDIA 1RM1B 1DF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 U;  1QVG U;  3I56 V;  3G4S V;  2QEX V;  1K73 W;  3G6E V;  3CD6 V;  4WF9 V;  2OTL V;  1VQM V;  1VQ4 V;  1QVF U;  2OTJ V;  1S72 V;  1VQ8 V;  1VQP V;  1YJN V;  1M90 W;  3CMA V;  3CPW U;  1VQK V;  1K8A W;  3CCM V;  1VQL V;  1KC8 W;  1K9M W;  3CCS V;  1YIT V;  3CCU V;  4WCE V;  1W2B U;  4WFA V;  1M1K W;  1JJ2 U;  1KQS U;  3CME V;  1YJ9 V;  1N8R W;  1Q7Y W;  1VQ5 V;  1VQ9 V;  1YHQ V;  3CC2 V;  1VQ6 V;  1VQ7 V;  1VQO V;  5DM6 V;  1R73 A;  2D3O W;  1Q86 W;  3CC4 V;  3CXC U;  1VQN V;  3CCV V;  4WFB V;  3CCQ V;  1YIJ V;  1Q82 W;  1NJI W;  3I55 V;  1KD1 W;  2QA4 V;  3CCL V;  1YJW V;  3CC7 V;  3CCJ V;  3G71 V;  1YI2 V;  1Q81 W;  3CCE V;  3CCR V; 
#chains in the Genus database with same CATH topology
 4KFM A;  3L74 H;  3L9D A;  4I7Z B;  4FM2 A;  1K34 A;  3OR6 C;  1S72 V;  2KG7 A;  1O9H A;  3N2G B;  5BY1 A;  4O2B B;  4K0K O;  2P06 A;  2XTA A;  4O4H A;  1QCE A;  4ZHQ A;  3GB7 C;  1TGO A;  2DYS B;  3ZN0 A;  1ZUQ A;  2RCV A;  2DYS C;  3K08 A;  4UVB A;  3CX5 F;  2IJJ A;  5E1A C;  3AG3 C;  4CC5 A;  1YIT V;  4EB6 B;  4JZG A;  1DF5 A;  1RPR A;  3VOU A;  3ZHU A;  4JYC A;  4MVM A;  4LNU B;  1NVP B;  1BQ0 A;  2OCC B;  1O9G A;  3FB5 C;  3FB7 C;  1EFR G;  4MSW C;  2UUB O;  4ZKI A;  4F4L A;  5L3D A;  1V9P A;  5L3C A;  4PI0 A;  1AP6 A;  4DV5 O;  4IYH A;  4DR3 B;  3R66 A;  1R6T A;  1AJN A;  2WA3 A;  3ZMS A;  5CBG A;  1FXV A;  5LXT B;  5KUM A;  1F4M A;  1DK1 A;  5EBM C;  4RUF A;  1YSC A;  2AZ0 A;  1IUR A;  3OUF A;  4O4J A;  4UXN A;  5JJJ B;  4I5S A;  2Z3Y A;  1DGS A;  2QM8 A;  1R3J C;  4NYK A;  4ZBM A;  4TQD A;  2FTK A;  1ROP A;  4CC6 A;  3K57 A;  3WG7 C;  4I55 B;  3H1L H;  1M57 B;  4W4K A;  1OCO C;  3ZMZ A;  3H1H H;  5CA0 A;  2Y48 A;  3SYQ A;  2OTJ V;  4Z1M G;  4NXN O;  4KP4 A;  2EJ7 A;  4CS2 A;  1AVM A;  3JAT B;  2G38 A;  1V55 B;  4JZ2 A;  1Y6X A;  1H38 A;  1VQ6 V;  2ZQM A;  2RQ6 A;  4JI1 B;  5CBF A;  5GON B;  1NVP D;  3ZHS A;  2JS3 A;  2HG5 C;  3ABK B;  3UM7 A;  2ZIO A;  4O4J B;  3P30 A;  2BSK B;  1N32 O;  3PN1 A;  3T4Z A;  4R8C A;  2Q6A A;  3A2F A;  5KX5 B;  1BS3 A;  1YJ9 V;  1P49 A;  3GVM A;  2BTO A;  1LUV A;  3D36 C;  1XUQ A;  2EIM B;  4NXM O;  1PP9 H;  2ZNI A;  4MTX A;  3VQX A;  5LHH A;  4LF8 B;  3ZRS A;  5EK0 A;  2XAF A;  5EYP B;  3CJH B;  2AW9 A;  3D8C A;  5EIB C;  2WAM A;  3FB6 C;  3AG7 A;  4JF3 A;  3KG2 A;  2FML A;  5J2U A;  4YJ2 A;  5LP6 A;  2Y4T A;  5J2T B;  2RDC A;  5LA6 A;  3RYC B;  4FZ1 A;  2GTS A;  2H94 A;  4PI2 A;  5EYP A;  3ZHV A;  1Q6H A;  4I50 B;  3K9S A;  3OR7 C;  4J9Z B;  4JI3 B;  1LR1 A;  1Q6I A;  1ZL8 B;  5J2U B;  1KKC A;  4GLX A;  1AI6 A;  2A9H A;  3Q4H B;  4B3S O;  4YHH B;  1SC5 B;  1Q5O A;  5BMV A;  5EC1 C;  4I9Q A;  1SQV H;  1GTO A;  1Q8I A;  2W6J G;  3KCY A;  3CJH A;  4PEL A;  2R9R B;  1WLE A;  3T1H B;  2WLL A;  4DR6 B;  3FAV B;  4FLZ A;  2HVJ C;  4DR7 O;  3L72 H;  2JGD A;  4X88 A;  5TIS Z;  5JQG B;  4QE7 A;  2DWE C;  4UUJ C;  1GM7 A;  5IYC O;  4OXS A;  4LF9 B;  2C2A A;  4GT1 A;  4DV5 B;  1Q43 A;  4JI3 O;  1JFF A;  4DW1 A;  1B06 A;  3HPL C;  4LFA B;  2UUC O;  2A79 B;  3UQ8 A;  2VWJ A;  4I0X B;  3ASN B;  4DV3 O;  5GON A;  3ABM C;  2UXD O;  4CBC A;  3BCC H;  2W6I G;  3OD4 A;  4P2Z A;  4YJ3 B;  3JAS A;  3F7V C;  3CCQ V;  1S3J A;  4FLU A;  3BAA A;  1FFX A;  1HNW O;  4K8X A;  3OMI B;  5LL6 Y;  1M56 C;  3ZS8 C;  1P4R A;  1M90 W;  3HKD B;  1H2S B;  4DV4 O;  1NU1 H;  1Y74 A;  4LH7 A;  4JAV A;  5JCO A;  4C7U A;  2KB1 A;  4JYA B;  1ENV A;  1URF A;  3AK3 A;  4PDR A;  4B3R O;  1EN5 A;  4DV1 B;  3CCV V;  2BTQ B;  1VMG A;  1AJP A;  1MNG A;  5DED A;  3CHX A;  4R50 A;  2ETN A;  2OIE A;  3RW0 A;  2LO1 A;  2QM7 A;  4MW3 A;  4X62 O;  2F95 B;  4PA9 A;  1VQ8 V;  2FL4 A;  5LGU A;  3K04 A;  2OWO A;  4FM0 A;  1CEZ A;  2CUG A;  2YXY A;  4K3A A;  3ASO B;  1SA0 A;  4MT8 A;  5AG2 A;  4JTD B;  2OIG A;  2WLM A;  1Q81 W;  1SES A;  5KAF Z;  2BE3 A;  1H8H G;  4F6R B;  1XNQ O;  5L3B A;  4DV1 O;  3BA9 A;  1VQ4 V;  4LCU C;  4DV0 O;  3FX7 A;  1PNK A;  1W0J G;  5IDJ A;  5IT9 N;  4O4I B;  2ZXW B;  2HP8 A;  4FLW A;  1GRJ A;  5EIB D;  2JK5 C;  3WB1 A;  5LOV B;  1KEC A;  2AXT Z;  4O2B A;  3H1I H;  2ZXW C;  3THO A;  1M93 A;  3F5T A;  1RPO A;  4UB8 Z;  1IZ3 A;  3X2Q B;  2Q8V A;  1PNM A;  3JD3 A;  3RT3 C;  4NVP A;  1AP5 A;  1M1K W;  4GKK O;  2EIM C;  2AGA A;  4TSF G;  2P4V A;  4JI8 O;  1WPB A;  2QA4 V;  1KMI Z;  2NN4 A;  4X1K B;  4QE9 A;  1SQP H;  4BIO A;  1GN6 A;  1FJG O;  3BFR A;  1JA8 A;  2DQ3 A;  3ZHT A;  3DTU B;  1Q90 D;  1F7Y A;  4IT5 A;  3VQV A;  3CB2 A;  3CXC U;  2EZP A;  2PF4 E;  3AG1 B;  4J41 A;  5IWA B;  3K59 A;  1V54 C;  2OYQ A;  3CCE V;  3VQY A;  4YHH O;  4L8J A;  1X59 A;  1R3L C;  1NR1 A;  5KHK A;  1DLB A;  4GX5 A;  3ZX6 A;  1M57 C;  3BHP A;  4I4T A;  2NLJ C;  2ILM A;  1VQ9 V;  4WFF A;  4BAY A;  1VIB A;  1ZTE A;  2Q4P A;  3EVK A;  4FLX A;  3CCL V;  1XRE A;  3JAW B;  4LF7 B;  3LSU A;  4WBN A;  3KKY A;  2CAZ C;  3ABT A;  3CXH F;  2Q68 A;  1I94 B;  1W59 A;  4JYA O;  4R7C A;  1H2G A;  1OHH G;  4B3T O;  2UU9 B;  3HKD A;  2DQ0 A;  2LP7 A;  1OJH A;  2VS0 A;  1HR0 B;  4FLT A;  4BW9 A;  2CH7 B;  2DOS A;  1GM9 A;  2F4V O;  1YXB A;  3HKE B;  3T4D A;  4P9P A;  2PZS A;  1I5Y A;  2R72 A;  2GSM B;  1EBO A;  4EFE A;  3JAS B;  3G4S V;  4PDV A;  1I7F A;  3CEI A;  3CP1 A;  3J81 N;  3JAR A;  2DN9 A;  3R65 A;  1J5E B;  2LFR A;  3TXQ A;  1TUB A;  2UXX A;  3LUT B;  4NTY A;  2AHY A;  3CYO A;  2Q7G A;  3QVN A;  1JFF B;  4U3F H;  3JAM N;  2BCC H;  1YJW V;  3EFF K;  3H01 A;  5HFL A;  1G6U A;  1ZSP A;  4X20 A;  1HP8 A;  2UXB B;  1Q6U A;  2Q0O C;  1NZ6 A;  3APQ A;  3NXS A;  3UT5 A;  1HW7 A;  1TVK B;  3STZ C;  1VQP V;  1IX9 A;  3OGI B;  2GTA A;  3K0G A;  4ZIB A;  4KHP O;  2D2C B;  3DXR B;  2Y0P A;  4X65 O;  4LF7 O;  5B1N A;  3OAA G;  5BMV B;  1XNR B;  4LF8 O;  2ZNJ A;  3IFX A;  2QEX V;  4HNA B;  4NTW A;  2DYR C;  2VRZ A;  1MZE A;  3OGC C;  2QWO B;  2AHZ A;  2VQF O;  4WCE V;  1LNQ A;  1SZX A;  1H2M A;  1PL4 A;  1US6 A;  2YSU B;  1MZF A;  1T5E A;  1YF2 A;  3CRQ A;  3M99 B;  4FPP A;  5LA6 B;  3QO5 A;  5GTI Z;  1K97 A;  2EIL B;  4X1K A;  3RYC A;  2EIN C;  3UKM A;  2CTR A;  3MHH C;  4J7J A;  3ZHR A;  5C8Y B;  2DMX A;  4DUZ O;  4G27 B;  5IYZ B;  3JCU Z;  1Z5V A;  2LQT A;  1S5H C;  2YXL A;  3N2K B;  4PV1 B;  4N23 A;  4MVU A;  2LJ2 A;  1AB3 A;  4GUN A;  2YIB D;  1SER A;  1V55 C;  3SPC A;  1S76 D;  1K3E A;  1XMQ O;  4B3M O;  3B4S A;  4X20 B;  1CPY A;  1K73 W;  2XHB A;  4MVZ A;  4LFC O;  1XI1 A;  1BQZ A;  5LOV A;  1QHT A;  2QJ1 A;  1N36 O;  1JJ2 U;  5H5N A;  4QJF B;  5JCO C;  2W0F C;  4FLV A;  1PNL A;  1FXK C;  2X6C A;  2IBZ H;  2EIJ B;  1D5A A;  3OTO B;  4XBF A;  2DYR B;  2X0L A;  3G67 A;  3X2Q C;  2R9I A;  2LFS A;  3BEH A;  1VQK V;  4PA6 A;  2ADQ B;  2CGO A;  2YS8 A;  1N33 B;  3BAB A;  2Q9L A;  1Q7Y W;  3SGI A;  1WB8 A;  5KMG A;  1Y66 A;  2IM9 A;  1N0J A;  3H9V A;  3CC7 V;  4FFB B;  4B3T B;  4NKG B;  2P6J A;  1FFX B;  3H1K H;  3LDD A;  1MSW D;  4LF5 O;  2Y4U A;  4U3J A;  1M9N A;  3OTO O;  4K35 A;  3CCU V;  4LR3 A;  2UUA O;  3B2E E;  3CME V;  5E79 Z;  1HNZ O;  2A7W A;  2LW7 A;  2IH3 C;  5CA1 A;  2KKW A;  2UUC B;  5CMU A;  5LHG A;  2QWN B;  2EZO A;  1ORQ C;  1S0V A;  4JTC B;  3APO A;  4LFC B;  1VF5 B;  2EIL C;  2JS5 A;  4YJ3 A;  3QG5 A;  1AR1 B;  3JAK B;  2VQF B;  1R6N A;  1L0N H;  4QPJ A;  4FLY A;  4H13 B;  3K5M A;  3E2E A;  4OPH A;  4G28 B;  4QNH B;  4J11 A;  1Z2G A;  4HZ3 A;  3E22 A;  4DR7 B;  1M56 B;  3B8N A;  2ZE5 A;  3KZI Z;  2UXB O;  4GX0 A;  4UCS A;  4JV5 O;  2WLL B;  4LH6 A;  3UO2 A;  2P4K A;  1YTF D;  4HAM A;  4CH6 A;  5LMN B;  1XMO O;  2FYU H;  4X66 B;  4JGS A;  1M4U A;  5CN0 A;  1IBL B;  4B3S B;  3N27 A;  5GW7 A;  1AJQ A;  4LWS B;  4AQY B;  2WLI B;  1NTM H;  1EN4 A;  4JV5 B;  1KU9 A;  1PL0 A;  4HYO A;  2UUA B;  3E89 A;  1TA8 A;  3N2G A;  4X1I B;  2WLI A;  1VP7 A;  1NT2 B;  4E2L A;  5JJN B;  3JD4 A;  4LWS A;  3BY6 A;  3VQW A;  1JQ0 A;  4H37 A;  1KKD A;  2HEP A;  2F93 B;  3M7M X;  1B04 A;  5GTH Z;  1WP8 A;  1SZT A;  4YY3 O;  4MTG A;  3MHS C;  3E22 B;  5B5E Z;  1IVS A;  3CMA V;  2X6A A;  3C3T A;  3B40 A;  3HB3 B;  3CSX A;  4TV9 B;  3E83 A;  4OGQ B;  2UXN A;  2F1M A;  4ZOL A;  1XEQ A;  4PA7 A;  3AG2 B;  3RYI A;  4LF4 B;  4PDM A;  4J7K A;  2DWD C;  4WF9 V;  2MK3 A;  1RM1 C;  3ZCC A;  4U7O A;  1JVM A;  2XUM A;  3CPW U;  5FPO A;  3WFV A;  1ZX3 A;  1YZB A;  1CXZ B;  1JJO A;  3KCX A;  1TUB B;  3DSQ A;  1K5Q A;  2QSA A;  2XAS A;  3C3S A;  2DE0 X;  3CCJ V;  3RFR A;  2QM4 A;  5BXZ A;  4UCT A;  3CCR V;  3FYI B;  5KHG A;  4G2K A;  5B1B C;  1V54 B;  2XAJ A;  3ABL B;  1BZK A;  3E8G A;  4JYB A;  1F23 A;  3AG1 C;  4JI1 O;  2QKA A;  2IJH A;  3IC9 A;  3P3N A;  4RQF A;  2A0L A;  3NR7 A;  1XIL A;  3ASO C;  4YIP A;  4HBN A;  1R73 A;  2ZD9 A;  2YEV A;  2CTQ A;  2ZKO A;  3ZJZ A;  2UXC O;  1EZV H;  1QR8 A;  3RVZ A;  4W4L A;  2HHH O;  1WB7 A;  5LGN A;  2GDS A;  4JAU A;  4X8A A;  5KHH A;  3K3W A;  5H9C A;  2N05 A;  2B9Z A;  1XMQ B;  2JRI A;  4FMT A;  3SPJ A;  1UFI A;  3E35 A;  1G8M A;  3K79 A;  2ZR3 A;  4LF9 O;  1YTF B;  4A5U B;  2JIZ G;  1NBM G;  5CA3 A;  5L3E A;  5B1B B;  5K1P A;  1IBM O;  2A06 H;  3SJB C;  3SPH A;  4YIO A;  2H3O A;  2WLK A;  2QWP B;  5H6R A;  2R9A A;  3Q4H A;  1OCO B;  5EBW C;  4DR3 O;  1L1F A;  4PD4 F;  2PUS A;  5KA5 A;  4I50 A;  1PPJ H;  1RM1 B;  4Q6G A;  4ZHQ B;  2ZM6 B;  2UXC B;  2UXD B;  2CE4 A;  3ZRW B;  3LDE A;  4PDL A;  1R3I C;  4HNA A;  1QR9 A;  2XOK G;  4EB6 A;  2KG7 B;  2WPD G;  2Z0A A;  1WAZ A;  3CC2 V;  3QNE A;  2ITC C;  4JAS A;  4D7S A;  1WPX A;  1D5N A;  2M6Y A;  3ZMV A;  3SYP A;  3I55 V;  1FXK A;  1QLE B;  2RNB A;  1IBK B;  4GX1 A;  1MG1 A;  2F43 G;  1QLE C;  3UT5 B;  4D7T A;  2PYL A;  3CCS V;  1W2B U;  5JH7 A;  1WA8 A;  3JSL A;  2OCC C;  5K1X A;  4BIZ A;  3G80 A;  2JGU A;  3A0B Z;  4N21 A;  2KQX A;  1GMG A;  1GK9 A;  1FPO A;  1ZWI C;  1JPX A;  5FL7 G;  1WNS A;  4GYC B;  3AG3 B;  2K1E A;  4AHC A;  2E5L B;  4XDK A;  5HFM A;  4AI8 A;  4GZR B;  4UVC A;  2XT9 A;  1N34 O;  5LGT A;  3SJA C;  1S5J A;  4FFB A;  3E8H A;  5LMU B;  4CZZ A;  2WSS G;  3ASN C;  4H33 A;  3RN4 A;  2ZE6 A;  5KHJ A;  1AIL A;  1P7G A;  5FNV B;  5CA0 B;  3D3Q A;  4RUE A;  1AR5 A;  1GN4 A;  1RSO B;  4QIW F;  2IJI A;  2GV9 A;  3CE2 A;  3ETQ A;  1Y4M A;  3JAR B;  3S3W A;  3BA8 A;  2P7T C;  1KC8 W;  2UU9 O;  1HNW B;  2UUB B;  3OFN G;  4CH3 A;  4WBN B;  3CRM A;  5EZY B;  4DV4 B;  3IGA C;  4U7N A;  1F4N A;  2PGG A;  1KUQ A;  5KMG B;  3JCZ A;  1SQB H;  5JJE B;  4DXW A;  1G4Y B;  4ICG A;  3SDL A;  3ABK C;  4IGG A;  4AIL C;  3CRC A;  5IJ9 B;  3AEI A;  2P90 A;  1TAE A;  2ZIM A;  2ARH A;  4DW0 A;  1SS3 A;  1VQO V;  4JI0 O;  2H8P C;  2JVD A;  4F6E A;  3JAW A;  1FFT B;  3MD0 A;  4B08 A;  3ABL C;  3N2K A;  3LSS A;  2ZM6 O;  3E8F A;  2X6B A;  1FYJ A;  1CP9 A;  4FM1 A;  1QVF U;  3RYH A;  5BZB A;  4LNU A;  1JCH A;  1WP7 A;  4FFK A;  2ZR2 A;  3T2M A;  3I5D A;  2X7R B;  5IJ0 A;  4JPR A;  1Q86 W;  4ASU G;  4DV6 O;  3F5W C;  5JQG A;  1KBH A;  4GCZ A;  3B77 A;  3T1Y B;  3SJC C;  3FYE B;  1G1X B;  3I56 V;  3PJS K;  2YDE A;  1QNM A;  2EIJ C;  4R6Z A;  1K5S A;  1U97 A;  2DW4 A;  4JI8 B;  5LBQ A;  5C8Y A;  1L8D A;  3AG2 C;  4QPK A;  3DC6 A;  3BRC A;  2DJV A;  2JJ1 G;  4MTF A;  5L3F A;  3AG4 B;  1QU7 A;  4K0K B;  3L75 H;  2XND G;  3ML0 A;  4RWU A;  1IXM A;  3ZMT A;  4DR1 O;  3SYO A;  1BHB A;  2Y69 B;  4LP8 A;  1BMF G;  1NQT A;  1A32 A;  1NR7 A;  4PJ0 Z;  5IY5 B;  5CB4 A;  5LP6 B;  2Q67 A;  4DR6 O;  3HR0 A;  2IJK A;  3QO7 A;  4B7K A;  1N33 O;  3OTF A;  5IE9 A;  1X4T A;  2YID A;  4DV7 B;  1NH2 B;  3J80 N;  3WG7 B;  1SQQ H;  4F6R A;  1NKD A;  1R6K A;  4JYY A;  3LNN A;  1K4C C;  1KB9 F;  2ADP A;  3TJT A;  3SYA A;  3ABM B;  3SR2 C;  3F7Y C;  4DV6 B;  3ZRX A;  5IJ9 A;  2WWW A;  3P32 A;  1H2N A;  1YDX A;  3LNM B;  1NTZ H;  2V4D A;  3FB8 C;  5KX5 A;  2WLH A;  2B1I A;  4GKJ B;  1SQG A;  3RYH B;  4UV8 A;  1BE3 H;  2PY5 A;  2PTM A;  3VBB A;  1MA1 A;  1FAF A;  2N74 A;  1YEW A;  1BGY H;  1MMM A;  2BOC C;  4UCU A;  1KP2 A;  1Y76 B;  1Y74 B;  4DV2 B;  1FS0 G;  4JI6 B;  4DR2 O;  1EN6 A;  4WFG A;  4UCR A;  1E1R G;  3DC5 A;  5LHI A;  1HDJ A;  1I94 O;  1KP3 A;  4X9Q A;  5EZY A;  2V1D A;  5KLV H;  4TUY A;  3GWO A;  5CBH A;  3D36 A;  1NJI W;  3ICX A;  4X64 O;  4J42 A;  1QBZ A;  1J5E O;  2F23 A;  4LFB B;  1QVG U;  1I08 A;  3G6E V;  4UFZ A;  4O2A A;  1S5L Z;  5KA6 A;  1GM8 A;  4IIJ A;  3WB2 A;  1D2D A;  2QTS A;  3RYI B;  4IHJ A;  4I0X A;  3JD1 A;  5B1A B;  4B3M B;  4DUZ B;  2YC0 A;  4DV0 B;  1WA8 B;  5JH7 B;  3STL C;  5LP6 C;  2LGQ A;  4TV9 A;  4QGP A;  1R1B A;  4GKJ O;  1OCZ B;  2WLN A;  3U11 A;  1IBM B;  1ZAU A;  2ODM A;  2Y69 C;  1HWY A;  1XQ8 A;  2JGD B;  1FXK B;  4FJC C;  5F2V O;  3C90 A;  2VWK A;  3OEH G;  1NI8 A;  3QTC A;  2JEU A;  2F66 C;  3T1C A;  5EC2 C;  4DRX B;  1AI4 A;  3W7S A;  1JMK C;  4X1I A;  1OCC C;  1YHQ V;  5J2T A;  3JAL B;  2EIK B;  3AK2 A;  1ZL8 A;  3RBZ A;  2ZCE A;  1FD9 A;  3CRR A;  3ZIA G;  4BR6 A;  5ITZ A;  2VQE O;  1OCZ C;  2YI8 A;  2GBO A;  4JI4 B;  1VAR A;  5B66 Z;  3CS5 A;  1BHA A;  1VQ5 V;  2XAQ A;  1I5X A;  3RWR D;  1YVW A;  4UCV A;  4DYL A;  1WN7 A;  4LFB O;  2YIA A;  3JAL A;  4MS2 A;  3ZRW A;  2N04 A;  1K92 A;  2EIN B;  2WA4 A;  4DRX A;  1XL6 A;  4E4E A;  4JI2 B;  4CH4 A;  2ZT9 B;  4EEQ A;  4LF5 B;  2CTW A;  3EHB B;  2RMK B;  1XOU A;  3UCS C;  2CTP A;  2EX3 A;  1VQN V;  1F51 A;  2HJF C;  4O4L B;  3QF7 A;  4FK5 C;  1MAB G;  1GO3 F;  2HKO A;  2EBO A;  3TET A;  2BSK A;  3ZBH A;  3K9A A;  5FPR A;  2YXH A;  4DV7 O;  3TK1 A;  2KSD A;  1TUE B;  3ZHQ A;  1UJW B;  4DR5 B;  3ZN1 A;  1VQ7 V;  4PHZ A;  4EFB A;  4ABM A;  3A0R A;  2IW5 A;  4CS3 A;  3OM3 B;  1SQX H;  3DGE A;  3JAK A;  3JAT A;  3HKB A;  4TOI A;  1DF4 A;  2R70 A;  3HKC B;  3O9O A;  1XBL A;  2OTL V;  3BVO A;  1IBK O;  2GUZ A;  2ZIN A;  4OX9 O;  4JI5 B;  4LF6 O;  1PD3 A;  1B3Q A;  3RVY A;  1VQL V;  2QKC A;  1IBL O;  1SKV A;  2GUZ B;  2K9P A;  4FVM A;  2QDO A;  3CC4 V;  4TT3 G;  4X64 B;  1Y76 A;  2E75 B;  4I55 A;  3HKB B;  2IU3 A;  3W7X A;  1NTK H;  3U0Z A;  2ZE7 A;  3G71 V;  2XAG A;  3E8B A;  3FFQ A;  1S77 D;  2GHY A;  2Q0A A;  3K0D A;  4TUY B;  4CH5 A;  5H6Q A;  2L6L A;  1E79 G;  4DR2 B;  5BR8 O;  1H2K A;  3J7A U;  1FKA O;  3JD0 A;  4ZOL B;  1GAX A;  3K06 A;  1AI5 A;  2B5U A;  3FD9 A;  3ZED A;  3L71 H;  4DK1 A;  4KHP B;  1XNQ B;  3WU2 Z;  2EUL A;  5LXT A;  2QWR B;  3HKC A;  2LGW A;  2HLD G;  2QGN A;  1VQM V;  4H44 B;  1NS1 A;  2FKX A;  2RN9 A;  3JD2 A;  3O65 A;  2P22 C;  2QWQ B;  2YI9 A;  1DTO A;  2IH1 C;  1N8R W;  3AG4 C;  3UO3 A;  2E5L O;  1EZJ A;  2Q5Z A;  1YI2 V;  1OZ0 A;  5FLX N;  2JJ2 G;  2OCH A;  3B09 A;  4J80 A;  1N34 B;  2ITD C;  5LMN O;  1XMO B;  4JI5 O;  4LF6 B;  2Q7H A;  3OEE G;  4LFA O;  1VF6 A;  2YUA A;  4UCO A;  4JAA A;  3P3P A;  4DV2 O;  1Z5W A;  1K7D A;  4O4H B;  4NXN B;  4CS4 A;  5DM6 V;  1VEW A;  4DK0 A;  5ITZ B;  1OCR B;  4YJ2 B;  5IYZ A;  2PYJ A;  4TWK A;  5L3G A;  4B3R B;  3IC7 A;  3K5L A;  1K4D C;  4Z1V A;  3RGB A;  4AQY O;  4KXR A;  4MVO A;  2CK3 G;  5CB4 B;  5A2Q N;  1XL4 A;  3DXR A;  1MSD A;  1MOF A;  4XDL A;  2Y0I A;  1W0K G;  3AK1 A;  3W7T A;  1KD1 W;  5D5P A;  4DR4 O;  3FKS G;  5J9P C;  2HFE C;  5JVD B;  3OE7 G;  5IJ0 B;  1P7B A;  1N4C A;  2LW1 A;  4LF4 O;  1P84 F;  2OT5 A;  2P67 A;  5B3S B;  5CA1 B;  4MTO A;  3B8M A;  4RAI A;  3W7U A;  1KYO F;  1PKX A;  3SJQ C;  4IHJ B;  4DR1 B;  3QO8 A;  4ZI7 B;  3ZMU A;  3CWB H;  3ZRV A;  2IU0 A;  3MDS A;  1BT8 A;  4X89 A;  3T1H O;  2YIC A;  2BOB C;  1OV9 A;  4JI4 O;  3TXS A;  5IWA O;  2QTO A;  1B6Q A;  4BW5 A;  4TQF A;  3GWK C;  5D5Q A;  4TV8 B;  1U96 A;  1HR0 O;  3LDC A;  4XDJ A;  2MW2 B;  4OPA A;  2EIK C;  4KUM A;  5BR8 B;  2M7W A;  3RYF B;  4IIJ B;  1IXB A;  2NNU A;  5B3S C;  3OUS A;  4O2A B;  3L70 H;  3OT7 A;  4RO2 A;  1HNZ B;  2WLJ A;  1SQF A;  4U3J B;  2EJR A;  1HNX O;  3OMA B;  3SPI A;  4DR4 B;  1JOY A;  5KUK A;  1XHX A;  3JYC A;  4JI6 O;  3A0H Z;  1N0N A;  1AR4 A;  5LYJ B;  1GN3 A;  1PM9 A;  5A9G A;  2Q73 A;  4WFA V;  4PA4 A;  4JI7 O;  1BL8 A;  1XHZ A;  4EKW A;  1IDS A;  1RSO A;  1Y67 A;  3SPG A;  2QE7 G;  1SF9 A;  5EBL C;  4GX2 A;  2JDI G;  5FNV A;  1H2L A;  3OW2 U;  4NXM B;  4MVR A;  3CD6 V;  3A8T A;  4RQE A;  4O4L A;  1OCR C;  4MVQ A;  1GKF A;  1YJN V;  5IYB O;  2HR3 A;  1K9M W;  3WB0 A;  2ZDI C;  3K03 A;  4NB5 A;  2Q7E A;  4ZI7 A;  4K8Z A;  1EM1 A;  4BIU A;  4FIP C;  1LUW A;  2V7Q G;  2QR4 A;  1AI7 A;  2ATK C;  4KL1 A;  2HHH B;  2E3C A;  1FXH A;  3ETE A;  4B7E A;  2E74 B;  4X66 O;  2W0X A;  1WJZ A;  3ETG A;  4L87 A;  3L73 H;  3K58 A;  3BPZ A;  1L0L H;  1UPG A;  4LBE C;  4DO2 A;  4FZ0 A;  2L35 A;  1BSM A;  1ZLZ A;  4OX9 B;  1GN2 A;  3OMN B;  1SRY A;  4WFE A;  1RP3 B;  1M5I A;  3S3X A;  3G6B A;  5KHI A;  2Z5U A;  4P30 A;  4I9W A;  4X65 B;  4J7Z A;  4UB6 Z;  2F4V B;  3M8A A;  3JSN A;  3ETD A;  4MVS A;  4NTX A;  4JI7 B;  2YIB A;  4DR5 O;  4YY3 B;  5IYD O;  4O4I A;  2XAH A;  4PA3 A;  2FB5 A;  1SET A;  4WFB V;  1TVK A;  2JEX A;  3U10 A;  1VF7 A;  4WFH A;  4J10 A;  3IAY A;  1BCC H;  1QQC A;  1N36 B;  1K8A W;  1SA0 B;  4JI2 O;  4IL6 Z;  4DV3 B;  4J9Y B;  3H1J H;  5DEC A;  3T1Y O;  4X1Y A;  1YIJ V;  5IY5 C;  1VF6 C;  4Q20 A;  2CGN A;  1E1Q G;  4Z2W A;  2QKS A;  4DUY B;  5LYJ A;  1Q3E A;  3E86 A;  3HKE A;  1PV0 A;  3D3I A;  1KQS U;  4LC1 A;  1GH6 A;  2E76 B;  1JR9 A;  1K33 A;  4JTA B;  1OCC B;  1HNX B;  5LMU O;  1FJG B;  3TGU H;  3SYC A;  4GKK B;  2RJZ A;  1XDC A;  3K5N A;  2Q69 A;  1COW G;  4NR1 A;  4UV9 A;  4P9O A;  5JWP A;  1QLN A;  4X62 B;  4UVA A;  2PI4 A;  4MW8 A;  2BTQ A;  2CH7 A;  4DUY O;  3TCU A;  2D3O W;  5KAI Z;  1Q82 W;  5B1A C;  1XNR O;  3CRA A;  1RFY A;  1R3K C;  3RYF A;  4TV8 A;  2AZ2 A;  4JI0 B;  2YEV B;  3K5O A;  4D6T H;  4IYI A;  2P5O A;  2NR5 A;  3MAQ A;  2HJD A;  2VQE B;  2HVK C;  1NH2 D;  5H2F Z;  3EXA A;  2CDY A;  3LSQ A;  4I4T B;  4X1Y B;  3W7W A;  3IJ4 A;  1YCI A;  1H8E G;  5DN6 G;  3ABU A;  4H0L B;  1JX9 A;  3CCM V;  4BWA A;  1N32 B;  4YXW G;  5B1O A;  5C93 A;  1J95 A;  2PI5 A;  2A3Q A;  2B1G A;  1I0H A;  5JVD A;  1ARO P;  1THZ A;  2ZE8 A;  2ZDI A;  2O57 A;  3FAV A; 
#chains in the Genus database with same CATH homology
 3ABT A;  4KFM A;  2Q68 A;  1K34 A;  3OR6 C;  2OTL V;  3ZRW B;  3LDE A;  1S72 V;  1PD3 A;  4PDL A;  3RVY A;  1VQL V;  4R7C A;  1H2G A;  1OHH G;  1R3I C;  1QR9 A;  2XOK G;  2DQ0 A;  2WPD G;  2LP7 A;  3CC2 V;  3QNE A;  2ITC C;  4JAS A;  4TT3 G;  1WPX A;  3CC4 V;  3ZMV A;  1GM9 A;  3SYP A;  1QCE A;  3I55 V;  2IU3 A;  3W7X A;  3T4D A;  1FXK A;  1QLE B;  3GB7 C;  3G71 V;  2XAG A;  4P9P A;  2DYS B;  1I5Y A;  3ZN0 A;  2GSM B;  3E8B A;  1EBO A;  4GX1 A;  3G4S V;  1MG1 A;  4PDV A;  2F43 G;  2DYS C;  1S77 D;  2GHY A;  1QLE C;  3K08 A;  3CP1 A;  3K0D A;  4UVB A;  2IJJ A;  5H6Q A;  5E1A C;  3AG3 C;  3CCS V;  1YIT V;  1W2B U;  1E79 G;  3R65 A;  1DF5 A;  1RPR A;  3VOU A;  2OCC C;  3JD0 A;  2LFR A;  4BIZ A;  4JYC A;  4MVM A;  2UXX A;  3K06 A;  3LUT B;  1AI5 A;  4N21 A;  2AHY A;  2B5U A;  3CYO A;  1NVP B;  1GMG A;  1GK9 A;  2OCC B;  3FB5 C;  1YJW V;  3FB7 C;  3EFF K;  1ZWI C;  3H01 A;  1JPX A;  5FL7 G;  5HFL A;  3AG3 B;  1EFR G;  4MSW C;  2HLD G;  4ZKI A;  4F4L A;  5L3D A;  2K1E A;  4XDK A;  1VQM V;  5HFM A;  3NXS A;  5L3C A;  3STZ C;  1VQP V;  3JD2 A;  4UVC A;  3K0G A;  5LGT A;  1DTO A;  2IH1 C;  1N8R W;  1AJN A;  3E8H A;  4CZZ A;  2WSS G;  3AG4 C;  3ASN C;  4H33 A;  3ZMS A;  5CBG A;  1FXV A;  5KUM A;  1EZJ A;  1F4M A;  5EBM C;  4RUF A;  5B1N A;  3OAA G;  1YI2 V;  1YSC A;  4RUE A;  1OZ0 A;  2JJ2 G;  3IFX A;  4QIW F;  2IJI A;  2QEX V;  3OUF A;  2ITD C;  4UXN A;  2DYR C;  3OEE G;  1Y4M A;  4I5S A;  3OGC C;  2P7T C;  2Z3Y A;  1KC8 W;  2QM8 A;  2AHZ A;  1R3J C;  4WCE V;  1LNQ A;  4ZBM A;  3OFN G;  1K7D A;  2YSU B;  2FTK A;  1ROP A;  5DM6 V;  3IGA C;  3M99 B;  4FPP A;  4U7N A;  3QO5 A;  1K97 A;  2EIL B;  3WG7 C;  1OCR B;  1F4N A;  2EIN C;  1M57 B;  3UKM A;  3JCZ A;  1OCO C;  4TWK A;  5L3G A;  3ZMZ A;  3MHH C;  3IC7 A;  2Y48 A;  4DXW A;  1G4Y B;  3SYQ A;  2OTJ V;  4Z1M G;  1K4D C;  4G27 B;  3ABK C;  4KP4 A;  4MVO A;  2CK3 G;  1S5H C;  1XL4 A;  3AEI A;  2P90 A;  1V55 B;  4N23 A;  1H38 A;  4MVU A;  1VQ6 V;  1MOF A;  1VQO V;  2ZQM A;  5CBF A;  4XDL A;  2H8P C;  1SER A;  1FFT B;  1W0K G;  3MD0 A;  1V55 C;  3W7T A;  1KD1 W;  1NVP D;  3SPC A;  1S76 D;  3ABL C;  1K3E A;  3FKS G;  5J9P C;  2HFE C;  2HG5 C;  3ABK B;  3LSS A;  3UM7 A;  3OE7 G;  1CPY A;  1K73 W;  3E8F A;  2X6B A;  3P30 A;  1P7B A;  4MVZ A;  1CP9 A;  1QVF U;  2OT5 A;  2P67 A;  5BZB A;  1JCH A;  3T4Z A;  5B3S B;  4R8C A;  2Q6A A;  4MTO A;  3B8M A;  4RAI A;  3W7U A;  1JJ2 U;  4QJF B;  3T2M A;  2ZR2 A;  1YJ9 V;  1PKX A;  3SJQ C;  2X7R B;  2W0F C;  3QO8 A;  4JPR A;  1Q86 W;  4ASU G;  1PNL A;  3F5W C;  2EIM B;  1FXK C;  2X6C A;  3ZMU A;  4GCZ A;  2EIJ B;  3B77 A;  4MTX A;  5LHH A;  3ZRV A;  3FYE B;  3ZRS A;  2IU0 A;  4XBF A;  4X89 A;  3I56 V;  2DYR B;  2XAF A;  5EK0 A;  2BOB C;  3PJS K;  2X0L A;  3X2Q C;  2R9I A;  2EIJ C;  4R6Z A;  2QTO A;  1B6Q A;  2LFS A;  4BW5 A;  1K5S A;  2WAM A;  2DW4 A;  3BEH A;  4PA6 A;  1VQK V;  3LDC A;  4XDJ A;  5LBQ A;  3AG2 C;  4QPK A;  3FB6 C;  4JF3 A;  2EIK C;  4KUM A;  3KG2 A;  2JJ1 G;  1Q7Y W;  2M7W A;  4MTF A;  5L3F A;  3AG4 B;  2NNU A;  1Y66 A;  5B3S C;  3OUS A;  4RO2 A;  3CC7 V;  2WLJ A;  2EJR A;  2H94 A;  3OMA B;  3SPI A;  1JOY A;  2XND G;  3ML0 A;  3ZMT A;  1IXM A;  2P6J A;  5KUK A;  3SYO A;  1BHB A;  3JYC A;  2Y69 B;  3LDD A;  1MSW D;  4LP8 A;  1BMF G;  1NQT A;  1M9N A;  3OR7 C;  4J9Z B;  1NR7 A;  3CCU V;  4WFA V;  4PA4 A;  5IY5 B;  3CME V;  1BL8 A;  2IH3 C;  4EKW A;  2Q67 A;  1AI6 A;  2A9H A;  5CMU A;  3SPG A;  2QE7 G;  5EBL C;  5LHG A;  2IJK A;  5EC1 C;  4GX2 A;  3QO7 A;  2EZO A;  2JDI G;  1ORQ C;  1GTO A;  2W6J G;  3OW2 U;  1S0V A;  4PEL A;  4MVR A;  4JTC B;  3CD6 V;  4RQE A;  1NH2 B;  1OCR C;  4MVQ A;  1GKF A;  2EIL C;  2R9R B;  3WG7 B;  1WLE A;  1YJN V;  5IYB O;  2WLL A;  2HR3 A;  1K9M W;  2HVJ C;  1NKD A;  1R6K A;  1AR1 B;  2ZDI C;  3K03 A;  1R6N A;  1K4C C;  4X88 A;  3SYA A;  4QE7 A;  3ABM B;  4FIP C;  4QPJ A;  2DWE C;  2V7Q G;  1GM7 A;  3F7Y C;  4UUJ C;  4BIU A;  4OXS A;  3ZRX A;  5IYC O;  2WWW A;  3P32 A;  3LNM B;  2C2A A;  1AI7 A;  4GT1 A;  3FB8 C;  2ATK C;  2WLH A;  2B1I A;  3E2E A;  4G28 B;  1FXH A;  3ETE A;  4UV8 A;  4QNH B;  3HPL C;  4HZ3 A;  2A79 B;  1M56 B;  3B8N A;  3ETG A;  4L87 A;  3VBB A;  3ASN B;  3ABM C;  4GX0 A;  4CBC A;  4P2Z A;  2W6I G;  4LBE C;  4DO2 A;  2WLL B;  1YTF D;  4HAM A;  3F7V C;  3OMN B;  1S3J A;  1SRY A;  3CCQ V;  2BOC C;  4JGS A;  4WFE A;  5CN0 A;  1KP2 A;  5GW7 A;  1AJQ A;  2Z5U A;  3OMI B;  4P30 A;  1FS0 G;  4I9W A;  1M56 C;  2WLI B;  1P4R A;  4WFG A;  1E1R G;  5LHI A;  1M90 W;  3ETD A;  4MVS A;  1PL0 A;  4HYO A;  1KP3 A;  3E89 A;  4JAV A;  2WLI A;  2KB1 A;  1ENV A;  2V1D A;  4PDR A;  4E2L A;  3JD4 A;  3GWO A;  5IYD O;  2XAH A;  3BY6 A;  4PA3 A;  5CBH A;  1JQ0 A;  4H37 A;  1KKD A;  3CCV V;  3D36 A;  1SET A;  4WFB V;  1AJP A;  1NJI W;  4R50 A;  3RW0 A;  1QBZ A;  2JEX A;  1SZT A;  1QVG U;  2QM7 A;  4MW3 A;  3G6E V;  4WFH A;  4MTG A;  4PA9 A;  5KA6 A;  3MHS C;  1GM8 A;  1VQ8 V;  3CMA V;  2X6A A;  3HB3 B;  5LGU A;  1K8A W;  3E83 A;  3K04 A;  3JD1 A;  2UXN A;  5B1A B;  4PA7 A;  1CEZ A;  3AG2 B;  4J9Y B;  3STL C;  3ASO B;  4MT8 A;  1YIJ V;  4JTD B;  5IY5 C;  2WLM A;  4PDM A;  1Q81 W;  1SES A;  4Q20 A;  1H8H G;  1OCZ B;  2WLN A;  2DWD C;  5L3B A;  1E1Q G;  1HWY A;  2MK3 A;  2Y69 C;  4WF9 V;  2QKS A;  1RM1 C;  1VQ4 V;  4LCU C;  3E86 A;  3ZCC A;  4U7O A;  1JVM A;  1FXK B;  4FJC C;  3CPW U;  1PNK A;  1W0J G;  3WFV A;  3OEH G;  5IDJ A;  2JEU A;  3T1C A;  5EC2 C;  3D3I A;  2ZXW B;  4LC1 A;  1KQS U;  1AI4 A;  3W7S A;  2JK5 C;  1OCC C;  1YHQ V;  1K33 A;  4JTA B;  1OCC B;  1KEC A;  2EIK B;  1K5Q A;  2XAS A;  3SYC A;  2ZXW C;  3RBZ A;  3CCJ V;  3CCR V;  2Q69 A;  1RPO A;  3ZIA G;  3FYI B;  4G2K A;  5B1B C;  1COW G;  1V54 B;  2XAJ A;  3ABL B;  4P9O A;  4UV9 A;  3X2Q B;  3E8G A;  4JYB A;  1F23 A;  1OCZ C;  1PNM A;  3JD3 A;  1QLN A;  3AG1 C;  4UVA A;  2IJH A;  2PI4 A;  4MW8 A;  1M1K W;  2EIM C;  4RQF A;  2A0L A;  4TSF G;  1BHA A;  3ASO C;  1VQ5 V;  3TCU A;  2XAQ A;  1I5X A;  1R73 A;  2D3O W;  2ZD9 A;  2YEV A;  1Q82 W;  5B1A C;  2QA4 V;  3ZJZ A;  1QR8 A;  3RVZ A;  4MS2 A;  1R3K C;  4QE9 A;  3ZRW A;  1K92 A;  2YEV B;  5LGN A;  2EIN B;  4JAU A;  4X8A A;  3K3W A;  5H9C A;  1XL6 A;  2DQ3 A;  3DTU B;  4FMT A;  3SPJ A;  3E35 A;  1G8M A;  3K79 A;  2ZR3 A;  3EHB B;  2HVK C;  1NH2 D;  1YTF B;  3CXC U;  2JIZ G;  2EZP A;  1F51 A;  1VQN V;  2HJF C;  3AG1 B;  3LSQ A;  1NBM G;  5CA3 A;  5L3E A;  1V54 C;  4FK5 C;  1MAB G;  5B1B B;  3CCE V;  1GO3 F;  3W7W A;  1H8E G;  3SPH A;  2HKO A;  5DN6 G;  2WLK A;  3ABU A;  2EBO A;  3TET A;  1R3L C;  1NR1 A;  5H6R A;  1DLB A;  4GX5 A;  1OCO B;  1JX9 A;  3K9A A;  1M57 C;  5EBW C;  3CCM V;  1L1F A;  4YXW G;  3TK1 A;  5B1O A;  1TUE B;  2NLJ C;  1UJW B;  5C93 A;  1J95 A;  2PI5 A;  1VQ9 V;  2B1G A;  3ZN1 A;  1VQ7 V;  4WFF A;  4BAY A;  5KA5 A;  3A0R A;  2IW5 A;  1ARO P;  3OM3 B;  3DGE A;  3CCL V;  1THZ A;  2ZDI A;  1RM1 B;  1DF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...