3CDGA

Human cd94/nkg2a in complex with hla-e
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
273
structure length
273
Chain Sequence
SHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, alpha chain E
publication title CD94-NKG2A recognition of human leukocyte antigen (HLA)-E bound to an HLA class I leader sequence
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 273
sequence length 273
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cdgA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3cdgA01
2Q86A 1LO0L 1T03L 1FE8L 3RVWC 3GJEA 3R4DA 2FYYB 4L4TD 3X3FH 43CAB 2XZZA 5SWQB 1QRNB 2VDKH 4CMMA 2F15A 3P9MB 4LPXA 4MJ5A 3EO0A 3DX7A 4H8WL 4LMQE 4AM0A 2ILLA 4HIHB 3THMH 4NUJA 3T2NH 2FWOB 3QXTA 4POZD 1MFDH 2VERN 3BQUB 4CDHA 4PJCE 4FFZL 4U1HB 2R15A 3BP6B 1A6TB 1A1OB 1D5MB 1TJGL 2OMNA 1PW3A 4FTVD 4N1CA 2HVKA 3D39E 3RZCA 4JRYE 2W9EH 1KN2L 4TVPE 4F7EA 5LWYL 2Q7YA 1P84J 1DBAH 4Y4FD 1CDYA 1LE5B 5IHUL 4GKNA 5E7FA 2DQJH 3V4PL 3VFMA 2XA8H 1XGRB 1NMBL 2YD9A 3SDXB 3VFRA 5L2JB 5K59F 2XOTA 5E9DE 4WW2C 3MMEB 4LPWA 1ZT1A 1WITA 1R3HA 2V9TA 5IB5A 4N0CA 2DS4A 2FGWL 4X6DE 2LTQB 5FUZL 1SEBA 4LPCA 4Y5VC 2YRLA 4MDJB 4JAMA 4V2BA 1VERA 3MJ9L 3V0WH 3FONB 3EJZD 2IH3A 4X4ZA 3CVHH 4OIIH 1YECL 1I7TA 3MRQA 3JVGA 2E27L 4UUJA 4PJCA 3PXJA 2Y7QB 2D9QB 3O6FC 1MFNA 3S6CA 1RZ8A 3OB0H 3EYVA 3VFNA 3MV8E 3KPRE 2X4QB 3MUJA 4WHTB 4QRPB 4KVCH 3HLAA 2QV2A 2HN7A 4JRYA 1FLTX 1ACYH 4PG2C 5FO8A 2VDLH 5B38A 1P4IH 3MRBA 4LSVH 4Z76B 1D6EA 5ADOL 4FXGA 5E9DA 4Z18A 4M6AA 5D5MB 1MFAL 2QBWA 4YC2B 4G3YH 2EZ0D 4WWID 3Q1SL 1L4IA 2Z4QA 1IVLA 1YMHA 3AY4A 3LKRB 1EBAA 3SE3A 3T2PA 3MRJA 4DN3H 5JXAH 3GUTB 3QI9A 3IDGA 3OR7B 4S1SH 1JGVL 1ZE3C 3BVNB 4X9HA 1ODAA 1SJHB 3VFOB 1I8IA 1CFNA 3SO3C 4B0MM 1FDLL 4DN4L 3AVEA 3BEWA 4M7KL 2ERJB 4KI1A 1EEYB 2Z31C 4X6CE 3VRJB 4I8DA 1P2CB 3IDIA 3BPLC 1KJMB 3MV8A 3QG7H 3KPRA 4LRNL 1X5FA 1ZA3B 5TE6L 3UROR 4P9HL 2ZPKL 5BS0E 4M9PA 3QPXH 3TIEB 3IU3A 3C5JA 3OKOB 3CFDB 3ZT5A 5I1JH 2COQA 1T1XA 3O3EB 3LKNA 1MCDA 1N6UA 3W39B 3V6ZA 3EZ8A 3DARA 4F33A 2VZVA 5SWSB 5FM8A 5KW9L 3LQMA 5EDXA 3F58L 1CFSB 4JJHA 1WBXB 2DBLL 1MFBL 4HIEB 3H8NA 4K94L 1FN4A 1NMAL 4L8BB 1QP1A 4YBQC 4ZFFA 1PLGH 1Q38A 5ISZB 4WFGE 1QR1B 4FXKB 4EI5C 12E8L 4LVNB 2P7TB 3L5XL 4HGKC 4A6YA 4WENB 4F8TA 5FCUH 1HDMA 2R29L 5FYLD 3OXRA 1MREL 5BS0A 1A6WL 1MI5B 2V7HB 2YN5A 5HDQL 4X6EA 2Z8SA 2AABL 4X4XB 1P5UA 2VAJA 2E6JA 4P57B 4C56B 4GRLD 4QHMA 4NNPL 5KSUB 3IDUA 4GT7A 1NCNA 5T3XH 4HMCA 3RNKB 4BK5A 2V5RA 5EO0A 2UYLA 3V9FA 5ERWB 2HMID 1H15B 1F3RB 4NKIH 3WFDH 3BP7A 3SQOH 2EECA 4UTAL 1UWXH 3CXDH 3GNMH 1MOEA 3HI6H 1HHJB 2RBLA 3JUYA 2W38A 4L3CB 1E4WL 1OF2A 5DHYB 1N5YL 3O6MH 3D18A 2WW8A 2I60H 2VXVH 2R0KH 3GMRA 4G7VH 4GAFB 3FO1B 3QQ9C 4HDIA 1ES0B 2BOBB 4RWYH 3CX5K 1NFIB 3UTSD 3CK0L 4AEFA 2Y36L 4RQQB 3S8WA 1J1PL 2VR4A 1R0AL 1R3JA 3MRDA 5HGBB 3D2UD 1PSKH 2PXYA 1N64L 2X89D 1FVDB 4JVWA 5FUCC 4JJ5B 4MNHA 5HPMB 4Z7WE 2AEQL 3MXWL 5I76B 2BOCB 1MIML 4PD4J 1E4KC 5BRZB 3OKDA 3BT2L 4FQXA 3IKCA 5JIHA 4JFOA 1IKNA 3LKPB 1WBZA 4WI5A 5HGGS 1HH6B 5DUBA 1U42A 3BDYH 4IOIB 3VXNB 5DK2A 4LL9A 2NY3D 2DWEB 4PG9A 4DKFL 3LN5A 2HT3C 1SY6L 4X5LA 2E7HA 1HEZA 1B88A 4MJ6B 4QHNA 5KSBE 4K2UH 1J1OH 5DJXB 1RJCA 3ECBA 5KS9E 4PJ5B 2F53B 3SGKA 4QRQB 4RA3A 5J9PB 1F3JB 1UQSB 3MRKB 1FRGH 1KEML 1FZKB 2RHEA 3GBML 3W11D 4B7LA 4Z7WA 3NACH 3ORJA 2NW3A 3VFWB 2A9MH 5JPMA 1RIUH 1ZEAL 1JGLL 4D8PA 3HZYB 1INDL 5JOPE 3H3PL 4UT7L 2CO7B 2EDTA 3GMQB 3U7WL 1QQDA 2NY5L 5EWIL 2P49B 4LF3B 1OGAA 4ODTL 2FX9H 1TZIA 2OZ4L 1MFEH 5DJ0B 4PBWD 2OXGA 3IETA 1CXKA 4CNIA 5L2KB 1F6LL 3WO3B 5DDHB 1B0RA 5KS9A 2QTEA 1A6VL 4PS4L 4JKKA 4IOFC 1Z9LA 3LS5H 3EYQC 5HJ3B 1TIUA 5JNYB 3HAEA 4WIQA 5GRVK 1J0JA 2IALB 4XBPB 5C0CD 3B3IA 2F5AH 3NZHL 1Q94A 5K9QI 2FX8L 1NFDE 4NPYA 1F4YH 1DSFL 1U3JA 1BQLL 4ZG1A 5IG7B 3KJ4B 4OTXL 4KJYA 5TFSH 3DO7A 2BVOB 4K7PL 3GSVA 3WSQH 3MYJA 1YEGL 1HILB 2AVGA 1DVFA 2QQLL 1EK3A 4NO5B 4FQHB 4JKPH 1T22A 4NO3B 3QNXA 2VXUH 1JHTA 1KCRH 3KPQB 5MERB 5DR5H 2I26N 4L8DA 2DQEL 2AXHA 1UXSA 3H0TB 5JW4Q 1HHKA 5A2KH 1EGJH 1TMCB 1BOYA 4Q2ZA 3C09C 2AJYH 5CP3A 4DGYL 2XQBL 3ELAT 1YN7B 1OLZA 1MCWM 2EH7L 1ZOXA 2YPLD 4MCYA 1ZVSB 3CMOH 2K7QA 1X5GA 3G6JE 4G9FE 3PWPE 4RGNC 3INUH 2YC1B 5CKGA 4QRTA 4W4OA 1OAUH 2NX5B 4B50A 4EN3C 1JFQL 1CR9H 2FJGA 5C9KA 2H3NB 4O2FA 5JORB 1KXVC 1JYWA 2EDKA 1SJEB 2CK0L 4GQ9L 3L7EB 4YUEL 2C7UA 3ZYJA 4PY7A 2R2BB 3W9DA 25C8L 1V3MA 2BMKB 5GXBB 3D0VA 4MAYC 5C7XH 5K9JL 1U93A 2VUOA 4LQ1A 2YHGA 3KPPB 5ID0B 5DMKB 5DRNB 4PJAE 1KCVL 3K46A 2XZQL 4OCWL 2ESVE 3ZSSA 1T0MA 3SE8L 5C6TL 4JO4L 1FIEA 5IQ7H 2ZCHL 3NCMA 3T3PE 3OGCA 2VXTH 4LP4A 2DM2A 3G6JA 2BP3A 4G9FA 3PWPA 1HSBA 2A83B 3G5YB 3MV9B 4YR6B 5GSRB 3K8KA 3MLPA 3K8MA 4KTDH 5DFVC 5FYKD 3NVQA 2VL5A 4RZCA 5SV4A 5JOEA 5HI4D 2Q3AA 4LVOC 3AM8C 4RFOL 3U6RB 1GAFH 3FQTB 2A73B 1FV1B 3VGAC 1P9MA 5CHNA 5D70H 4HC1H 4IMKC 3DTXB 3EIFA 5I9QC 1MWAL 3T4YB 2OJEA 2AXJA 4LASH 4PJAA 5E00B 3EOTL 5IKCA 1NUNB 2W9DH 2ESVA 3K81A 3HZVA 4OZFH 1ZWIB 1V7NH 4U1GB 3TZVD 2NMSA 1JYVA 1CG9A 1Z9MA 2CXKA 5GRVL 4RISH 3CU7A 1OAKH 3NGBB 1LILA 1UACH 2BVUA 3LPGA 3TJHC 5IMOA 2FL5A 5HYFA 3TA3C 5FIEA 5CFHA 5DRZA 4KGLA 4TN9A 1UENA 4XPGH 5LKNA 4GSDL 1KTDA 5D1QB 5I73B 3QEQB 2O93L 1QTYT 3FFDB 3MNWA 5D7LE 1B4RA 4G43A 2R1YB 3TVMB 1F2XK 2GK0B 4POUB 4QXUL 5D2NA 5BVPL 1MWAB 2CJUH 2UWEF 4U05A 3AS1A 2YBRA 3CU1A 4HMEA 4P4KC 4ZUUB 1WFUA 5L8LB 3RPIB 3CPLB 3K8LA 1X7QA 4QGYA 1QOKA 4YHMH 3K4DA 3M1BA 4CN6A 4ORGA 3PWNB 2A1WL 3QNYB 3PDOA 4OCLC 2P24B 1VFBB 1CFBA 1YQVH 4Z8FH 1KTLA 2O26U 3ZTNH 1KTKE 2N7AA 4OF7A 5FDWB 5ILTH 4C4KO 3ZE0E 3HNTL 1FCGA 3QRFM 5DS8B 3O4LA 2R9HC 4G8GB 2GTWA 4NC1C 3ARED 5IW3A 2BSED 4L3AA 5C9JA 3BJ91 5T1LA 2AEIT 3G04A 5I1CL 5JHDD 1A14H 4GAJL 3QH3A 5T1KA 3PL6A 1OTSD 4P2QB 4R2GB 2A6JB 5D7LA 1QUNA 3TN0B 1IZKA 1ERNA 5JMOC 4XP4H 4KJPD 4MLIA 3MLVL 3S3JA 3DLQR 3FQNA 5F7HA 3VXPB 3KHQA 1BFOB 5EU6A 4KHXL 3I2CH 2ITDA 5FYJL 5AAMA 2N4IA 4MJ4A 5I1KL 3FTGB 1OTTD 1FFOA 2PW2A 2XT1B 1S7TA 4LFHG 4CDGC 5J6GA 4MMZC 4X99B 4LOUC 2NY1B 2V9RA 5ESVA 4CMHB 4WEBL 3QUYD 4N8VG 4Y1AE 1AGCA 2NTSP 1T1ZB 2P1YA 1EXUB 3H42L 4MA1C 1ZT7B 4OKVB 3GGWA 4ZUTA 2VDOL 4HPOL 1VEOA 1J8KA 5GJTH 1OW0A 1RK0A 4NCC1 1ZHNB 4CJ0A 1AO7D 3JZ7A 4RWHA 1FFPB 3EGSA 4LCWB 5FO9A 2GFBB 3CLFH 3NA9L 1A7OH 1K2DA 4PJHF 5FB8B 5GRJH 4YE4H 1HH9B 1QPXA 5E08H 2HT2D 3LMJL 4C58B 4OD2A 3GKWH 1TJHH 2YD1A 5DJZB 2X70B 3BZFA 5TGBA 2C9AA 3MLYL 2OI9B 4AY0A 2WIIA 4K7PX 5T3ZL 4OLXL 3MO1B 1KACB 4YFDB 3HG1D 1X3DA 4IDJL 3WFBL 4Y1AA 3IF1A 5I75C 4JQIL 2H26B 1RD6A 3VXTA 1BJ1J 5KANI 3VWJB 4HK0A 5ITFB 1GHFL 2VITB 5LAXA 2CR3A 3ULVL 4X9FA 3O9WC 3JWOL 3OJDA 4O2EB 2XFXA 3QO1B 1I1RA 1MHPH 5KSAB 4U1LA 3DXAB 3JTSB 4LLVB 4R8WH 3MNZA 1LGVA 2RGSA 2J5LB 3HRZA 2H1PL 3KLDA 1YYLH 2DYPB 2XV6B 3VFPB 1E0OB 1G7PB 3EO9H 5LQBH 4MCZA 5EOQH 3EYUL 2FJHA 1JPTH 3LEXA 3HE7A 2VLRE 4O51B 2J6EH 4IIQA 4BZ1L 5IB1B 2XTJD 3OJ2C 1AY1H 4JPKH 3WLBA 2X1PA 4QHLA 3HCVB 2WQ8A 4IRJC 4KC3B 1N6QL 1XCTB 3QZWG 1VFOA 4UMGA 3V8OA 1I3GL 1WC7A 3QFJB 3DMMC 1AC0A 2PYED 3RDTC 4N0UA 4PRBA 2GY7B 4P3CL 3UYRH 4AL8H 2D2OA 1H3PL 1P7HL 2L7JA 5IMKB 2D7TH 1IC5L 2JCCB 4XP1H 4Y4FA 5I19L 2YSSA 3MFFB 3SDDB 1KELH 3UTQA 1MNUL 3QUKA 1N4XH 3UTTE 5D2LE 5HHQB 4GKSB 1NGYA 4OFPA 4P46A 1QSEB 3SBWA 3LIZL 4K3JL 2EDNA 3GIZL 4N0YH 5KN5A 4JDTL 2VLRA 1K8IB 3DVIA 1XR9A 2HH0H 2XN9E 2BSSB 4I4WA 2WBKA 4KAQH 4HUWB 4OLWL 3RGHA 3JSSA 3RHWK 4IRSA 4R4BB 4CN4A 3N1MC 2BJML 5EBGA 1HSAA 3O2DA 4E9LA 1CVRA 2R4SH 1DBJL 4OAWA 4PJEB 4ODWA 2HVJA 3ARFA 5SWZE 4WNQB 5LCVL 2J8OA 2Q6WA 5GGUA 3IDJA 4Y0GA 1C08A 1ZLWK 4LPYA 4HWEH 5DO2C 3QEHB 2PF6A 2A74A 2D03H 3SKMA 3WV0A 5CIPH 1HQ4A 1M7DB 3BGFC 1BX2B 5D2LA 2APFA 4LGPB 4PRDA 3AB0C 5E2WH 3KJ6L 3V6FB 4PJCF 1SMOA 3O6LL 4KJWD 4ZAKC 3L5WB 3VFSA 2ZOKB 5H2BB 2E9IA 3RWDA 1RMFH 4HCRH 4U6VL 3FAWA 1AFVL 1C1EH 5D7SL 5DJCB 4AG4H 4HJGA 4UOW0 3PHQB 3VFUB 2IFFL 1ONQA 3LHPH 2IMMA 4KUZH 1D5ZA 5M7QA 1QEWA 2NY0C 4UB0L 3WS6C 4HS3B 1HN1A 5CUSH 4PFEA 5TE7H 2R4RL 2AEPL 3QG6B 4WU7A 4D0BB 2FX7H 5MEOB 1BEYH 3Q48A 5HHOB 1A22B 4LLYB 1YJDH 3ZDYF 2ZCKH 1GGIL 2GAZB 3QRGL 4QCIB 1Q9WA 4QO1A 4TOYH 1KB9J 5T33H 5DA0B 3O4OC 1WWAX 2FB4L 2UVEA 1R5VB 4QGTA 2JIXA 2NXZC 4QYOB 2HJFB 5KJRL 4D0CB 4O2CA 1F8TL 1YJDC 1AR1C 4TSBH 4X4ME 3WFHB 3O3UN 2HTLC 3G6AA 1U41A 1ADQL 4V1DE 4Y19B 3V4VH 1OAZL 2ADIA 2NZIA 4NKDB 2YEZB 5I15L 3JV5A 1E6JL 2DLFL 3C5ZA 3GSQB 4EOWL 4U0RB 5L7XH 3AS2A 1HYRC 2GITA 4NNYB 2O5XL 4FNLH 1V3KA 4JANB 4MVBA 1QO3B 3CUPB 2EDBA 2BCKA 5EZJA 2QR0A 3LRSB 5E5MB 4F2MA 2LU3A 3PGDB 1GVIA 2AQ1A 4LGSB 5TE4H 4OUUB 3PJSB 4M6MH 2PYFA 1IQWH 4YBLC 1ZLSL 1M05A 5DSCB 1GJIA 5F7KC 1TJIH 3L6FA 5HI5D 4URTB 2Z0BA 1E28B 3QCTH 3RWGB 4Q9RH 2AK4D 1A5FH 2WQRA 1OARH 1WBYB 2AERT 5JA8B 2G9HA 3MZTA 1AHWA 1XIWB 5TDNA 5FM4A 4ZOAA 1OSZB 5HHXH 4XWGL 2CLZB 3MLRH 3MUGB 3VFTA 3HE6B 1JZ4A 1DDHB 4V1DA 5C0BB 3L3OB 1QRNE 2FIKB 1EHAA 2SEBB 2VZUA 4PP1D 4NZTH 4J2XA 4LCCA 4EZMA 3U30C 4Z78A 1JWSB 1U8QB 3WS3A 1NAML 1NGPL 3HC0A 4NCC2 3UTSA 4KPHL 3V4UH 3VXQB 4NQVA 1RURL 5CEZL 2GT9A 5KVGH 1K4CB 1BQHA 3LV3B 1NC4D 4HT1H 4YIQA 4WWKA 2C5DC 3FB6A 3MLUL 5JPNB 5H94A 2AQ2A 3O8XD 3MUY1 5TJWK 4KK8D 1F00I 5IOPB 3TESA 4S11A 4Y5YB 1YNKH 1A47A 1IQDB 4ZSOB 2HP4A 4HZAA 2NR6C 4MXQA 5K9KB 5KSAD 1RUAL 4H88H 2XZAL 2FYYA 3SDXE 2Z8VC 5MI0C 5SWQA 4JKWA 3BD4A 2YPVH 3GKZA 1T6WA 5DD0L 3BKYH 2CIKB 3P9MA 3R1GH 4GFTB 4MA7H 1KJ2L 2E8YA 4OM0L 2CH8A 4HIHA 4KWUA 4ZTPH 3QPQC 2YD3A 2FWOA 1VCAA 1FNAA 4PPTA 4WO4C 1MQKL 3BQUA 1CIUA 1S3KH 1W72L 4U1HA 3BP6A 1OTUD 1A6TA 2WMPA 1JPSL 1Y6KR 4OT1L 4WFED 5BMFL 4G6KH 5F7EH 2X1WL 4LVHC 5B4MC 3CCHB 4QRPE 4PJDB 4XCEA 3IGAA 2XY1A 1BZ7B 1QLRA 4ZO7A 1F90H 3V52H 1UCBH 5E24E 3IT8D 3RKDD 1LE5A 1BAFL 3IAPA 3CFJB 4WJ5B 3PQYD 4ODXB 3SDDD 9CGTA 1MY7A 5KG9B 1RAMA 1FGVH 3SDXA 5L2JA 4Q9BA 3MMEA 4XXCA 5D5ME 2G60L 3C2AL 1KJ2B 1F97A 3ZT7A 2CKBA 3NIGF 4G80B 3STZA 5DJ6B 1IAOB 4PREB 1D5IL 1ZA6B 3I6KB 4Z7WF 4MDJA 3RUGB 3QEUB 3SJVB 1W72B 1WFNA 2KPNA 2CDGB 3RTQC 3E6HB 3ESUF 1SM3L 2IH1A 1QFUL 5ESQB 5KVEH 2Y7QA 1DLFL 5KTEL 1YPZF 3K3QA 1CWVA 1JHKL 3D69B 2X4QA 3DURB 4WHTA 4MS8D 4QRPA 1E6OL 4U2YA 3LS4H 3BP5A 1SEQH 3C60B 1CGSH 1RULL 1CK0H 1LK2B 4LSPH 4QXGL 3ZSTA 1OQXA 3IU4H 1RJZB 4NIKB 4Z76A 1XGYH 3QA3B 3BDXA 3JV4B 5KS9F 1BFVH 2IMNA 4QHKJ 5D5MA 4Z77B 5SWSE 1OP5H 1Z5LB 2P8MB 1R5WB 2DJUA 2NTFB 4K8RL 3LKRA 4OLZL 1UVQA 3E3QC 3GUTA 3SKJL 3OR7A 1EEZB 3MJ9A 3BVNA 3NAAL 4I18C 2H41A 4U2ZA 1SJHA 3VFOA 4J4PD 4D9QE 1MVUB 5DZLA 5ISZE 5EA0H 2X4NB 4YBHA 2YPLA 1JP5A 1EEYA 5IF0B 1I9RH 3VRJA 4YWGL 3SGJC 1KJMA 4XPBL 2W91A 3PWVB 1UT9A 5B8CB 3FT3B 1ZA3A 5KSVA 5J13B 2DQIH 2CK2A 5D1ZC 3BH8B 3TIEA 1YYMH 1MI5E 3ROOA 3CFDA 4HXAL 4RFNB 3L5HA 3O3EA 2KKQA 4C56E 1A4KB 3W39A 1B0WA 1KB5B 2B5IB 4IMLB 5SWSA 5KOMC 1KYOJ 5I8KL 1GGUA 1MSPA 1CFSA 4P49A 2CD0A 1GIGL 1WBXA 2D0HA 2MOVA 3LD8B 1WCQA 4L8BA 4NRXB 2I24N 5ISZA 4N8PA 4I0PC 2VQ1B 4HUVB 4FXKA 1T66C 3VGEA 2W92A 4J23A 2WUCL 2P7TA 4DOHB 4KKLD 1EA9C 3VE0B 3OXSB 4NO0B 2KBGA 4HQQL 3PV6B 2WV3A 1QFOA 1X5JA 5KOVC 3WUZA 4L4VB 2EICA 1MI5A 2DMBA 2V7HA 3WIIH 1KC5H 4HWZB 2JB6B 4X4XA 4P57A 1AJ7L 3OGOE 4OCYL 4C56A 5DJ8B 4XMKL 2IBBA 2A9NL 4K23H 2VSDA 5AZEH 5KSUA 1XZ0A 4JLRB 3EDDA 4Z6AT 3E8UH 3RNKA 4LLMA 4AEIH 3GSNH 1P7KA 5FV2A 4FZ8H 1NEZA 1SYVB 5ERWA 1KIQB 1H15A 3G6JF 1EZVX 1L9NA 2I07A 2ITCB 1OWWA 3WNMA 4L5FH 4RGOH 4Y2OA 5BRZE 3MOAH 3UBXG 1NAKL 3TZVA 1HHJA 3KYKL 4L3CA 4U7KA 4Y16B 5DHYA 1C7TA 1L7IH 3MV7D 1UJTA 3B9EA 3U9PH 1CD0A 3UO1L 2ZUQC 2VDMH 2PTTB 1D5BB 4LLQB 1T6VN 5F6IB 3FO1A 4S2SB 5D7JC 1ES0A 4O02H 4PDCE 4GBXC 5LGHL 2BOBA 1RZ7L 2ZSVB 1NFIA 3UP1A 1LO2L 2MPAL 1V7ML 3A67L 2W9LA 2F53E 4PJ5E 4RQQA 1G1YA 1FGNL 1N0XH 4M7LL 1KULA 4EDWL 5HGBA 2X1QA 1NEZG 2A6KB 4HKBB 3T3PF 5CKAA 5GGVY 2XQYK 4IRZL 3IFLH 1FVDA 2Y06H 3S3SA 4K3DH 1MH5B 1KENH 2GYSA 2EE9A 5HPMA 5I76A 2BOCA 3AXLB 4M48H 2NZ9D 1YNLH 1XF5B 3MLZL 1RSFA 4Q6IC 5EULV 4NHUB 4IJ3C 4OV6F 2A6IB 4ALAH 5E4EB 3LKPA 2D7MA 1HH6A 2CDFA 4CVZB 4IOIA 3QO0A 3VXNA 5ITBL 4NYLB 2DWEA 2H2PC 3V7MA 5L2KE 2I27N 2FGZA 5C0JB 1TENA 1MHHB 4MJ6A 2DTML 5TDOB 3BZDA 3AC0A 1TETH 4HIJB 4PJ5A 3EDFA 2QSVA 5J9PA 1IC7L 1IILE 2IPUG 2XWTB 1F3JA 3GO1H 1UQSA 3FN0L 3IJHA 1BZ9B 3MRKA 3B9KB 2AW2A 5HI3D 3CDFA 4Y4HB 3OB0K 1FZKA 1GGCL 5AWNH 4H1LA 1D9KB 4QRRB 3QUYA 4U6XB 5DK0B 1D5XA 2B1AL 4G8IB 3RWHB 3SDCC 1S5IH 5ETUB 3DETD 3GMQA 4WUKH 1VENA 7FABL 4X7EC 2VOTA 1SY6A 3HI5L 3GMMB 1YMMB 4X7DC 5H37H 1YEEL 3G5ZA 5DJ0A 3JXAA 3MRNB 5L2KA 4POZC 1G7LB 4TULL 5MEQB 1J88A 3IDMB 3O3BB 3SOBH 5DDHA 4KMTH 5D7KD 4OF3A 1IM9D 2APXA 3ET9F 5DUML 1BVLB 5KZCB 4S1QH 5F7LB 3ZKQD 3I3DA 2ADJA 5HJ3A 4ZS7L 3W2DH 1K3ZA 5JNYA 1VPOH 4HPYL 5K33A 5D6DC 3RWJB 5I66B 2IALA 4XBPA 3FAXA 5SV3A 2E7CA 2KL6A 5CSBA 1DN0B 4XC3H 5BVJB 1L0QA 4ODSH 1LEGB 2NX5E 4KTEL 5I18H 3MBED 4ZFGH 1XF4B 5IG7A 4OLYH 5GHWL 4J3TA 4M00A 2BVOA 1INEH 2F54B 4BQ8A 6FABH 1FVCB 2OZ4A 4XP9L 5HHMB 1HILA 2BFVL 5F88B 3GI9L 4FQHA 3VMNA 4XC1H 4AH2B 4NO3A 5DQDL 5C08D 1S8DB 2O5YH 4K9EC 5MERA 3THML 3WKMH 3H0TA 5C0AD 3S35L 4PP2B 1TMCA 3QQNA 4YNYB 4U6YB 3GK8H 5SX4I 4TSAH 5I1HL 1YN7A 4BKLB 3U7YH 1CGVA 3TBSB 3TV3H 3B83A 1ZVSA 3QIBC 4G7YH 4XX1E 4AEEA 3MV9E 4ETYA 2YC1A 2NLJB 2QQNH 5I2IB 1EJ6A 2NX5A 3HA0A 4HWBH 5F7DB 2FO1A 1KCLA 1AGFB 4KK9D 1AI1H 1RFDL 3ULUD 4KROD 2DWDB 2H3NA 1SJEA 3L7EA 4XBEL 2R2BA 3FZUD 3OQ3B 2X4RB 3KXFD 3P0GB 1I1YB 3ZTJG 1MCBA 3MCLH 5ID0A 4UV4L 5ADPH 5DMKA 5DRNA 1FG2B 1JE6A 4WHYH 3TH2T 4N0RA 3SKOB 4MJIB 5GSVB 5IFJB 1UWXK 3VD7A 3CVHL 2GY5A 3BGMB 3D85D 2EKSB 5IEKB 2YKLL 2VLJB 1DQLH 3CD4A 3IJSB 4XVUC 2VQUA 4XNUH 4Y5VB 3IAGC 2X41A 2A83A 3G5YA 1ZT4B 3MV9A 2R69H 5GSRA 4YR6A 3ERYA 4KI5E 3QIWD 4DTGL 1X4XA 4GUPB 1QBMH 3QEQE 3HR6A 3O6FB 4KRMB 3P0YL 1YY9D 4D2NA 5EORL 2ICEB 3M8OH 5CJ8A 3U6RA 3FQTA 1OP3K 4H0IA 1KN4L 4GW5B 2A73A 1F2QA 3VH8B 1FV1A 3WNNA 5JLZB 2B2XL 3HMXH 5IVZB 1UC6A 1I7ZB 3BIKA 3JUZA 2JJTA 4TNWK 1XCQB 1U6AL 5E00A 3CVHB 4P2OC 2DQGL 3WXVH 2CUIA 2V5SA 4OQTL 4WV1C 3Q2CA 4X7TB 1RUPL 1C5BL 4MA3B 4Y8AA 1BBJB 1FHGA 1I3RB 2OQJB 4G8GE 4U0QB 4R4FH 1CZ8H 1LDPL 4UQ3B 4GRLC 1KLUB 1UYWH 4FFVD 1Q9OB 3SO3B 2C3GA 3FCTB 1P4BL 1MRDL 5D1QA 3QEQA 2VLME 2Z31B 4P2QE 5DURB 3L3HA 4OJFH 2R1YA 3V5DB 3BPLB 3MV11 3TVMA 1RIVH 4DW2H 2GK0A 2NY4D 1NGQH 5J7CC 1MCLA 3D3VB 3F7VA 4LRIC 4RMRA 3GSXB 5E6ZA 4XCCL 1MWAA 1T7YA 2K7PA 3DECA 3NCFB 2HKHL 4ZNCD 1CBVL 4OSUH 4ZUUA 3VXUB 3RPIA 3CPLA 4YXKH 4BYHA 4WI6A 5F1SA 2VLKB 4PRAB 1NANH 2BX5A 1KIPA 3PWNA 3QNYA 3X11B 2P24A 1VFBA 3BKCH 4BSVB 3L3JB 1J86A 4OUOA 1QYGH 3W5NA 3MFGB 5DS8A 4NZRH 15C8L 4G8GA 4C83A 5IFHH 3KPSD 2VH5L 2DI9A 4ZODA 1RZJH 4LCWE 1XGUA 1HNGA 3DHJA 3GRWH 5CZXD 1WK0A 4P2QA 3U1SL 1X5LA 3TN0A 4S0UC 4G42B 2OK0L 2VISB 4WGVB 4H20H 2D0FA 1WIUA 5FYJE 2K3TA 3VXPA 3TLRA 1AD0B 1BFOA 4ODHH 5L88H 4M43H 3U4BL 2Q3ZA 4BFEA 2Q87A 5I1EH 5E2JA 2E7MA 3WFZA 1RZJC 4PJIF 4X99A 4MZ2A 4KQ4H 5MEPB 2RCSL 4U1JB 4P2RD 2NY7H 5ACLA 3DYPA 1HHIB 1H8SA 3QHZL 4U3CA 1T1ZA 1EXUA 1ZT7A 1D6VL 3LVEA 1K3IA 1OAQL 5CGMA 1SBSL 3NIDE 1RUML 4U1IB 2JKXA 1ZHNA 2WBWB 1I85C 2AQ3A 2C3WA 4S1RH 1G7HB 1Q0YH 3D1MC 3PP4L 2HRPH 2ATKB 3L7FB 4LCWA 1KB9K 1EMTH 3DXAE 3HNVL 3PNWB 5F7NC 5AG8A 4JREC 1G7MB 4BH8B 4OZ4B 5FB8A 3TP4A 2DQDL 1E4JA 5IIEB 4M7JH 5DD3L 2HFTA 4MNQD 2F19L 2F5BL 1XEDA 5DJZA 3W11C 4RBPK 1T2JA 5T3ZE 1I7UB 4UAOC 2IQAB 2OI9A 3H9YA 3LEYH 2V5YA 3BKMH 1CFQB 1IAIM 1FFRA 3ARTA 3JTTA 3MO1A 1Q9LB 4WUUB 3VFGH 1FNHA 2AJZB 1MIEL 2DIAA 4I2XB 1U8OB 1NC4A 3M45A 4JHAH 4I3GA 5DI8B 1NH6A 4GKOA 2CO6B 5JA9A 2R56H 1I1CA 4QLRA 2EH8L 3MACL 3QFJE 2F8XC 2HRLA 3ULVE 4L1DA 3S35X 4HV8A 2VITA 2E9WA 3FT4B 4O2EA 2JCCE 1QLEL 3QO1A 4PTUB 5KSAA 3DRQB 3DXAA 3JTSA 4LLVA 2W65A 4M5YL 2V2WB 3RVWD 2BXYA 2DYPA 5IK3B 3VFPA 1BVKB 3QUML 1G7PA 1P7QB 1NBQA 1QSEE 3FFCD 4XNXH 1J8HB 2DJ4A 4J12A 4O51A 1QFWM 3TPKA 4FABH 4X8JA 5IB1A 4JFED 4XVJH 3HCVA 1U8NB 3TO4D 3WUWG 2YZ8A 2AXGB 1IAII 1XCTA 1RIUL 2ZUYA 5FXCH 1D3CA 1MAML 4PJEE 1MFCH 3QIUB 1FZOB 4TYUA 4N8CH 3B2VH 3NBNA 2B1HL 2OYPA 3WJJA 3TWCL 5HHVL 1F4XL 1RQ5A 3GDBA 5IMKA 4KDTA 5E0QA 2OCFD 2FIRT 3SDDA 4F58H 4LHUD 4ERSH 3L3KB 1V5JA 5IB2B 2HWZH 3QUMB 5IB3B 3T0ED 3MCKB 5HHQA 4GKSA 4LNRA 1X5KA 4MJID 1QSEA 1QA9A 4DZ8B 3BE1H 4UDTB 3UJIL 1K8IA 2BK8A 2X7LB 5HYIA 1JNLH 2BSSA 2IPKB 4X98B 2OTWB 4FQJH 3ZL4L 3TBWB 4HUWA 1QFWI 4R4BA 4R7DB 5CINH 3C08L 4BA8A 1IGIH 1UH4A 4KQ3L 2B8OT 3SDXF 3VG0L 2PKDA 1MCPL 1T3FB 2YD7A 5DLML 1ZHKB 3DYOA 5HHOE 2VAAB 1CLOL 3QEHA 4Z95H 3SDYH 1JZ5A 1L7TL 4B7IA 2G5BB 1HKLH 4FG6D 5KVDH 4ZXBD 3L5IA 1M7DA 1A7BA 3U7AA 3V6BR 5IESH 4FXLA 2ENSA 4IS6B 4PJ7B 4LHQB 3ROLA 2VYRE 2K1MA 2GJJA 3L5WA 2ZOKA 1AKJB 5H2BA 1UM4H 2DMKA 5F96L 1ZTXL 4J4PA 3WE6B 4YQXH 3GMPB 3C09B 4XMLL 3CC5B 1K85A 5DJCA 5HI4C 4ETQB 1I75A 3NCJL 4UV7L 3PHQA 2Q8AH 2AV7B 1T5WB 4Y19E 3O3DB 4PJGF 1T83A 2YN3A 1C12A 5TH2B 4RGNB 2IAND 4LHJB 5D5MF 4HS3A 3QWRA 3T4AA 1DUYB 1RZGB 2GTZA 3QG6A 4D0BA 5MEOA 5F9DC 1U8PB 2AI0L 4EN3B 2APVA 5HHOA 3OL2A 2YOCA 1WT5A 2GAZA 1F11B 4PJ9D 5E5RB 5C07E 2BY2A 1CE1H 4OGXL 1P1ZB 1FAIL 5JW3L 3BZ4B 3RAJH 3T0AA 1X5YA 4MAYB 5DVOA 2W59A 1HINL 1R5VA 4QYOA 5F93C 1YDPB 1B6UA 3QDGB 4D0CA 1DZBA 4IHOA 1RZKH 3MLWL 4N0CC 4LNVA 1OD9A 4YBQD 1F02I 3TYGL 3W0WE 3WFHA 4DJMA 2YWYA 4O9HH 2NXYD 2V7NB 4TVPH 4EI5D 1DQDL 3OF6A 4Y19A 2DL9A 1CU4L 2IPTH 2W0PA 4NKDA 2YEZA 5FA3B 5C0BE 2RAMA 1IGMH 1N3NB 2YS4A 5EU7E 3GSQA 5FM5M 3UDWA 2V5TA 4HBQA 4NNYA 2FBJL 2CRZA 4JANA 3LDBC 4R9HA 3VGFA 1QO3A 2JJSA 3C8KB 2IADB 3PGDA 1C8PA 3N1GC 1OCWL 1QLFB 4LVOB 1Z3GH 3PJSA 5DSCA 5JDSB 3QNZB 3VGAB 4D9RE 1I9IH 1TPXC 4KDWA 1NBYB 1E28A 3I50H 3AREC 4NQCB 5I9QB 4NQSB 5CWSB 3RWGA 8CGTA 2Y5TB 1WBYA 3IDXH 1XIWA 4ZSOE 1OTSC 1CYGA 1AIFB 4FQ2H 3N85H 5EO1B 3FRPA 1OSZA 4KJPC 5B39B 1A7PL 1UM5L 3EOAB 3MUGA 3HE6A 4JQVA 3FB8A 5EOCJ 5C0BA 1G9NL 3SDAD 2FIKA 5T3XD 3BAEH 2SEBA 1UA6H 1T21B 4JG1L 4N68A 4XTRD 3TA3B 4P48A 4K07A 1CTOA 1JWSA 1T7ZA 2G75B 4WI8A 3TPUB 1U8QA 5CEZE 2WWKO 2ID5A 1KCUH 4WFHD 4KY1H 3VXQA 4OZFB 1YEJH 4UT6L 5A2FA 4OFDA 1K4CA 1CF8H 3LV3A 2DICA 1F4WL 3P9WB 5DD6B 1JGUH 5JPNA 4P4KB 5J3HD 2E9JA 5IOPA 4O5LH 1LEKB 4FQCH 4PJDE 3RNQA 3U0WH 4Y5YA 1V8HA 35C8L 5D9SB 4A6YH 1IQDA 1UFUA 4NUGL 4LP5A 4ZSOA 2CMRH 3MA7B 4NWTH 4L8SB 4TQEL 3QXUA 1MCEA 2HT2C 1S7QA 4YHZL 8FABB 2WP3O 4KUCF 5K9KA 4M4PA 1JFMA 3ILQD 5IBTH 5EIIA 2PN5A 5EZOH 4X9BA 3REVB 1ZAGA 1QSFB 2CIKA 5I16A 1KXQE 1JK8B 3CFIC 1LO5A 1KJ3L 3N0PB 3RUGE 3VGBA 3SJVE 4LCUB 4R26L 1LO3L 4KK5D 4QTIL 4TPRH 4XBGB 5LBSL 3CCHA 4GAYB 4PJDA 2Q86B 2OBGA 5T1DL 1NCWL 3MODL 3WIFB 1BZ7A 3WJLA 4M1DH 4XNYH 1UJ3C 3CFJA 4MA1B 4ZTOH 4ODXA 2OP4H 3MRMB 5FGCB 3QDMD 5KG9A 2OLDA 3N1PC 4MJ5B 1S7RB 3EO0B 1NQBA 1KJ2A 1QFPA 5ACZB 2VDNL 2Z92B 3Q3GB 5CJQL 1JL8A 1FNLA 4XMPL 4G80A 4QHUB 5DJ6A 3QJFB 1IAOA 5D8JH 3ARGC 3QXAA 4L3EB 1T7VA 3I6KA 5CGYD 5C2BL 3RUGA 1G7IA 3SCMD 3QEUA 5D7IA 2DM4A 4W6XB 2CDGA 3LPWA 3E6HA 4MHHI 5ESQA 4M6NH 3RZCB 3NFSH 5AYUL 5EIVA 3D69A 3DURA 1CGUA 2YD4A 3HC4H 2KUTA 3MBEA 3C60A 1UZ8B 2OL3L 1LK2A 4AMKH 1ZT1B 5I75B 1RJZA 1BFTA 3QA3A 3JV4A 3S5LG 4Z77A 1L8JA 5CLTA 1Z5LA 2YA0A 1R5WA 3H9SD 2NTFA 3O9WB 4XAKE 1JF1B 3OKEB 1IEHA 1S5HB 2AJ3B 3KR3L 2XKUA 4JAMB 3VXRD 1G9MH 3GBLA 1EEZA 4JPVH 4OFYD 1AKJD 5C09B 1FPTL 5BO1L 1BQUA 5H35B 4LSRH 2HFGH 3BD5A 2X4NA 3EYVB 4UINH 1CICC 4DOHE 3JWNC 4PY8J 1UH3A 4WY7L 5IF0A 3N9GL 1U8MB 4PRPB 5A3ID 5FKPB 4JZNB 4PJXF 2QADC 3PWVA 4LSSL 2B0SH 2OL3B 5B8CA 3FT3A 1MCOL 2BNQD 4PV8B 2VDQH 4L4VE 4IRJB 1G9MC 1QFWH 3BH8A 5B3JE 1Q1JH 4E5XB 1LDSA 3JBG7 2Y07L 3UTZB 1A4KA 5K9OB 5J57B 4AQ1B 2LAAA 1KB5A 1WIPA 5BV7C 3F7PC 4IMLA 4OCXL 3TNMB 2R2CA 4J3VA 5D71H 4GMSH 5E6YA 3HNSH 4HULB 1QKZL 1CFNB 2H6PA 5JHLL 3E2HC 5TPWH 4YZFE 4NRXA 1EJOH 2VQ1A 4HUVA 3NH7H 4NFDA 3S36H 4TRPL 5FYKU 4TUKL 4HJJL 4Y89A 3VE0A 1PQZA 3IU3B 1BLNB 3OXSA 4NO0A 5F9WC 3PV6A 5FHBL 1YEFL 1IGCH 4L4VA 3QHFL 4RAHA 4KRLB 1GPOL 3V6OA 1EUTA 3HFML 4HWZA 3OPZH 3CLEL 4JB9L 2JB6A 4YHKH 5C6PB 5F9JB 4Z7QE 5DJ8A 4WTZG 1NCAL 4APQC 1A9BA 4JLRA 4KKCC 1A1NB 1UWGH 2EDJA 5I6XC 4G6FB 1OM3H 1SYVA 4Y4KD 3TF7A 2FD6L 1KIQA 2D7NA 4Z7NE 2P43B 2ITCA 3BGFB 5CCKL 1R3IL 3AB0B 4N90E 2ZUWA 3LY6A 4YLQT 4ZOEA 4Y16A 3BJLA 1HXMB 4RDQF 4NHUE 3QUZD 1VGKB 1VB9A 4DK3A 4ZAKB 5TDPB 1BM3L 1HIML 2AJSH 1D5BA 4LLQA 2UZIL 3ZLQC 4HH9A 5KAQG 1SVCP 1BD2D 2GKIA 4S2SA 2ZSVA 4HS8L 5HI5C 1EAPB 4Q74A 1H9VA 1VFAA 2NY0B 2W0FA 1DTUA 1EFQA 1VEPA 3ZDZE 4R90H 2A6KA 4HKBA 4OFIA 2Q1EA 3MRLB 3DROB 1LEIB 3C6LD 3U9UB 2DDQL 1T0NB 1MH5A 1MLBA 3AXLA 4OGYL 4QRRE 4XGZB 3JV6B 2BSRA 4NN6C 4PP1C 3MOBH 1XF5A 3O4OB 4KVNH 4K3HA 4NHUA 2A6IA 1IAIL 5FEBA 1KBGL 1B4JL 1YMME 4NYLA 3UYOD 1CT8B 4NM4L 1HI6B 3NZ8B 5AUMB 1MHHA 5ICYB 3D9AH 1GGYA 5TDOA 2GIYA 3B5GA 2X4TA 2J3SA 2PXYB 2GK2A 2X44D 3O8XC 4HIJA 5CJOH 4KK8C 4JFYB 4Z7UA 3RJDA 4AEHL 1PY9A 2MCPH 2HJLA 4X7SH 2XWTA 4JGJA 4KHTL 2ICWA 4F3FB 1BZ9A 3B9KA 5IFAL 3LH2L 4Y4HA 4M6OL 1LK3H 1JF5A 4KZEL 1SBBA 4DGIH 2EXWC 3C2SA 4OLVL 4YHOH 4FQXB 4LPUA 4H0HB 1D9KA 1BP3B 4QRRA 4U6XA 4JFOB 4BZYA 4LOUD 2AS5M 4JY5L 2XACC 5DK0A 4FS0A 4D3CL 4Z0XB 1CVSC 5DK2B 4TSCL 5JR1L 5LG1A 4XNZC 4HX1B 2F54E 1NC2B 3SGDH 1TZGL 5HHME 2MKLC 3GMMA 1K6QH 1EERB 1YMMA 1OP5K 5BQ7B 5C6WH 4XVSH 3MRNA 5EG6C 1G7LA 5MEQA 3TJEL 1JRHI 2FJFA 5DZOA 3IDMA 3O3BA 3RGVD 5BZDB 4LCIL 2R8SL 4NJ9L 1NDMB 1IMHC 4OIBA 4J3XA 1T4KB 2D4FA 1AE6H 2P8LB 1BVLA 4P23D 1UXWB 2X9WA 3HC3L 4PRHD 5MP6H 3U30B 4N0FB 1S9WB 5ECJE 2NW3B 4TUOB 2CPCA 4PJ8D 2WM0A 4HLJA 2HTKD 3MLSL 4JG0H 3MA9L 3RKDC 1ZLUH 3BP4B 4NHCL 1HXYB 3RWJA 3X14B 3X3GL 1EO5A 4HFUL 3ZKND 5I66A 4P9ML 1DN0A 4OF6A 5CSZB 1T5XB 1LEGA 1YPZB 4PGZA 1OGAB 4JPWH 1XF4A 3TC9A 2BDNH 4YDIL 4PYGA 2IF7A 5F9OL 4JZJC 3RVVD 3WDHA 5C0EB 2F54A 3OWEA 3QJHB 4OIAA 3DX9B 4WHCA 1FVCA 2NW2B 4X6FB 5HHMA 3UAJC 4GS7C 2M8XA 2BRRL 5JW4M 4NWUH 5I1IH 5F88A 3UTPE 1MLCA 4GAGL 2GJ6B 3HUJA 5DD5H 1S8DA 2ARWA 1QSZA 2EYRB 2EO1A 1VGEL 5DTFB 4ZUVB 1GC1C 4ODVH 4PP2A 5MI0B 3U0TB 4OM1L 2A0LD 2ZKHH 4U6YA 4XP6H 4YNYA 4K3EL 4MS8C 4BKLA 2VLJE 3DWTA 3TBSA 3B3IB 1Z0MA 2R2HB 4PRPD 2JJUA 3CDGB 4DQOH 3NIDF 3A0OA 2NLJA 4YK4B 5I2IA 4WO4B 4IRJD 5J06A 5F7DA 1AGFA 4B41A 5GJSH 2VR5A 4XCFH 4LVHB 1FBIH 3DMMD 4NZJA 1WVZA 2R0WL 1GGBH 3RDTD 3QBTB 3KYAA 1CDUA 2OJZL 2X4RA 1I1YA 4JO3L 1V05A 4DGVH 4BH7B 5MEND 4NGHL 1FG2A 3I6GB 1I4FA 4MJIA 1CXIA 5IFJA 1G6RL 2O5ZH 2ZJSL 1MCNA 2P4AB 3BGMA 1A0QL 4I0CC 5IEKA 4KRPD 5JUEH 4LLWB 3MRCB 2VLJA 5I8CA 5IVNA 3TH4T 1H3XA 2D7PA 3WHXB 2X4OB 2DKMA 1A2YB 4Y5VA 4JFXB 1XT5A 5CJXC 1X5AA 1DEEB 1ZT4A 3QQ3B 3JWDL 4GUPA 3ALWA 2C7UB 3BWUC 2FECL 1YEKH 1RJLB 3I02B 3O6FA 3RWFA 2IG2L 3O6KH 4Q9QH 2ICEA 3O0RL 3NCYS 1U93B 1I1FB 2F9BT 4GW5A 1IEAB 3D3VE 4LHUG 3VH8A 4UIMB 3LKQB 4PG2A 4G8FB 4NBZB 1ZXQA 1I7ZA 3VXUE 4HG4K 4YHNB 5AD0B 5DO2D 3W5MA 2VLKE 1G6RB 2XQYG 3CVHA 4M1GL 3CX5J 1NLDH 4KKLC 3U48A 1R5IB 3OGCB 3NIFF 2IAMD 1LD9A 4LQFL 2AJUH 3RY6C 2ENYA 4X7TA 4ZD3H 1DQJB 2CRYA 1HSBB 1IFHH 4MA3A 1BBJA 2EIEA 2QHRH 1ULVA 1I3RA 3OZ9H 1JNNL 1MAJA 1EVUA 1N8ZA 2PR4H 2DQTH 2VL5B 1PG7H 4RZCB 1KLUA 1Q9OA 3FCTA 4EI6B 3GHEH 3V79C 2Z31A 3NABH 1ZMYA 5DT1H 3V5DA 5B22A 4OCSL 2MTPA 5C86A 1A6UL 3ARRA 3D3VA 5D1ZB 3GSXA 2X2YA 4JRXD 1RIHL 3HZVB 4I9WD 4OQTA 2VLKA 4NP4H 3S4SA 5ABDE 4PRAA 1BJ8A 2AGJL 3X11A 1HWGB 2PTUA 2DN7A 4Z7VB 3LEVL 4YDVB 3L3JA 1QHPA 1WZ1L 2X05A 2AKRB 5T1MA 3GJFK 1FORL 2EDDA 4UIKH 1FLRL 3BYYA 1KTDB 2NXZD 4RAUB 1I9JL 4I0PB 1MHCB 4EI5A 1AR1D 1TNMA 5IT2L 3S88H 5D2NB 4PB0L 5L6YH 2YBRB 4JN1H 4LIQL 3A6BL 4G42A 2VISA 1FNSH 5L9DL 1AD0A 3U83A 2JK5B 4ORGB 2EDQA 3CSBA 1U3HD 2XXCB 4WUUE 5F44A 4WEMB 4LEXL 1MVFA 3CIQA 4I2XE 4N8VB 5MEPA 2ED8A 2UY6A 2NCMA 4FP8H 1EO8L 4U3XA 1HHIA 4JCLA 2F8OA 4PB9L 3CH8A 4I77H 4PRID 4Y8DC 2Q8BH 3CDCA 3O4LB 1WICA 4DVRL 2X5PA 3RIFK 4E41D 3KS0H 5C9JB 1H3TA 4U1IA 1N5AB 4N1HB 5T1LB 4YDJA 1TCRB 4MNGB 1G7HA 3CGTA 4YDKL 4OGAD 4MQXD 3VWKB 1FZMA 3L7FA 2ATKA 2WBJC 2VXQH 3CVIL 3PNWA 1D7FA 1FIGL 1J18A 1ORSB 4K8RD 5DF0A 1J9CT 1IT9H 5FYJU 4BH8A 4HUUB 4OZ4A 5IIEA 2ZUQB 5HI3C 5IJKC 5EU6B 4XH2A 3ARZA 4MB4A 4Y5XC 4PLJD 5D7JB 1J8HE 1I7UA 4GBXB 3QUXD 3FO0H 4DAGH 2IQAA 4NQDD 1EHLL 1CFQA 3V5KA 2XPGB 4WUUA 1Q9LA 1OB1B 5I1AB 2AJZA 2WWKT 3QEGL 5F7UA 1MRCH 4I2XA 1U8OA 4TUJB 2W0LA 1LMKA 3DETC 5DI8A 1WEJH 1ITCA 4UOW1 3BUTA 2R23A 1YEHH 5EZIL 1YEIL 4Q58C 3EGSB 2BY3A 5EBWB 5A2JH 1E4KA 3FT4A 3U46B 1H5BC 1MCSA 3MGTB 1FSKC 4G6ML 3WFEH 3DRQA 4Q6IB 2PTVA 2RJMA 4WW1A 2WP3T 1O5DT 2V2WA 3BZFB 32C2B 4Q6YA 3VD4A 1WIOA 4HZLA 2E7LC 2P46B 2J8UB 1BVKA 1P7QA 3HMWH 2FR4B 3P4OB 1YUHB 5GGQH 1J8HA 1JRHH 3X12B 1CL7I 3RHWF 4XPAL 3RA7H 4O00A 4UT9H 4YGAB 3I6LE 1IC4L 3O2VL 4CJ1A 4G6AD 3BRDA 3QZWB 3PIQB 1U8NA 4JZOB 4YPJA 4OFKA 5T5FL 3GBNH 4XX1G 3UTOA 2PCPB 4DUWA 3E1F1 3OJDB 1FZOA 3CSGA 2QSCH 5B4MD 5JQ6L 5GGSY 5C0RL 5DEGB 4L4TB 4WFFE 1IEBA 3U2SB 3BKJL 4JM2D 4OD3L 3FOMB 3L3KA 1AXIB 1QBLL 4X4YB 5IB2A 3QUMA 5IB3A 3MCKA 5IW1B 2JLLA 2AJXH 4PJ7E 2LU7A 5J8OA 1RVFH 4DZ8A 1C5CL 3VI4E 4UDTA 5EBLA 3U4AA 5AZ2L 1CDBA 4OF8A 2YMXL 3PABB 3TCXA 2X7LA 4NM8H 2IPKA 3GSWB 4PJDF 4KK9C 3FT2B 4WVRA 3DV6B 4K9EL 3TBWA 5JIIA 4U1KB 3S96B 4R7DA 4GMTH 4FTVB 4BZ2H 2VZ3A 2NQCA 3GJFB 3O2DL 4N0UB 4ZFGL 1A7RH 4PRBB 3RTQD 4P5TC 3C8HA 1SYSA 4Y4FB 3ARBD 4RGNE 4KKAC 1T3FA 4OCMC 1A7QL 4WWKC 5I8OL 1ZHKA 3RU8H 4XVTL 3W82A 1TTGA 3QR2A 4I48A 4NQED 5C70A 3KYNB 3Q5OA 4F7CB 2DQHL 2G5BA 1YZZA 3RUGF 3KVQA 5E1HB 4P2YA 4RMVA 5D7IF 4PJ7A 4IS6A 4LAJH 1BGXH 5CILH 3QIWC 3H6JA 3Q5YA 4OFYA 1AKJA 4W81A 4ONFH 1RU9L 3GI8L 3WE6A 3QDGE 3WYRA 3GMPA 5I1GL 4OAWB 3CC5A 1QSVA 4GRMB 4ETQA 3B6SA 2E5EA 1LO0H 2AV7A 2EDEA 1T5WA 1T03H 1S9VB 1FE8H 3O3DA 3IDJB 2Q6WB 1PY4A 4WTXA 2BNQA 1I8KB 2F8VA 5TH2A 1MUJB 1FQ9C 3SKMB 1QZ1A 1U8PA 3D0LB 5JDJA 2KZ1B 4EN3A 1EGJA 4H8WH 1JNJA 4O58L 2XKNB 1F11A 3WKNA 4OF0A 1CFVL 4FQLL 1P1ZA 3KPLB 2J2ZA 3BZ4A 3NMEA 2F58L 2H8PB 5C0FB 4MAYA 4FFZH 5FECB 2MHAB 4FFVC 4NQCE 3CH1B 1TJGH 2BNRD 3L3IB 1EX0A 5EOCL 3VXMB 1YDPA 1HCFX 1KN2H 5E99L 2NY4C 5LWYH 3VMOA 5TQ0L 3ULUF 2V7NA 5IHUH 3U0PB 3V4PH 2MKWA 3EAKA 5FA3A 5FYLL 2J88L 2YPKA 1NMBH 4F9PC 3HR5A 3FQRA 1P4LB 4ISVB 2H2SD 5C92A 3TPUE 1MCRA 2FGWH 3C8KA 5IWLC 2IADA 5FUZH 1FYTD 1MJUL 4RRPG 3DGCR 1QLFA 4XWOD 3AM8A 3MJ9H 2R0ZL 1OWRM 5JDSA 1YECH 4PJFB 3PXHA 4PJIB 2E27H 4IMKA 3AMLA 2VXSL 4X80L 4QY8A 4NQCA 4NQSA 5CWSA 3V7AG 4MQSB 2Y5TA 2RIKA 5CZXC 3W81A 1CZ8L 1P69B 3BIAX 4YC2C 5JXED 2CLRB 4CGTA 2EE2A 1GH7A 3VXOA 1CDHA 5B39A 3EOAA 5B3JF 4D9LL 2UY7A 4JVPA 4ZDHB 3OAUL 5ADOH 3PHOB 5DVLA 3TJHA 3VDBA 4HC1A 1MFAH 1T21A 4NC1E 3TA3A 4GRLB 1QSFE 3VW3L 3Q1SH 3SY0B 4GXUN 2G75A 4UTBL 1WAAE 4P59L 4JHZA 5EC2A 3IJYB 1JGVH 1AQKL 3P0VL 4OZFA 4MAUL 4DUVA 1EUUA 3LQZB 5FOJA 5HGAB 4DKAA 4G6JL 1TDQA 3LRHA 4B5EA 3MZGB 4DN4H 4M7KH 3I9GL 1XMWA 5DD6A 4JFZL 3FQWA 1A6ZB 4P4KA 4X7FC 4MXWL 2J1KA 2EDHA 3ALXA 1LEKA 4LRNH 5D9SA 3P4MB 5TE6H 4EQ2A 3MA7A 4P9HH 2ZPKH 2LU4A 2DJSA 3OAYH 8FABA 2VQTA 3PWUB 5FGCE 1E4XL 4NZUL 4Z7QF 4YGVB 2BVPB 3FHAA 1CGWA 4KV5F 3F7YB 5HDBE 3WS3B 1KV3A 3HC0B 3UTSB 4HJ0C 5E8NB 4NQVB 5KW9H 1ZVYA 1QSFA 1KCSH 2P47B 1VACB 1S9YB 1WAAA 3F58H 3WD5L 3D2UB 3FN3A 2PO6D 4L3EE 2DBLH 1MFBH 2ZUVA 4P9HC 4UNUA 4Z7NF 5HDLA 4K94H 1NMAH 1U58B 2OSLB 5GISL 4LPTA 3B4NA 3FMGL 3MYZA 2RQ8A 12E8H 3MX0A 4YX2H 4NKMA 3L5XH 4WI3A 2F74A 4RMTA 4FN0A 1VFMA 2LV4A 4GAYA 3OJMB 1AGEB 2EDLA 2R29H 1U8IB 3WIFA 4GXVL 1MREH 3MROA 5HVFB 1A6WH 1KT2B 5HDQH 2NY3B 5DMJB 3WCYA 5JIPA 4K94C 2AABH 4ZPTA 3MRMA 4FMKA 3SDCD 1TQCC 4NNPH 1S7RA 2AAVA 5LJYH 2FATL 1P6AB 4LSUL 4Z7UF 2CKBL 2I25N 5ACZA 2Z92A 3Q3GA 3ZDZF 3TO4C 4QHUA 2BNUB 5F7FA 3P30L 3QJFA 4JREB 3BI9X 2YD8A 3LKOA 4L3EA 5HVHC 5C09E 3F7QA 3VFGL 4UTAH 1CDCA 2DL2A 2ZWLT 5TF1L 4ZNEE 4XCEB 1E4WH 3IGAB 3J7HA 4U4BA 4UAOB 2EYSB 1MRFL 3BOVA 4XAWL 3ZE1E 1N5YH 4PRPE 1QLRB 1OGTB 3RBSA 1NSNL 4PLKD 5FKAB 2VRAA 4AQOA 4Y2DD 3TBYB 4LLAA 2X42A 3T0EC 1UZ8A 4JM4L 4JFHE 3VRIB 4X7CC 4B53A 1BIIB 3WIHL 1HHHB 2CKBB 1PJ9A 3CK0H 2P42B 2Y36H 4S10A 3STZB 4EQ3A 1J1PH 1R0AH 2JB5L 3ZDYE 3K7UA 3O9WA 1JF1A 1VADB 3OKEA 1RUQL 1S5HA 2AJ3A 2IPUK 1N64H 3HS0B 5GS1C 1PEWA 1W0VB 3L3GB 4X6BA 2DQCL 3FL7A 2IH1B 1N2RB 2AEQH 3MXWH 1F42A 1MIMH 5C09A 4IDLA 5H35A 4XI5D 3BT2H 5C0CB 4ZNEA 1S7SB 1GOGA 4HGMA 1T2QL 1U8MA 3LB6D 4PRPA 5FKPA 3BP5B 4JZNA 4JCMA 3B43A 2OL3A 3QIBD 1FG9C 4PV8A 5GRWA 5GS2D 2BERA 2NYYC 4PJGB 1HZHL 4FG6C 4IRJA 4JHWL 4DKFH 2NY6D 4ZXBC 5LGJA 3CDYA 1SY6H 4E5XA 3HUJF 3MJGX 2LFGA 1MF2L 3UTZA 3DMMA 5K9OA 3RDTA 2QQKL 4ELMF 1UVQB 2HG5B 3TNMA 1ZS8A 1HOCB 4A2MA 4KKNA 1NPUA 1KEMH 2YPLB 2ZP0T 3GBMH 5GZND 1RV6X 4HXBL 4BFIB 3VXMD 5GRYA 4JFDD 4EBQL 1EBPA 5EUOB 2YD6A 1ZEAH 3QCVL 1JGLH 4BJLA 4YHYB 5KSVB 2AJVL 1INDH 4IEFB 1ACZA 3H3PH 1BLNA 1TLKA 4UT7H 3ROOB 1W8NA 3U7WH 2FZ3B 2NY5H 4XVUD 5EWIH 4ODTH 5FYKL 1FO0L 2OZ4H 3GHBL 1EZVY 4GG8B 4PJ9C 4YHLL 1JMZA 1O0VA 5F9JA 3B9AA 2ZUTA 4YDLC 4OB5L 4WW2F 4OZHF 5IJVB 1A6VH 4PS4H 5F9AC 3SKNB 4NFBA 3MRRB 1ZANL 1A1NA 3SE4C 1CXHA 3EYSL 2NY5C 3UZVB 5F7WC 1MAKA 3UBXB 4N5EC 2V9QA 2W60B 1OY3B 2NXYC 1KFAL 3RX7A 4P2OD 3NZHH 1S7UB 2FX8H 2VIRB 1DSFH 1BBDL 1BQLH 1HXMA 4MJ2A 1VGKA 4ZAKA 5K9QG 4OTXH 1CGXA 5TDPA 1FO0B 4K7PH 3BWAB 5ACMA 4NJAL 1NGXB 1YEGH 4R7NA 3LZFL 1JZ6A 2DI8A 4QT5A 5E8DL 1QPPA 2QQLH 5CSGA 2C1OB 4LKXB 1XZ0B 4M8VA 2L4OA 2DQEH 1EAPA 4LLMB 2UVFA 1P7KB 1NEZB 5GGVL 3MRIA 3WS6A 2E8ZA 5KVMC 3AU1A 4DGYH 2XQBH 2I07B 4JRXA 2EH7H 3MRLA 3QHTC 2OS7A 3DROA 4JFFD 4BM7A 1LEIA 3U9UA 5E4IA 3TZVB 1T0NA 4GO6B 4U1SA 2ZNXA 1WSST 4NN5C 4ZO9A 4XGZA 3JV6A 5ELIA 1CL7L 2VWEC 3ARXA 1X5XA 3SDAC 4HEPG 2P5ED 4XT1C 3QCUL 4XPTL 1NGWB 2IQ9L 4XTRC 1JFQH 2ZCLL 2CK0H 1R24B 4GQ9H 4YPGB 4GH7B 4YUEH 3P4LA 4H5SB 1CT8A 25C8H 2AK1L 4FFEX 1HI6A 1QBBA 3NZ8A 3UXFA 1TZHB 1IKFL 2EIZB 5K9JH 5AUMA 5ICYA 1X6NA 3NIGE 1KCVH 5J3HC 2XZQH 4OCWH 4JFYA 5C6TH 3SE8H 4JO4H 2ZCHH 3OG6B 5FF6A 2D0GA 3LDBB 1KIUA 4F3FA 1F4AA 5DWUL 1Z2KA 1IE5A 2BVEA 1OSPH 3ILQC 4BSWB 2R1WA 1DL7L 1YPZE 2CDFB 4Z0XA 5J12C 1ZKAA 1TPXB 3QO0B 1OGAE 5HY9B 4HAFA 3AREB 4HX1A 1RHHB 1NC2A 1NCCL 2Z91B 5JHDB 4RFOH 4U1GC 4NKQB 3ZMRA 1KTRL 3F7RA 5BQ7A 2GJ6E 4UBDD 1PZUB 5F89B 4GKZB 5BZDA 1F13A 1TTUA 4LARL 2P5WD 1MWAH 5E6ID 1NDMA 3NGBC 1JBJA 4KK5C 3VXSD 3EOTH 3NPSC 1T4KA 2CLVB 5DA4A 3IJHB 2P8LA 4PGCB 5INDB 5D6CB 1UXWA 2ORBL 2VB5A 4KI5C 4QTHB 1NMCB 4N0FA 1Q0XL 1S9WA 5D1QC 4H1LB 3FRUB 3QUYB 4TUOA 1AP2B 4P3DA 3WHE0 3BP4A 3P2TA 1D5XB 1HXYA 1LVEA 3X14A 3W9EA 3OKLB 1TVDA 3D5OF 1XAUA 5CSZA 2ICWJ 1T5XA 1UM6L 5DC9B 5E2UL 1YPZA 2QSTA 2WINB 5C71A 1GYAA 4GSDH 4YHIA 1AO7B 3G5ZB 5C0EA 3QJHA 4G8EB 3DX9A 4X6FA 2NW2A 3DO3A 4ONGL 4QXUH 5CGYC 4I5BB 1B2WL 5BVPH 3SCMC 2C3VB 2GJ6A 2JELL 3QXVA 1W0YT 1UKTA 2EYRA 3DVNB 5DTFA 1QBAA 4ZUVA 5HYJD 2ADJB 3U0TA 2A1WH 1WCBB 4HK3J 2H9GB 4V3DB 3HG1B 1KEGL 2M1KA 5FDYA 2R2HA 3HNTH 5E1AB 3TN0C 3CDGA 1JGDA 3VGGA 4MQTB 3NCBB 4CN1A 4WO4A 1WQVT 4PJXB 5I1CH 3R8QA 4GAJH 1LP9F 2YA2A 5A2LH 2P45B 3MLVH 1DR9A 1FL5B 5IGXL 3EDKA 1NCDL 3FB5A 4MWFB 4NRZB 3ARDC 4TNWF 3TFKD 1NBVL 4H26B 4KHXH 2OR9L 5J11B 2ED9A 5DMIL 1UJ3B 4BH7A 5FYJH 5I1KH 5D1XD 3I6GA 5GGTL 3S34L 5A3IC 1VESA 5F21B 3BRGC 2PW1B 2XTJB 4WEBH 3ZKMD 4QOKD 3E3QE 4U6HB 4LLWA 3MRCA 3H42H 3AS0A 3GSRB 2VDOH 4HPOH 2X4OA 3ARGB 3TNNB 3WHXA 1A2YA 1OAXL 4JFXA 1DEEA 2PYEB 4U3HA 3QQ3A 3RTQA 3SKUD 3C5SB 3I02A 3NA9H 1RJLA 2E7BA 4NCDA 1ZLVK 4MZ3A 4MQ7B 3D48R 4M5ZL 1I1FA 5D96C 1IEAA 4UIMA 3LKQA 5J0BA 4G8FA 1KGCD 3K1DA 5K93A 5EU5B 1X6LA 3ARQA 1WWCA 3MLYH 1QNZL 4YHNA 5AD0A 1XGQB 3H7LA 5T3ZH 3VWJC 4OLXH 1G6RA 1HE7A 1R5IA 4M62L 3MGOB 4IDJH 3WFBH 4Z7VE 1DQJA 4UZGA 5BV7L 4OV5B 2R2EB 1OVZA 3E3QA 3MR9B 4JQIH 5I71C 1GHFH 1EH9A 4I18A 3ZE2E 4U7SA 1VEMA 3EFDL 3ULVH 3JWOH 5KANG 4IM8A 1PDKA 1QRKA 2HT4C 1CICB 4HLZH 1MEXL 4EI6A 1KCKA 5IQ9B 4LAQL 5D2NE 1AR2A 2FH6A 4GLRI 3SGJA 2H1PH 4Y4KC 2QADB 3EHBD 2ZUUA 3BIKB 4PJ7F 4UILL 5HHPB 5D1ZA 3X13A 3EYUH 5JW4R 3PGCB 3RWIB 3U36B 2XYCA 4MA8L 3VI4F 4UI2A 3F5WB 3STLA 1NUDA 4BZ1H 3ULVC 3JWOC 3QUZC 5DUPL 4ZO6A 5BV7B 1OLLA 4Z7OE 2FEDD 1OHQA 1N6QH 3O4LE 4Z7VA 3DSFL 3ULSB 4YDVA 1I3GH 2AKRA 4R4NC 3E2HB 4FQIL 4HWNA 4NC0B 4P3CH 4MNGE 1H3PH 2J8HA 4RAUA 3L3HB 4XPHL 4I0PA 1MHCA 1IC5H 5I19H 4N0CD 5I30L 4LIQE 1MNUH 5KSBB 3F7VB 1ZVHA 3C6LC 1JYNA 2DQUL 5EU6E 5F9WB 5GGRY 5FHAL 2IGFL 3LIZH 3ZYOA 4K3JH 3GIZH 2JK5A 4JDTH 1KIPB 3LQAL 4BELD 3AROA 3G6DL 2MSPA 1ZLUK 4N8VA 4PLNC 4OLWH 3D39D 4JRYD 4DKEL 2RR3A 2BJMH 5C0DA 4TVPD 3UJTL 5DRXB 1RK1B 4C83B 5I6XB 4ZFOL 4YO0B 1DBJH 5DMGC 4NOFA 1XGUB 5LCVH 1N5AA 1TCRA 1FCCA 4MNGA 5E9DD 3VWKA 2X4SB 3MLXL 1BOGB 1ORSA 4FFYL 3TT3L 3ZO0A 3HKFA 2BVQB 1MCIA 3QI9D 4HUUA 1SJVA 4LSQL 4WI4A 2J8UE 3NA4A 3IXAB 1EFXD 5D7JA 1JYXA 2LVCA 3KJ6H 4GBXA 4YAQB 2VABB 3LSOA 2B20A 3O6LH 3RWCB 1T89C 2XPGA 1MHEA 1OB1A 4U6VH 5I1AA 1AFVH 4J8RB 3G5XB 5E2VL 4JRWA 5E2TL 3MV8D 2AK4B 3KPRD 2P48B 4TUJA 5D7SH 5DFTA 4E42B 4JO1L 4ZFOB 4LBEB 2IFFH 3MXVL 4Z0BL 3IYLW 2A38A 3RGVC 5MHSD 2R39A 2R0LL 5EBWA 4UB0H 4L4TE 3U46A 2EE6A 2R4RH 2AEPH 3MGTA 1IGYB 1Z6JT 4P23C 4Q6IA 5B21A 2DOCA 5EOTB 1G6VK 1GGIH 3QRGH 4IOSD 32C2A 5AYQA 1TVBB 4ZOCA 4OF5A 3RL1B 3CAFA 2J8UA 4PJ8C 2HTKC 3ZKNC 2FR4A 3JTTB 3P4OA 1YUHA 5E8OB 3OG4B 3X12A 2FB4H 1NC4B 2OX5A 2NY2D 3WUWB 3BW9A 3QZWA 1WF5A 3O8XB 3PIQA 4JZOA 3RVVC 5KJRH 3RWEB 4FTVE 1F8TH 4N0UE 4HV8B 2BY1A 5BS0D 2PCPA 1ADQH 3UZEA 1OAZH 3BN9D 4HF5L 5EPMB 3DHMA 5I15H 4PTTB 1OAYL 1E6JH 2DLFH 1K6QL 4EOWH 1G0YR 5DEGA 4L4TA 2DBJA 2W65B 2MJWA 2XIDA 5E8PB 1LQSR 2O5XH 2BRQA 3U2SA 2A0LC 3QWQB 1WAAF 3FOMA 4EKXA 5IB4B 4CUCA 3SDCA 4X4YA 4XNZB 2ICWI 5I8EB 5IHZB 2V17L 5FGBC 2WAHA 5IW1A 2P8PB 4LDLB 4X8JB 1ZLSH 4WCYL 1JZ8A 4BUHA 1DBKL 2AEWA 4WFGD 4FHBD 1JUFB 1IGFL 3PABA 3BPNC 3GSWA 4PIRF 3KPNB 3AMKA 3FT2A 3ARGD 3DV6A 1UB5B 3B8SA 4U1KA 3S96A 1AXTL 3BUYA 4FTVA 1GC1L 3GJFA 3M17B 4XWGH 5DRWB 3MBXL 2AP2A 2HLFD 1X44A 5ENWB 5D6DA 4OCRL 3QISA 3Q6GL 3PQYB 5HDBF 4YXHL 1FZJB 1N7ML 5HYSG 2YD2A 4X0KB 3VFVB 1A8JH 4POYA 3OX8B 1NAMH 3KYNA 1NGPH 4JFQB 4LNRB 4KPHH 3R0NA 4F7CA 1QA9B 5IV2B 4JZJB 4KRPC 1RURH 4L1HA 4F9LC 5CEZH 3MJ8B 3V5HB 5FUOL 1PZ5B 4GS7B 3MLUH 2GQHA 2HKFH 2QL1A 2IC2A 1H3VA 3GB7B 5ALCL 3EDJA 1WISA 4TTDD 1T04B 2XA3A 4GRMA 2Y5EA 5A16B 5F6HJ 5F8QC 1CICD 1RUAH 1S9VA 5H37G 2XZAH 1I9EA 3CFEA 4TNVK 4FA8A 1I8KA 3EYFB 1FH5L 2DAVA 2J4WL 1EHXA 2QADD 1MUJA 5DD0H 3B5TA 1KPRB 1NUFA 1BWMA 3D0LA 2DD8L 2IAMC 1KJ2H 4OM0H 3X17A 1F58L 4JKLA 5IMMB 4NQUA 2XKNA 2L7UA 3ROLB 3S37L 4PUBL 4PJFE 3KPLA 4AIOA 2H8PA 1MQKH 1A3LL 4PJIE 1FNFA 5C0FA 1W72H 4L29A 2MHAA 5FECA 1II4E 2Y6SD 5D72L 3ZE1F 5BMFH 1JPSH 1OPGL 3CH1A 4OT1H 4YXLL 1HWHB 3L3IA 1MCFA 4UQ2B 5DD1L 1BVZA 1OP9A 3VXMA 3RPKA 4X9IA 3ZKXB 5FYLE 1C12B 2ZSWB 5EU4B 3FN9A 1BAFH 3U0PA 3T4AB 3UC0L 1LQVA 2GTZB 3IAQA 4MSWB 4HMDA 4W4NA 5GS0L 2V5MA 2G60H 3C2AH 3SE9H 1P4LA 4ISVA 4PGBB 1PG7W 1U8HA 5L8JB 2A77L 2B4CL 2WUBL 1D5IH 1C7SA 2HFEA 3BSZL 3CFCL 3RY4A 4OZIA 3LPFA 4OBSA 4APQD 2MNUA 1I7RA 4PJFA 1SM3H 4PJIA 1QFUH 3ZZ1A 4XP5L 3UJJL 4KKCD 4YFEA 4EIGB 2E9BA 1DLFH 5KTEH 4IHOB 1JHKH 5JOPD 5IROC 2LQRA 1E6OH 3T09A 4BFGA 3WXWL 2CLRA 1RULH 3GMNA 4QXGH 1DVFD 1HYSC 4ZDHA 4FZEL 1DBML 3P11L 3PHOA 1U3HC 3UTSE 3ESVF 5JW5B 4LU5L 4ODBD 2XRAL 3O2WL 2X40A 4GRLA 4NO2B 3H7BA 3DBXB 3SY0A 4K8RH 4WHYG 3ZYZA 4JGMA 4OLZH 2X4UB 1XF1A 3SKJH 1U8KA 3IJYA 3NAAH 1JF6A 4P5MB 3LQZA 5HGAA 3WFCL 1HK6A 4AENB 5GRXG 2NNAB 5E8EB 3FOLB 4LRIA 4EDXB 4ONHB 1U9KA 3HI1B 4ZUSA 3EOYG 1A6ZA 4OGAC 4MQXC 5C0GB 1X4YA 4YWGH 2DI7A 4XPBH 3MV7B 4K8RC 3P4MA 3CFBB 3FB8B 1Y18A 4JY4B 1JGEB 1JZ7A 2VZ1A 4HXAH 3PWUA 3QAZC 2XWBA 5CEXB 4PLJC 2VDRL 3QUXC 4YGVA 1IAKB 2BVPA 3OKYA 4Z5RB 3G5VB 3A6CL 2XY2A 3F7YA 3O3AB 1NCBL 3OHXA 3DOSA 5E8NA 4MD0B 1MJ7L 1J1XL 3ARWA 4UU9B 4U1NA 5I8KH 1VACA 3WLWD 1S9YA 4I3RL 4Q0XL 3D2UA 1GIGH 3GSOB 2W1NA 2X89A 4HK3N 1ZGLP 1G7QB 4G9FD 2OSLA 1JNHB 1U58A 3TO2A 3PWPD 2FCBA 4LKCB 4HBCL 2Q8BL 3RNQB 2VDPL 4DZBB 5HGHB 2WUCH 4KZDL 4G5ZL 5CJ5A 1S7QB 5F8RC 3R8BB 1MJJB 1AGEA 4GQPH 2VLLA 4HQQH 1U8IA 2EXWD 1DQQB 5EIIB 1UWEL 4J6RL 1KT2A 1BFSA 1NLBH 3VMPA 5H8DA 5C0ND 2Q20A 4GRWB 3KNBB 2ADGB 1AJ7H 4OCYH 5CJBA 4XMKH 2A9NH 3ETBF 1U8JA 5I16B 1I85A 4HS6B 2Q7NA 1VSCA 1LO5B 4LCYB 4G6AC 3FO9B 5EO9B 3HZKB 2BNUA 2H32B 3MRHB 2LVEA 4A2LA 4L4JA 4KKBD 1NAKH 3WN5C 3DUHA 3QFDB 3KYKH 4JN2B 5C0CE 2X4PB 3TT1L 4L9DA 4M3KB 2EC8A 4MMXC 1ETZB 2EYSA 3FB7B 4JM2C 1OGTA 3UO1H 1I1AC 3DVFA 4O4YL 5FKAA 3TBYA 4HKXB 4PJGE 1MCKA 4PGJA 3ABZA 5LGHH 3VRIA 1RZ7H 1MPAL 3KLAA 4OLUL 1BIIA 3T0XA 3S5LB 4XXDB 1LO2H 4I3SL 1HHHA 2MPAH 1V7MH 3A67H 5IR1B 3WO4C 1FGNH 4M7LH 2WZPD 1H5BB 4EDWH 3UAJD 1IM9B 3QXAB 5GGQL 1FSKB 1VADA 2YUXA 1G7IB 4IRZH 3HS0A 3WEXB 5D7IB 1TTFA 1W0VA 3L3GA 2YPLE 1N2RA 2BVTA 3ARBC 4H25A 5J1TC 5C0CA 1S7SA 3DIFB 3MBEB 5T1KD 1CQYA 3PL6D 4NKOA 1U95B 3RVUC 5D7LD 3S37X 5ITBH 4NNXB 4PJGA 5KVFL 3WIHA 5DHVB 3ULUL 4NBYB 4F57L 3NTCL 3E0GA 4K3GA 2DTMH 4KK6C 1KB5L 2I5YL 1H3UA 5C08B 1Q8MA 1B9ZA 2HG5A 1DBBL 3EJJX 3NFPA 5C0AB 3SHSA 1IC7H 4CAGA 1N26A 1NJ9B 3FN0H 1HOCA 4HAGA 4LPVA 5BZWA 1TVHB 3RZWA 1GGCH 4MLSA 1NKRA 2QJDA 5GRUL 4BFIA 3L1OL 5FOBB 5CAYB 5LXGL 1DFBL 4GMTL 5EUOA 1Q72L 3BZEB 1I3VA 2ARJB 5FYKE 5TQ2L 3L5JA 1RHFA 1JHLL 2FZ3A 2QKIB 7FABH 4XPFL 3HI5H 4KROB 1XGPB 4LLDB 4RMWA 1YEEH 4GG8A 1T1YB 5DJ2B 4HIXL 1UCTA 4EUPG 4MXVE 4TULH 1U2HA 4TTGA 3WDIA 3BIBX 4NDMA 3G9AB 3KXFB 4JR9L 5F6HI 5IJVA 5DUMH 3MUHL 3SKNA 4U7MA 2H6PB 3MRRA 4X9GA 1XF3A 1RZFL 4ZS7H 4Y1AD 1WJ3A 1AD9B 2YZ1A 4HPYH 3D85B 3UBXA 1XH3A 2W60A 4Y88A 2YK1L 3BPCB 3PV7A 5ANMB 1PQZB 1S7UA 4KTEH 1J7VR 2VIRA 3OAYK 4W70A 3DPBA 3QIWB 2H2SC 5GHWH 1FO0A 2GJZB 3BWAA 1B90A 4XP9H 1NGXA 5FA4B 3I85A 3GSUB 4OD1L 5CD5D 2GUOA 3IRPX 2BFVH 3V2AR 4XWOC 3CSPA 3GI9H 2C1OA 4LKXA 5DQDH 1A9BB 3HE7D 5GZOD 4QEGA 1KG0B 3S35H 3DUSB 1J0HA 4R97C 3BFOA 4X83A 5DHXB 1LO4L 3OR6A 2V6HA 5I1HH 5JXEC 4JO2L 4X5WA 2XTLA 3WNKA 2KZWA 1BJMA 4M61B 3HHRB 5IVXB 2CGRL 3DUUA 3ILPB 4BUGA 2DLTA 1NGWA 4HH9B 2XZCL 1RFDH 1NEUA 3OKMB 3VI3E 5DZNA 5JHDE 1R24A 4YPGA 1N59B 4XBEH 4H5SA 2VC2L 3ZT6A 2ADFL 1OT1A 4P46D 2GSGB 2NY4B 4L8CA 1TZHA 1CLYL 2EIZA 2W0FB 1VFAB 4FQ1L 2VLRD 4UV4H 3T1FB 3G08B 3C87A 3IRZA 3KPTA 3KLHD 3PWJB 1J5OL 1Z9SA 1MLBB 2ICCA 4IRSD 4Z7VF 2YKLH 2BSRB 1W0WB 1KLGB 2W07A 4WI9A 3ARFD 2EDFA 3ZE2F 3D39A 3QB7C 4RFEB 4BSWA 3KYMB 2WWMC 2ZUXA 3WNPA 4DTGH 3KPSB 4R96B 5DQ9B 5HY9A 4C4KT 5J4MA 1AO7E 3AREA 1RHHA 1WTLA 1AGDB 1NL0L 5MHSE 43C9A 3P0YH 5E5UB 5CZKA 5EORH 3RI5K 2Z91A 5JHDA 1EAJA 2PO6C 1LWRA 4NT6B 3UTTD 1KN4H 4PR5A 5C2UB 3V8CA 2M2DA 1DQML 2I9LB 2X4TB 2B2XH 2PNDA 3SQBA 5F89A 4GKZA 2WBJD 3PP3H 4Z7UB 3K80A 4X6DA 1CLZL 5BW7C 2HJLB 1IBGL 1U6AH 2DRUA 2XN9D 2ICWB 2CLVA 1CTNA 2DQGH 5E03A 1EFXA 4PGCA 5INDA 5D6CA 4Z7OF 4OQTH 4QTHA 1ZHLA 3HG1E 3PDGA 1TFHA 2V2XB 4P2RB 1RUPH 1C5BH 3FRUA 1AP2A 4P5KB 1A7NL 4LSTL 5ALBL 3OKLA 5SWZD 1QVOA 1LDPH 3P77B 4QF1B 5B38G 4PJXE 1P4BH 2WINA 1MRDH 3MQIA 1T20B 3GIVA 1MJ8L 1AO7A 3EOBA 4G8EA 1BMGA 1RUKL 2FJFB 4JQXC 4I5BA 2VR9A 1KCSL 2C3VA 1CXEA 4XCCH 4MNQB 2HKHH 1CBVH 3K2UL 4CW1A 3EO1B 2CQVA 3DVNA 4XCYB 4MX7B 1A3RL 1ZHBB 2JIXD 2XTJE 3SPVA 1WCBA 3QYCA 4PLKC 5AG9A 2H9GA 3E6FB 4L9LC 4Y2DC 3HG1A 3PGFL 2APWA 4YX2L 4X6CA 1J0ZA 5E1AA 3V0AC 5J1AB 15C8H 1V3JA 2PYEE 3C5ZD 2VH5H 3X3FL 4PJXA 4MVBD 2VDKL 3LAFA 4ACPA 3N1QC 1F45A 3U1SH 1MLCB 3GMLB 5DJAB 5GS2H 5JO5B 2J8UF 3HUJB 3KPMB 1FL5A 2OK0H 4MWFA 4NRZA 3T2NL 5JZ7D 4WI2A 4ELMB 4H26A 4XI5C 2NPLX 3U4BH 3FFCB 1UJ3A 1K5NB 1MFDL 5FM5O 3UMTA 1BJ1H 3LB6C 1TQCB 2RCSH 2ZG1A 4XNMB 1L0YA 4KFZC 2PW1A 4JFEB 3TO4B 3QHZH 4U6HA 4LK4A 2W9EL 2NY6C 3FQXB 3HN3A 3GSRA 1D6VH 3TNNA 3ARGA 4V1DD 2FO4B 3R06B 1OAQH 3RVXD 1DBAL 5HVHB 1SBSH 1WWWX 2FH8A 1RUMH 2PYEA 2DQJL 2XA8L 5DGQA 3PP4H 3P40A 1EHNA 3HNVH 5INCB 3C5SA 4AIXA 2ICES 4P5TD 4MQ7A 2DQDH 4LHUB 5DFWH 5DD3H 5F1IB 1OP3H 2F19H 2EXYD 2F5BH 4KKAD 3T0EB 5GZNC 1A6AB 4PRNB 4N9GB 5EU5A 4WWKD 4NQXB 1I4FB 2OTUB 4WW2B 4OZHB 3TIDB 5GGTA 2OR8A 3V0WL 2X9YA 4KJQD 1XGQA 4OIIL 3U4EB 3O45B 3FKUS 1MIEH 5I8CB 3P4NB 4QHKI 4KGJA 3MGOA 1GZPA 4OV5A 2EH8H 2R2EA 4KVCL 3MACH 2WLYA 1ACYL 4MXQD 3MR9A 3RJQB 5GS1B 4W6YB 2VDLL 2C1PB 1P4IL 1VHPA 1QRND 4LSVL 3ZKSD 3RWFB 1CICA 1QLEH 1INQB 5IQ9A 4G3YL 2VMFA 4M5YH 4GW4B 1BF2A 4TVSa 5JXAL 4DN3L 5EH1A 1HQRA 3QUMH 2Y1VA 1GXEA 4S1SL 5HHPA 4PV9B 4ZXBB 3PGCA 3RWIA 3U36A 2MCG1 4DFHA 4NSKA 3F5WA 3BQUD 4RIRB 3IXTB 1LD9B 2FLRT 3QIUC 3MJ7B 1J11A 5IBUG 3FO2B 4AJ0A 3RX8A 2ARJQ 3RIFF 4CVXB 3QG7L 3ULSA 1N8ZB 3TYFB 1MAMH 2ZUSA 4U1MB 3QPXL 5D93C 5I1JL 4HUXB 2B1HH 3E2HA 2FHBA 3TWCH 5HHVH 4WHDA 1F4XH 4D0DB 1UZ6E 2IANB 3QDJB 3DX8A 5KSBA 3ZHLA 3IVKB 4ZMAT 2HA1A 3LN9A 1JN6B 4PJ9B 3S4SB 3UJIH 1PLGL 1X9QA 2A6DA 1JI1A 2GSIB 4EEEA 4YDLB 3ZDXF 3ZL4H 2AK4E 4QRPD 4APQA 2HLAA 3C08H 5FCUL 5T1MB 4OBRA 5DRXA 7CGTA 4KQ3H 4PYHA 4YO0A 5JOFA 4DKDC 2NXYB 4EI5B 3VG0H 1WZLA 1WFTA 1MCPH 4LEOB 5DLMH 2X4SA 1BOGA 1CLOH 5I17A 5M95B 5T3XL 2BVQA 2I9TA 1L7TH 4M7ZC 4PP8C 5CMAB 4OZIF 3IXAA 4RBPH 4HIIA 4PJFF 3EZJB 4YAQA 4NKIL 2VABA 3WFDL 3HAEG 3SQOL 2LAGB 2EDWA 3CXDL 2KQMA 3RWCA 3GNML 1X5ZA 3HI6L 3IS0X 4BQBA 5F96H 1ZTXH 4J8RA 3G5XA 5JIKA 2AK4A 2BXZA 4E42A 1I8LA 3BMWA 1IGJB 3O6ML 4XMLH 2O61A 2CRMA 4ZFOA 4JFPB 1NFDA 2I60L 3NCJH 4LBEA 4UV7H 2VXVL 2R0KL 1VDGA 4G7VL 1BREA 4YDJB 3MSPA 3RQ3A 4UBDC 4J3WA 1FZMB 4RWYL 4NN5B 5E6IC 3DRTB 4HW6A 3KYOB 3T3ME 1ZGLM 2BHUA 3SDAB 5SWSD 5TF0A 5HDOA 1IGYA 2AI0H 5F1KC 4XH2B 4ZPVB 5EOTA 1KPVB 4E0RB 1M7XA 1PSKL 1TVBA