3CDGA

Human cd94/nkg2a in complex with hla-e
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
273
structure length
273
Chain Sequence
SHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, alpha chain E
publication title CD94-NKG2A recognition of human leukocyte antigen (HLA)-E bound to an HLA class I leader sequence
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 68
structure length 273
sequence length 273
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cdgA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3cdgA01
4M4RA 1EHXA 5F9WB 2F5AL 2P47B 5DS8A 1MY7A 5KS9E 4P2QD 3U46B 5D71L 1PEWA 5ICXB 4P2RD 3VD7A 3L5HA 3VGHA 3H7BB 1U8OB 3GI9H 1B0RB 3SDAC 1LVEA 3OAUL 5KVDL 1MJUL 4PRAA 1Y6KR 3DVIA 1G7JB 3LEXA 1MJ8L 1QSFA 5FM8A 3D69B 1U8PA 4WHYG 3OAZH 3RL2B 4F8TA 3CMGA 2YBRA 4YHYB 5M95B 2BSTB 3P77A 1DE4A 2F9BT 1TDQA 1AGFA 1OAXL 2JJUA 5IK3B 4TVPH 3OAYH 4M8VA 1QLEL 5KS9A 5K9OB 5BMFL 3RWDB 5DUBB 2R2BA 1OSPH 5C0IA 4U6VL 3BP5B 5HHME 3UPRB 2HWZL 5CJ5A 2VDPH 3ZKMD 1NCWH 1RJCA 3GRWH 3M17B 4E5XB 2FWOA 5I19L 5DDHA 5HHPA 3SO5A 1BD2B 4TUJB 4JKLA 4Y4FA 4OF5A 3OGOE 3QUYA 4I3GA 4KHXL 1MVFA 5DD3L 3OKDB 2BSSB 3BFOA 3LKOB 2F8VA 2NX5D 5BS0B 1KJ3H 1CGSL 4FZEL 1QA9A 2JJTC 1NC2B 1H5BB 4LSUH 4YPGA 5HHVH 3GSOA 5C3LD 3U79A 4G9FD 3ULUD 2EH8L 1IGYB 5HHMA 1FZKB 4KUZL 2Q87A 1S78D 2FX9H 1N5YL 5EULV 2FD6H 3WDJA 4P5MB 1JZ3A 1RMFH 1BIHA 4MJID 4O51A 1F4WH 4YBHA 5D6CA 4ONFH 1IGCL 5LQBH 3NH7L 4RGMB 1CFNA 4DEPC 2NR6D 5GGTL 3BHBA 5DRNB 2Y07L 4XP6L 1ERNA 4EOWH 1CIDA 1BX2B 3QQ3B 4N9GA 4C83A 4OCYL 3VH8B 1JWUA 1S5HA 1IGTB 1MFBH 3B43A 4LHJB 4NT6B 4FNLL 4OKVB 1U8QA 2X1WL 1X5LA 4F15C 4RRPA 4KJWD 2B5IB 3I3BA 3BKJH 6CGTA 4YHPA 3QUZA 3BP6A 4ETYA 2C7UB 5A3ID 5ALCH 3EYUL 5F7HA 2VQTA 2AW2A 1I1YB 1A14L 3ARVA 5DSCB 4XBPB 4XAKE 3AROA 5FYJL 1XFPA 2WZPD 2H1PH 4LPWA 5E8DL 5EZOL 1JPSL 1KTDB 1MFDH 4R96B 2FR4B 1FPTH 4M5YH 5K9KB 2X5PA 5IHBA 4HKZA 5D7LB 1ZHKA 4PLOB 4MA1B 1J1OL 4LAJH 3MLRL 4GT7A 2PYFB 5CZKA 5DQ9A 1XGQB 3HTLX 4XCEA 3R8BB 2Y23A 4U3HA 3B9DA 2B1HH 1FZOB 4XTRD 2PCPA 4QXTB 4QHLB 4R6UA 4NJ9L 2CRMA 1J11A 2EYRB 4POZC 1EGJA 1T0NA 4O2FB 4GG6E 3WHXA 1I8MB 2GK2A 5FEBA 4KFZC 1OAQL 3L3OA 2NW3B 3H9SD 3JV0A 3OR6A 1DQDH 2Y06H 4XB8A 5HYQA 1C5BH 2EDNA 3QDGD 4E41B 2F15A 1O5DT 4RMUA 5DUPL 4KJYB 4U1GB 1FSKC 1H9VA 3I6KB 1CD9B 1CICC 4K3EL 3B9KA 4G8GA 4XHQA 2AXGB 3NZHH 5ANMB 2P45B 4GH7B 1QSEE 1A2YA 4J4PC 3TNNA 5I66B 1MWAH 2X9YA 1HH9B 5F3HB 5I2IA 4ODHH 2H8PB 2BHYA 4FQPA 5H94B 2HRPH 1DDHB 2PKDA 4ENEC 1MF2L 5ISZE 3JBG7 3F58H 3QPQD 1MY5A 1PVHA 4OZGE 1ULVA 4Q74A 3SKNA 1MHHA 1B2WL 2DM2A 5JTWA 1I7UA 3VA6A 3STZA 1I1AD 2NY1C 4F37K 2AEIT 4IOSD 2CUMA 4P59H 1LP9A 1RIHL 3BRGC 4S1RL 2HLFD 4Y16A 3DVGB 4R97C 4QHNB 3ULUF 1JBJA 1QSEA 5D2NC 2KL6A 1EFXD 4RAVA 4XNYH 5DJYA 2CH8A 1PG7H 4NRXA 2WQ8A 5INCB 1FNAA 1MLBA 3IU4L 3KPOA 4JDZA 2X4NB 2E7MA 4GMSH 5ISZA 3RUGB 2M26A 3JXAA 2MPAH 1N3NA 4DZBB 2A83B 2XQYK 4U1MA 5JMRA 5I1EH 4OZGA 4Y19D 5EZIL 1J1OH 1F6AB 3ILPA 3BKML 1V7ML 1K6QL 4MNQB 3TPUB 3KNBA 2M8XA 2NY2D 4PRDA 5DT1H 5DRXA 2PF6A 4APQD 5JORA 3I9GL 1V8HA 3TIDA 3QQNA 3U6RA 2VXUH 3L1OL 2VZSA 3ARYA 3RZWA 3TBYA 1NLBL 3B2UD 3QJHA 5I1LB 1XF2B 4LCWE 1MHCB 4H20L 5DJZA 1YYMH 4H8WH 3EBAA 5IVZB 1WTLA 4YX2H 1YNKH 3FO1A 4ZPTA 4XH2A 3PHQB 5FF6A 2ADFL 1CE6A 2UUDH 1JGEB 1JCKA 2H6PB 4P4KD 1JPGB 1JWMB 4NNXA 2C1PA 3C6SA 2VXVL 3PGDB 2BNRB 3U9PH 4AY0A 1MREL 3S3JA 3KXFA 4XVJH 5HI5C 1ZVHA 5K9JH 3BJLA 4CUCA 4X7TB 4PLNC 3VDCA 3NACH 2A9MH 3TCXA 1B2WH 3CFBA 1CFVH 4JHAL 4XRCA 2Z92A 3RZCB 1U93B 4LU5L 4RFNC 1G6RL 2FX7L 1NQBA 5FCSH 2UY6A 5F1KC 3WN5C 3BMVA 1RIHH 5B4MD 4JKWA 4S1RH 4V1DB 1GL4B 3OKOA 1VGEL 3EYQC 2OK0L 4PY8I 5JHLH 2ZG3A 2IG2L 2ZOKB 1RZIB 1ITBB 2BY1A 3O4LE 4XNZB 3H0TA 1AXIB 5EBLA 4PJ7B 4LKXB 1ES0A 4Z76A 5A40E 4YDKL 3TIEA 1UB5A 4PRNA 4WW2A 3BWUC 3TA3B 5IW1B 3MCLL 4QGTA 2VAAA 2R4SL 1PSKL 3IXAA 1RZ8B 2XA8L 5I1KL 1BVLA 1WF5A 5HI4D 1UJ3B 4OUOA 4K2UH 4NNPL 2ID5A 4JFZL 3ESVF 2BHZA 3O4LA 3KPQA 1MCKA 3BPLB 4NZRL 4LCCB 4Y8DC 2VTFA 4LPVA 1CFTA 1K5NB 2IADB 1CFSA 2W38A 4HWEL 3WSQH 1ZS8B 1KIQA 4JFDB 3DI3B 2VR4A 3K7UA 4P23C 2GW5A 5FGBC 1ZVYA 5D7KE 3MYJB 1RULL 1XZ0A 4KRNA 1NGQH 5GGSB 1SBSL 3GNML 4H5SB 1UCBH 5DD1H 1N64H 5CFHA 1ZHBA 4EUPH 4QXGL 3EJYD 4KJQD 5F72S 4D9RE 4FTVB 1EZVY 1IC1A 1VDGA 5JZ7C 4JZJC 4IMLB 4KMTL 2X1PA 3CNKA 4X4ME 4M62L 2XNAB 2OL3A 4HJJL 4HIEA 4IIQB 5JO5B 3HFMH 2XQBL 1IFHL 5DJCA 2EDFA 2XZCL 4RWHA 4LAQL 5EC2B 3ZE0F 1BQUA 5EWIH 2ZOLB 4P5TC 3I6GB 5EC1A 4BH8B 5HYFA 2JJSA 4JKPL 2KQMA 3F65A 3U4BL 4WUUB 3C5JB 2E7HA 1QBAA 1L7IH 2OK0H 5BZWB 1FVDA 1JFQH 4JFHD 3BP7B 4ODUA 2BNQE 1K4DB 4WI3A 2QQNL 4UB0L 4WU5A 1A9BA 4HS8L 5E2WL 4L4VD 3BJ91 2VDLH 3BD5A 3IDJB 3UDWC 4LIQL 1U8HB 5DHVH 1E4XH 3P73A 3CFIC 1TLKA 4NKMA 3J7HA 1NBZB 3VWJB 5ICZA 2V5YA 3CUPA 4RAUA 5C2BL 1T7ZA 5ITFB 1D5XA 1PSKH 4W70A 4L4VB 4Q0XH 2EYSB 2N4IA 3PIQA 1OP5H 2Z0BA 5LGJA 2OP4L 3MNVA 8CGTA 5JW4Q 3FTGA 4JFZH 4DUWA 4MB4A 3MUGA 5CP7B 4O58L 4YK4B 4B7LA 4G8FB 3K80A 4L8BB 4NC0B 4ZSOB 3RVTC 4DWHA 3V79C 5E6ZA 2AK4D 1B3JA 2D7PA 1TQBB 5E5UB 4ORGA 1FORL 4ONHA 4NM8H 2D7NA 1G7LA 4KKLC 1UZ8A 3MRJB 3G6JB 3GNMH 4U1NB 4AMKL 1I3VA 1A6UH 3PNWA 1AGBB 4KDWA 3BT2L 4DK6A 3RBSA 3TT1L 3UEZA 1BVKA 4PJBA 1VFOA 4MQ7A 5FHAL 3HCVB 4KZEL 2W07A 4LHUG 1MCBA 2YC1A 5MEOB 1I8IA 1ZTXL 3MRLB 1OP3K 4HBCL 4PJXA 4N0FA 4NKDB 4Q97A 1OGTA 5D7SL 1LK3L 4I9WD 1IKNA 3UBXB 5GZOD 4LFHD 3WS3B 4JGUA 4CVWA 2VN7A 5IM7B 1DSFL 4JPKL 5F6IB 1WBXA 2OI9B 4I4WA 1BZ7B 4F58L 2OQJA 2GI7A 4JCMA 4Y4FC 4M8QA 1C7TA 3QUYC 5HVHC 3IAGC 7CGTA 4MD4A 4YHZL 4WW1B 5I1IH 2IANB 2QQNH 1MAMH 3QWRA 4ZYKB 1ZK9A 5GJTL 5JR1L 4OM1L 4OM0H 3OKEA 3CZFA 4EIGB 4MXWH 5EBGA 1D5BB 5AUMB 5TF0A 5IW3A 5J89A 4TULL 2GAZA 4WI8A 4AM0B 1EGJL 4UNUA 4JQIH 4R3SA 1OM3H 2HT3D 1M7DA 1BHGA 3VFPB 5L8JB 4TPRL 5BVPH 3BVNB 1YEFL 4L8DB 3QRGL 4XNMA 3MCKA 1TJGH 3P30L 2ZUTA 1L7TH 4LKCA 4U7MA 3SDDD 2D9CA 4NO5B 3QFDA 1RUMH 4Y2DD 3HG1D 2GJ6A 2NY4C 1MPAL 5FCUH 3EFDL 1F11A 3GJFA 3T04D 4WU7B 1NUNB 4MYWB 4Y5VB 4YXKH 1UG9A 2W65A 4XBGA 2BOBB 5F93C 1YMHB 3PWLA 5E4IA 3D39D 4OIBA 3TO4D 3W82A 2CK0H 1YQVH 4Y2DB 4D9LH 4JKMA 3WLBB 2Y5TB 4ODXA 1YEJL 5EFIB 1UC6A 2ZJSH 3QUZC 4P46B 2Y4SA 5EOCJ 5ESAA 3D3VD 3O3DA 1A7PL 1VKXA 2I9TB 1RURL 3DJ9A 1A1NB 1N59A 3BAEL 2BX5A 2FB4H 5FKPB 5LAXB 1CXLA 3TO2A 3G6JF 2VLJB 1JZ8A 1JPTH 1JF1A 4DGIL 2DQDL 2WWMC 3CSYB 5E99H 4J12A 2VABA 1T0PB 4NN5B 4JN2B 2AVGA 5KSAC 1UWGH 3P0YL 5BZDA 5SWZD 4YHZH 1DLHA 1MIEH 4JGMA 1W8OA 1MHEA 3UAJC 2XFXB 3MGOA 3O6LH 3KLHC 4QOKD 5JR1H 2LABA 3RDTD 4YGVA 1ZXQA 2BC4B 2DWEB 4L3ED 5KVEH 5GGVL 4I3SL 1IAII 4LSSH 3RIAK 4HZLB 4UAOC 2YPLE 3IKCB 5JXEA 4K23H 3U0PA 4X98B 3EO1A 2C9AA 2J4WH 4D94A 3QIUB 1OAZH 4PJEF 1U3HD 4Z0XB 1RFDH 3HC3L 5IQ9A 3T3PE 4OLUL 3B9KC 4IRZL 4NHCL 5ITBH 3BZ4A 4OGZA 1F4AA 3WFBL 4NM4L 5BV7L 1HH6A 1RQ5A 3QZWG 2NLJB 1T0MA 3H9HB 5KZCB 1R3LB 2WWKT 1E6JL 2NY0C 4CBPA 3BW9B 1PLGH 1I1RA 1N7ML 3LSOA 3CPLB 3JTSA 4ELMB 2YPLA 5F71A 2FLRT 1J0ZA 3WKML 1A02N 3U4EA 5E94B 5E8PB 3PGCA 3L5XH 4LPXA 4ZO6A 4O00A 3QQ9C 1MQKL 5EU5A 2CDGB 5TH2A 5C0CA 3DGGB 1WZLA 1WWAX 3D85A 4ZTPL 1L8JA 4RMTA 5A16A 1GIGL 3HR6A 4HS6A 4JB9H 3G9AB 3QA3B 3IDMA 4Y16C 1DQJA 2ADGA 5E8NB 2VC2L 2N1KA 1TJIH 3LKNB 3SDAB 3TH2T 1SEBA 1UKQA 1AJ7H 4QLRA 1HINH 2I5YH 4TRPL 4DGIH 4MX7B 3GBML 2FDBP 2D9QB 4YUEH 3VXTB 5KSUB 3DUHA 1X6LA 3H3PH 4HG4J 3TN0D 4PUBL 1IEAB 5TPWL 3CFEA 3RWFA 4WGVB 4Z7WF 5E00A 2V17H 3DECA 5D6DC 1DEEB 3EUUA 4MXQD 1MI5D 2YN5A 4LSQL 4GW5B 4LLUA 4XMLL 4NJAH 5DRWB 4GW4A 1A6AA 3ARGA 4I77L 2HTKC 3ECBB 3KPSD 5BV7C 2EDXA 2ZUQC 3DYMA 4MWFB 3PWPD 2OJZL 1H0DA 1T80A 3FAXA 4OGAC 1XGUB 5A43C 1N0XL 1M71B 4UIKL 3NIGE 2W92A 4NQCD 1JWSB 1YYLL 5TQ0H 4JY6A 4L4JA 1NAKL 3QNZB 2QKIA 3LKRA 1X7QA 4LRNH 3PWPB 1E6JH 4HV8B 1ZLWK 4HQQL 3MZTA 4M7ZC 2HFFA 5IKCB 5D9SB 1T1YA 2NCMA 4LCIL 4XPTL 2NY7H 4LOUD 2IH3B 4F7TA 1P69B 1XF5B 3QIWA 4MJ5B 4MD5A 3V0WL 3TLRA 2IH1A 1VPOL 3IETB 5T1LD 2OL3L 1QR1B 3M07A 3AMKA 4ZTPH 1QHOA 3WUWB 5FYJU 4DEPB 2P24A 4BZ2L 4PRID 1YA5A 1MCPH 3G5VB 4O4YL 1LO4L 3N9GL 5SWSB 1T3FA 2ZSWB 4IM8A 4NKOA 5D5MF 4OLVH 4OLXL 2W60A 2AAVA 4HJ0D 4F15B 3FOLA 5H2BB 3N1GC 5F7WC 2D7QA 2NY5H 2R29H 1ZMYA 5DI8B 5C0JB 1LD9B 1PX4A 1ZANH 4NQED 1TCRA 2B0SH 4YIQB 5IVOA 5IHZB 4G3YH 4MS8D 5CEYB 1LHZA 5F6HI 3HNVL 4UTAH 3OKMB 3QQ4A 1WVZA 1L0YA 1I3UA 4G6FD 2Y1VA 4OAWA 5F9OH 1CD0A 1NMAH 4OCLC 4XMLH 5F7KC 1INDL 1U8IA 4PJIE 4MAUL 1AGCA 5EN2B 1KC5H 4QHMA 1G9NH 3QJFA 3WIFA 3G08A 1WWBX 1LO2H 5HI3D 5HPMB 3KWWB 2XZQH 1UH2A 2X7LA 3GMMA 2NY3C 2A74B 2HKFH 2XRAH 2GUOB 1FSKB 4JFFB 2F54D 1CICB 4OZIB 3OGCB 4LSVL 3CC5A 3O3AA 3HLAB 3KYNB 3U7WL 4QCIA 4ENED 4MJ6B 2X10A 1FC1A 3CVHH 4ISVA 3FFCA 4J2XA 1R3JB 1BGXH 1KLUB 2CUIA 2WY3A 1MFCL 3HRZB 3RPIA 4ZMAT 3VFNA 3ROLB 4QXWA 2CLVA 1KELH 4H25B 3HAEB 4Z5RA 3RGVB 3V9FA 2XACC 4N5EA 1A7QH 3HNTH 2NY1B 5CSZA 1RV6X 1BFOB 3FRPA 3KYMB 4ZNEE 1KXQE 1JRHI 2G9HA 1T1XA 2G2RB 1ZHLA 2JCCB 4S1DC 1GZQB 1P2CB 4R97B 3THML 5AD0A 5D2NB 4XP1H 2F53A 3F6LA 3HNSH 4MNGE 4QRRE 3H7LA 3NPSC 3MJ8B 2EDEA 1QRND 3G5YA 4X7FC 3GEWB 3G5ZB 5IMOA 1XGYL 2Q8AH 1JF6A 2CLRB 5ESQA 1M7IA 1N4XL 2H3NB 1KG0B 1QSZA 2UV3A 2VZ1A 4AG4L 2XY1A 1OGAA 1ZLVH 4PS4L 3B83A 4WEUD 3RY4A 1NEZG 5T3XH 1QBML 1RZFL 5M7QA 3Q5OA 1OP9A 4GAYB 1CGUA 1FNGB 2HVKB 1NDGA 8FABB 4Y5XB 3D0VB 1P7HL 4B5EA 1S8DB 4CDGC 3VRJA 3MNWA 1FL5A 4QRRA 3HC0B 4PIRF 4WRLA 4NHUA 2M2DA 3CZJA 4LHUA 3VG9B 1ORQB 1Z0MA 3TBSA 4G5ZL 4Q9BA 4WENB 3DVNB 3WL9B 5KG9A 3IDGB 2VDKL 2HJKA 1OAUH 4GUPB 4H88H 3MV7E 2F58H 1IQWH 4LRIC 1C5CH 4FFYL 4XP4H 1NL0L 3B5TA 3QUXB 4LLVA 2YA1A 1KENH 5KVFH 4DVRL 1TQCC 1BQHG 3IDNA 4M61A 4WI9A 2PYED 4HKXA 4KQ4H 4KTEL 3JWDL 3SDYL 4MMZC 4HKJA 3MV9A 1N8ZB 1AD0A 2X05A 4JFXA 2A73B 1BIIB 2MJWA 5EU6B 1X5HA 2IPUK 1FGNL 4QRQB 2OTUB 2QHRH 3MUJA 3DX6B 2PYEB 3EYQD 3EO9H 2WLYA 2QR0B 5JDSA 1ZT1A 3CFCH 4X7SH 1IBGL 2EDOA 5TE6H 1QVOB 3PUCA 3I75A 4RFNB 4NNYA 1XCTA 4DUXA 3VFRA 1ZHNB 3WN5B 1HDMA 3MRRB 3QNYB 5BJTA 3ARSA 2EKSB 3CSBA 1HXYA 1OSZB 2FGWL 5L7XL 5TE7H 1II4E 2GQHA 4KQ3L 5C0DA 4Y7MA 3OAYK 1GGIL 1I9RH 5TQ2L 5ADPH 1INQB 2A0LC 2FJFA 5CILL 2J8OA 3GO1L 3LHPL 5IF0B 1AKJD 4NBYB 4NN7C 3ZYOA 4JZOB 5E9DA 3O45B 1QNZH 3WFCH 2NXZC 3ZTJH 5HHOD 4GRWB 2AI0L 5C0AE 3W9DA 5K9QG 1IAOA 5FA4A 2QL1A 4G43B 1GVIA 2C4FT 5I8KH 1T66C 5ID0B 1YN6A 3KYOA 3K3QA 3LZFL 5FHBH 4DVBB 4XPFL 5C92A 1AIFA 1A7RL 1JGVH 3IFNL 3JWDC 4F7EB 3PL6D 3T3ME 1EBPA 2NNAB 4P23B 3X3GH 4ZUUB 1NGXA 2DQFA 2ARJB 5CEZL 4UILL 5H35A 4IOFC 1D5MA 1DANU 2D0HA 1OLZA 3IF1A 3GSUB 1LEGB 1BZQK 5GRXG 3QH3A 4NC1E 1FE8L 4JZJB 4MDJA 4MHHG 5JA8B 2ITDB 1S7VB 5L2KE 1T21A 1S9KC 1D6VH 3ULSA 5CP3H 4JZNA 4ZD3H 4NSKA 2R56L 3LEVL 4X0KB 4BFIA 5T5FH 1NCUA 5JOPE 4JRYD 3AY4A 1KOAA 3VMNA 4K7FA 2ZNWA 4P5TB 1AY1H 4J6RH 4MD0B 4WY7H 2NQCA 2GIYA 3MFGB 4DOHB 4UOW0 5JXEC 1F3DJ 1F58L 2XQYG 5LWYL 3ME0A 4PV8A 4KKBD 4D0BB 4IBLT 4BQ6A 5C0ND 5F8RC 4CVXB 1YEKL 2YMXL 2CLZA 4MZ2A 3GBNL 1F45A 1HCFX 4M1DH 1FFQA 1C5DB 3QZWA 1OAYL 3BQUA 1KTLA 4JPVL 5E2TL 4GMTH 3RQ3A 4HCRH 4FHBD 1NC4A 5I8CB 5CGTA 1CL7I 4M7JH 1YDPA 5CILH 3MR9A 3NCEB 5GRUL 3ROOB 3GSXA 2FATH 3MXWL 1E4WH 5DC4B 3KPRE 4XNXH 4Y89A 1A6PA 4JFEA 3WNOA 3RVTD 1IAIL 3QHFL 3C2AL 3C5SB 5DHYA 4PG2A 4S0SD 5ADOL 1U8KB 1B88A 3DXAB 3UYPA 3K2UH 4PJDE 3MLXH 5CBEB 5T3ZL 1RJLB 4Y1AE 2ICES 4QO1A 5DS8B 1QSFD 1WAAA 4G8IB 4E42B 3T0EA 1GGTA 3CX5J 4JJ5A 3Q6FA 4EI5A 3NAAL 1SYSA 2A9NL 3ARED 1G7MA 4WFFE 3QEQD 4EVNA 1F13A 3AGVA 4PRAB 2C3VA 1V3KA 2UZIH 5SX5H 1Z2KA 1QSFB 4GSDL 5DJ2A 4OCXH 2W9EH 1U8PB 5FB8A 4ZUTA 2YBRB 2ZCLH 4WNQA 1XIWA 3ZKND 4R7DB 1BFSA 1A8JH 1DE4B 1T4KA 3V6BR 4UUJB 1AO7E 3MRPA 3B9VA 1A6VL 3VXPA 1AGFB 2R56H 5GSVA 5KS9B 4Y4FD 3LPFA 1J1PH 2R2BB 4AT6A 3REWA 5D1ZA 1WC7A 4S1SH 1C16A 3ZE1E 4HWBA 1KN4L 1F58H 2Z35B 2EEAA 5DDHB 5IQ7L 4I5BA 2VXQH 4ZFGL 4WWKA 3QUYB 5HVHB 4YAQA 1WV7T 3C5ZA 3FN3A 2P5EE 4M1GL 3IVKA 1P4IL 2PUQT 1EBAA 3ZDXE 1BEYL 1F4HA 2VSDA 5C70A 1T04A 1OAYH 1UQSA 1CS6A 2X44D 2AJXL 4OF6A 3NTCH 5EH1A 4FQCL 4IDJH 3S3PA 1FNSH 3KR3H 3HI5L 4XNUL 5CZVH 2AJSH 3ARBA 1FZMA 3CDYA 5HHMB 3TT3L 4JM2A 3U83A 2WIIA 4N0YL 3BX7C 5DMJB 4HGWB 3S88L 3DHJA 1K8IA 3E6HB 4O51B 4JAMB 2BVEA 3OG6B 1ZEAH 4Y5YA 1RIUH 5A1AA 4NP4H 1CFNB 1RZJC 2NY4B 1MCSA 2YUVA 4HUVB 3WFHA 1JL8A 4DGYL 3LEYL 4GRMB 3NN8A 3WE6A 4P3CH 5D8JL 4GLRI 4QTIL 4RCAA 1JWUB 1S5HB 2XT1B 3FMGH 5HTSA 1MRCL 2XPGB 1P7QD 1U8QB 1MCDA 3D9AH 2OSLB 3A6OA 1GOFA 1JNJA 3F7QA 2OJEA 2I9LA 5GGSY 5SWQA 3QUZB 5C07A 5F70A 2UUDK 2D31A 3NCJL 1T5XA 2WWMD 5C09D 4JHWH 3OL2A 5B22A 1CDGA 4BQ9A 3FB8A 1UKTA 4PRPD 4M6OL 4QWWD 5C0BA 4S2SA 4OV5B 4PBVC 4POYA 4OQTA 1ZHKB 5GPRA 32C2A 5F89A 1NCCL 1JTPA 4PJHA 2JTDA 3EYFA 5J7CC 4XCEB 4BH7A 1PGRB 5HDLA 3V6ZA 3VXNB 3B9EA 2P5WD 2V2WB 5KSAB 2A77L 2NXYC 3MUY1 3A6CH 4HK0A 1T7YA 2G5BA 1CR9H 1C12A 1VFMA 3C87A 4Z7UF 5IT2L 1OHQA 4HJGA 1OTUD 4WTXA 5KS9F 1YEHH 2ZKHL 4NZDA 4OI7A 3MLWL 4G8GD 2COQA 1WCQA 2DJSA 4PJ9A 3SN6N 5EOQL 4UAOB 2MOVA 2KQNA 2F8XC 5I9QC 5E24E 3B9KB 1AGDA 3HN3A 5D7JA 3EIFA 1DQQA 4MAYA 2J88H 3VFGH 4RGND 1WBYB 1ZLUK 4O2EA 4X4YB 5I2IB 1IGFH 2NY0B 5JNYA 3QDMA 1EEYB 3JV6B 5D8JH 4QTIH 3VWKA 4LARH 3UTTD 3VXMD 3LS4L 4U6YB 4G7VH 3DSFL 1DBBL 1I7UB 4ZUWA 4OUUA 5CMAA 3MOBH 3VXRD 1LP9B 5A2IH 2OMNA 2VLRE 2BMKA 5L88H 4Y16B 5ESVB 5K9QI 3NCJH 5I1AA 5IBUB 1MCOL 3S35X 3V8CA 1QSEB 2P1YA 1OF2B 4XNQB 5EOCH 1I3GL 5DJYB 3GHEH 2NY6B 1MLBB 4PRHA 4JDZB 3ZYZA 1YPZE 4M48L 5IBTH 3QHTC 5IMKA 2XOTA 5ISZB 3SQOH 5F3BA 2Y36H 1N3NB 5HDOA 4U1MB 4OZGB 1QG3A 1NEZA 3M1BB 1KULA 4KPHH 4PGEA 3MRNB 5MEND 4NZUL 3BKYL 2ARWA 5F7YC 2YZ1A 4PRDB 2J2ZA 4PBXA 4Z7NF 4PG9A 5INDA 3BZEA 1RUQL 2HTKD 2VLRA 1EA9C 5JORB 4ZFZA 4UTBH 1JRHL 2YKLL 1BP3B 3U6RB 3KYKH 4OD3L 1ND0A 4Z18A 1T2XA 4MHHI 5DURB 3M8OH 4S1QL 3TBYB 3TFKA 4F33A 3QJHB 3ARDA 3PWUA 3V52H 1UWEH 1AC0A 1RUKL 2EO1A 2BCKA 5BV7B 4ODSH 3MQIA 1BQHA 1FFNA 1I7TA 2ZG1A 3VFVA 3K8KA 5J1AA 3X13B 4XH2B 3O2WL 2MCPL 2R0KL 1B6DA 5DD5H 5ICYB 1GC1L 3KXFD 1CBVH 2P7TB 3ALPA 2QQKL 5I1CL 4K55A 1G0XA 1W72A 2IAMA 4NNXB 4HBQA 4HLZG 4M7ZB 3V4VH 1S7WB 3NABL 1OY3B 3P4MA 1JPFA 3N85L 1JHTA 3O3BB 1F3JB 4GRWH 1JHLL 4KK8D 4U33A 4AL8L 1E6OL 1WGOA 3CFBB 4TUKL 3BP4A 3VXQA 4M03A 3S34H 1J9CT 2VN4A 4Y4HD 3V4UH 4X6DA 4JEGB 4OIAA 3KG5A 3TWCL 3HA0A 2CKBH 4PB9L 1MFEL 3VXUE 12E8L 2H32H 4K9EH 4LASL 3FQTA 3SY0A 1EV2E 1LQSR 5GISL 4HLJA 4L1DA 2V2XA 3E6FA 5AYUH 4L8SA 3GZKA 3VMOA 1EMTL 1I9JL 3MMEA 5EBLB 1ES0B 3MPCA 4Z76B 3L3KB 3MNZA 1UA6H 3SDXA 3TIEB 1WSST 2AK1H 2X6MA 5AZ2H 3WNPA 2OTWA 2JJWA 4NQXA 1LP9F 2VAAB 2MQCA 3BI9X 4X4XA 3IXAB 3N1PC 4FP8H 1OAKL 3RHWK 4UT9H 4UZGA 4I13B 4U1HA 1YMMD 2EH7L 3I85A 4C56E 4YHMH 2PO6A 3ZHLA 5CJOL 3VXUA 5IB1B 1M6OA 1G9MC 2D2OA 2QEJA 3KPMA 2OZ4H 1FDLH 4P3WA 3OHXA 1FFOA 4TSAH 2X89D 3OTTA 3O4LB 1J10A 1OD7A 4JN1H 4LSPL 4KTDL 4YGAB 2AEWA 1KJ2A 1GC1C 3SE8H 2HKHH 1KGCD 2NY3D 4PP8C 1DBKH 1XZ0B 5GS0H 4ODVL 1T7XA 4HT1L 1NSNL 4R0LA 1ZHBB 1OQXA 4YQXH 4LDLB 3C6LA 1FRGH 1UT9A 5IUSA 2NY3B 1VSCA 5AG8A 1QOKA 5F7FA 4PJCA 2IMMA 1T03L 1SVZA 4HIEB 6FABL 5L8LB 3GM8A 1Q0XL 4AQ1B 5DJCB 5EG6C 3AY4C 3V7AE 1X5ZA 1DQMH 4YBQC 3QO0B 1NGZA 4TUKH 5EC1B 1AXTL 3MLYH 2VDRH 3LS5H 3DROB 1P6FA 1YUHA 3B6SB 1V7NH 2VR9A 2VDOH 1K85A 1EIBA 2DD8H 5JW4R 4D3CL 1G0YR 3B9AA 4WU5B 3MRKB 1A9BB 4HWBL 5CJQH 1HSAA 1DQLH 3BQUC 5GXBB 5L6YL 3BUTA 5T3XD 3P73B 3MRGA 4NKMB 4L5FH 5IBLC 5ICZB 3CUPB 5T5NF 5BRZA 4JQXA 1I4FA 2H2SD 1D5XB 3AXLA 4I3RH 1CU4L 2XN9A 3NPSB 1MH5B 5C71A 4OGXL 1KCUH 3PIQB 4HK3N 2I60L 1OW0C 4PG2C 1ZSDA 4Q7DA 1R5IA 3FTGB 2NW2A 2BNQB 5EIIA 3RVVD 3EJZC 2MHAA 2YUXA 4P2QE 3QYCA 4WW2F 3BN9C 3T0EC 2VLLA 4QY8A 4NWUL 4P2RE 2Z9TA 4EI5C 1CL7L 1G7LB 1UZ8B 4H1LB 1DCLA 4MCYA 1EHLH 3O9WD 3QI9A 3PNWB 2CIIA 3MBXH 1DVFA 1QO3A 1BVKB 3GM0A 3QCUH 3ZKQD 3RFZC 1XIWC 3VCLA 2YC1B 3JWNC 4DW2L 4PREB 1KCSH 4NCC1 2R1XA 4R90H 5AWNH 4P3DA 1IL1A 1IT9H 3R06B 4N0FB 1R5VA 1RPQA 1OGTB 4P2QA 3QXDA 3D0LA 1TQCB 4XC1L 3NMEA 4KWUA 5C3TA 3Q1SL 4P2RA 4F57L 5I1HH 3QWRD 2OMBA 1KEGL 2MWCA 5EBWA 1WBXB 2OQJB 3FQNB 5E8OB 4M8QB 4WWKC 4OQTL 2VDML 2AQ3A 4F7MA 4W6WB 3C5ZC 4PY7A 1KJMA 4FG6C 4AENA 5DEFB 3E8UH 1V3JA 2VZ3A 3VGFA 3OKEB 1NKOA 3CZFB 3QEUA 4OD1H 3SCMC 5L9DL 4OF8A 1G7QA 4NKIL 2GJZA 2GAZB 5DA0B 4G9FE 2WAHA 3ULUE 4LFHG 3RKPA 3U9UA 3NA9H 2ORBL 1H3UA 4MQXC 5DK0A 4LCUB 1CLYL 4Z7OF 3DI2B 3L95A 2E7LE 3HZYA 4XNMB 4MJIE 4LKCB 1QHPA 4Y5YC 4MVBA 4JO2L 3QFDB 3GJEB 4MQTB 2NX5A 4RGOH 4NN7B 2GJ6B 1U2HA 4NQDD 3BPCA 4KROC 2NXZB 1F11B 3GJFB 5E08L 2W65B 5KW9L 1UVQB 5K59F 1U8LB 3PWLB 5IFAL 1MFAH 1KPUA 3RVUD 3FO0L 1YEEL 5F88A 4B7IA 1X4ZA 5GSRB 5J6HB 5ESAB 2KZWA 3ZE2F 5E8EA 1LO0L 4MJIA 3U48A 4WDIA 1K4CB 4EI6B 3SGDI 5FGCB 2V2TB 1L0XA 4HH8A 5IB4A 2K9UA 3F8UB 4KTYA 4OLYL 5HYJA 5CINL 5AAWA 5TE4H 2V5RA 3IAQA 2A1WH 4J3VA 3TO2B 3O2DH 2CGRH 2B1AH 1JF1B 4XXCC 5GRYA 1H3PH 3W9EB 2A38A 2R0LL 3DX8A 1TVBA 4PJBF 3TJHC 4ZTOH 2X4RA 1CK0L 5JXED 2D0GA 2PR4H 3EOTL 2HRLA 3L5WB 4KVNH 5BOZG 1MHEB 4PJXF 5DD0L 5T1KA 1E0OB 4B41A 2ENSA 3N1FC 4NUJA 4DKFL 2X4OA 4I18A 4PJ9C 3H9SE 4U1KA 3VD3A 1Z9OA 1B4JL 4S10A 4GAGH 5ANME 3QDGE 1RUAL 2F19L 1NFKA 3QFJD 1X5JA 4JE4B 5IQ9B 2J8UF 2XG4A 3PGFL 4HSQA 3T2QA 3ES6A 4UINH 2L4OA 2MTPA 1WIUA 5CSGA 1LDPH 3BZ4B 4NWTL 4UDTB 5I1GH 4Q6IA 1NFIB 4MAYC 5J12C 1HH6B 4U2ZA 2DQHH 5EUOA 1A1MA 1T0MB 1SY6L 3C8KA 3SDCA 4G42A 5C0CD 3KS0J 1AD9B 3AS3A 4TVSa 1UM5L 3D85D 4FQLL 4GQ9L 4JY5H 15C8L 2HFGH 3LSOB 3G6AB 3H9SA 3WEXB 2YPLB 1J05A 3VW3L 1XF1A 2D03L 4OGYH 3VWKC 5F9JA 1JUFA 3GMNB 3T8XA 3U4EB 3PGCB 1DBML 1OB1A 1RJYA 5EU5B 2XICA 5TFSL 1LO3L 3OQ3B 4BA8A 2YA2A 5A16B 2ZCHL 2WM0A 3WD5H 2ZUSA 3TV3H 1DQJB 1CWVA 2WK2A 4HEPG 4NZTH 2R8SL 4ALAH 1OQOA 2VLKD 4Z6AT 2IPUG 2QSCL 2XV6B 3TPUE 1D3CA 4LLAA 5DWUL 5F9DC 1MCFA 4RFOH 1CDUA 1QKZH 4NRZA 4GLRH 4Y19E 2DIBA 5I18L 3VRIA 4EDWH 5FUCE 1I1AA 1Q72H 3O6ML 4M9PA 1CK0H 3GSNA 3DV4A 3ARGD 5JW4M 3RWFB 3V4PL 5E00B 3ZYIA 1YEIH 4N0CD 1U3JA 3D48R 4UT6L 3GIZL 3ZE0E 1TMCA 1EFXA 4I48A 4Y4KA 1FYTD 2IEPA 2J12B 5DJ8A 3GKZA 3ARDC 3MJ9A 1ZGLM 4RWYH 1A6AB 4RISH 4ZOAA 4JFOA 3QDJD 1G6VK 2F19H 2ZCKL 4D9QD 2YD7A 1RD6A 1T1ZA 1F3DH 1H0DB 4Y19A 2EEBA 2CUHA 3X3FH 3DIFB 1CG9A 2DWDA 5T3ZD 3DO7A 4N68A 4O5LL 1M1SA 1SM3L 5FO8B 1JI2A 1KJ2L 3R4DA 4KXZH 3QIWD 4JY6B 5FDYA 4APQA 1IGJA 5KSVA 1SY6H 2C4FU 3BE1L 4MJ2A 4PJFE 1X7QB 1IM3B 2IAMC 1GHFH 4YDJA 1ZLVK 2R69H 5DXWA 2HFFB 4P9ML 1ZOXA 5ALBH 1P84J 1T1YB 1CLOH 1LE9B 4HPOH 4F7TB 2VH5L 4UNVA 1FIGH 4ZUSB 3B5GA 1U42A 2CPCA 3QPXL 4XMPL 4MD5B 2IH1B 1CXHA 2ESVD 1F6FB 5B39G 2XKSA 4POUB 2ZCHH 3L3GA 4DJMA 5DMYA 1DLFL 3RI5F 1BFVL 4PJFA 2DQUH 4V2BA 1Q9OA 5T1MB 3MRMB 4L8SC 3C9NB 5DC0A 2W60B 4KKAC 3ESUF 3FOLB 1VADA 3O4OC 1IGIH 2ERJC 3O0RH 3RWEA 3BIBX 2D0FA 1FO0B 3I50H 3TBWA 3MXVL 5AG9A 3LKQB 1TCRB 4KRPD 1GZPA 2GSGA 2O5YH 2FHCA 1J87A 3CLFL 3V4PH 4RMSA 2V7NA 4ZXBA 4JFDE 1X44A 2IPTH 2NXYD 2PO6C 4OJFH 2HMID 1RVFL 2Y5EA 3L3IA 4XC3L 2RIKA 3LIZH 4FQXA 2JELH 4OAWB 2F5BH 1LK2A 2UZXB 3X11A 2GCYA 4FTVE 1EEQA 1U8IB 5GQBA 1YN7A 3GHBH 5CUSL 1O7SA 4QHMB 2LFGA 4HX1B 4WVRA 2WMPA 4ZDHA 3G08B 5J9PA 3ABZA 5CIPA 2AABH 2ZUVA 3V6OE 3VGAC 4H26A 3GMRB 2VLMD 3C6LC 3UP1A 2DM3A 2X7LB 3GMMB 5AEAA 2W9DL 1UM6H 1R5WA 2F8OA 5DLMH 1GXEA 4P9MH 3GB7A 5I9QB 1Z5LB 2Z91A 3CC5B 3FB7A 1IVLA 3QSKB 3O3AB 3QG7H 4M93C 1JYWA 3W2DL 2Z4QB 4PJIB 4R4BB 4BQ8A 5I8OH 3X12A 4ISVB 3FFCB 2ZZUT 4QKXB 1LO5A 4N5ED 3CFDA 2WLZA 2AEQL 3RPIB 3VFNB 2CLVB 1IC7L 1GGCH 4WV1C 4ZUVA 4JFHE 1MIMH 4Z5RB 2F53D 4UV7H 3LQMA 4QHKI 3TYGH 1TVHA 4L4VE 1KB9J 5KN5B 5EZJA 1F90H 5CSZB 2HJFA 4H1LH 4TQEH 5FV1L 4YHKL 1FNFA 1WK0A 4ZODA 3WXVL 4X9HA 5IVXA 2ADJB 1T1XB 1ZHLB 2OR8A 5AD0B 2BY0A 3CFJA 4JQXC 3TF7A 4X6BA 3RKDD 1KXTB 2F53B 4WEMB 4YBLC 3G5YB 1BBJB 3VJ6A 5IMOB 5D1QA 4P5KA 1NJ9A 3RA7H 2ITCA 1J5OL 5ESQB 1M7IB 4JO4H 4NYLA 1SQ2N 3G6JE 5FXCH 1OGAB 3VFMA 4WCYH 5K33A 4JQVA 3QHZH 1KCVH 5LBSH 5CD5D 2BVOA 3X17A 1L4IA 1QBLH 2AK4E 1J18A 4CAGA 4LNRA 5L8KB 3QI9C 3SEPA 4Z78A 3VRJB 1O7VA 1FL5B 1DVFC 4QRRB 4CU8A 1F8TH 4LHUB 4NHUB 3TBSB 2DKUA 3NCMA 3L5IA 4LEOA 5I1DB 2P8PB 4FQJL 3MV9D 1QFWM 3QWOA 4Q9RL 3GIVB 1EPFA 4F3FA 4PJEE 2DI7A 5IFHH 1S7RA 5IGXH 3DX7B 1P7KA 1WWWX 5FUZL 2Z93B 4LLVB 4YDIL 4M61B 2YK1H 4HKXB 5DJAA 3WIHH 5BCAA 1EJ6A 4AK1A 5ILTL 1AD0B 1H3GA 3O8XB 2YR3A 4FQQB 2NZIA 3O6KL 3BZDA 3ORJA 3FT3A 3DRQA 3EZ8A 3WFDH 3RVWC 1B0GA 3CLEL 5BOPA 5E6IA 5JDSB 1ZT1B 1BF2A 3MV7B 2DYPB 4PJEA 5I74C 3I75B 4GFTB 5FM5M 3R8QA 4NNYB 3VFRB 5T33H 1HDMB 1MCRA 3GSVB 2CRYA 2SEBA 3OX8A 3WFEL 5BJTB 1IC5H 2RFXB 1HXYB 2VWEC 1JHKL 3P0GB 2ATKA 4JY4A 4OZHA 5JW5A 2X4PA 4IRJA 2Q1EA 3ZKMC 4JRWA 5E4EC 1J5OH 2Y72A 3ARFD 3ARUA 2FJFB 3RBGA 3MLSL 4CADB 3U0WL 3HG1E 5IB3A 5E9DB 5GS0D 2EC9T 3W9DB 3P0VH 1IAOB 2XA3A 4OFIA 1Q94B 5FA4B 1IARB 3S96A 3NZ8A 2DDQH 4GBXA 4Z7WE 1UM4L 3D39E 5EO1A 5EU4B 2D7TH 1RK0A 3ULUC 4KY1H 1YN6B 3KYOB 2VISA 5FYLL 3B8YA 1JV5A 2VLJE 3WNMA 1S78C 3D3VE 3WO3B 2GTWA 3KJ6H 1UACH 4ORZC 3UJTL 2P8LA 3WLWD 1RUPH 3TH3T 1R3KA 5KJRH 5D72L 4K7PH 4U7SA 1NGXB 1CD8A 5D1XD 2VRAA 3FN0L 2NR6C 2DQFB 5H35B 1A4JB 5C0AB 2AS5M 4FZ8L 2GSIB 3P3YA 3T4YA 5TDNA 3S98A 4LGRB 4WI6A 3QH3B 2VJXA 3MACL 4YR6A 3QUKA 1NBYA 4WO4A 1QFUH 1ZA3B 2LVEA 2W59A 3A6BL 1MJ7H 5JLZA 1T21B 3EYOB 2OXGA 1HEZB 4LBEB 4Z95L 3ULSB 2P48B 3QUML 4JZNB 4A6YA 3VFOB 43C9A 2X4QA 4NSKB 5SWZE 5A3IC 5GZND 3D3VA 2EIDA 5GHWL 3LRSA 2VDQL 4HUKB 4N8CL 5H37H 3OPZH 2VIRA 3GSNL 3RPKA 2R9HC 4I18C 1V05A 5I8EB 2Q7YB 1WZKA 4PV8B 3V5KA 4JRXA 1IM9D 5IESH 3RWHB 2I26N 3Q3GA 4OLZL 5L2KB 1KN2L 3EYSH 3QZWB 5D5ME 2VSCA 5D2LA 3MJ9L 4Q6IC 3BQUB 5ELIA 4XTRC 5I17B 1NC4B 1PZUB 1F5WA 4K94L 3RWJA 1YDPB 3RWCA 2RCSL 4EN3D 5GS1A 4QOKA 3GSXB 5FYKL 4NN6C 1BREA 2W1NA 9CGTA 4L3EA 3BZFB 2W0KA 4O2CA 2UWEA 4JFEB 2E7CA 2R0WH 2P8MA 3T0ED 1JK8A 2DBLL 3B5HA 2BVPB 1U3HA 2PTUA 3MLZH 4PLJD 5GGVY 5GJSH 3FQWA 5EOTB 4L4TA 3MRFA 2C26A 2H26B 4Z0BL 1WICA 1MLCA 3T0EB 2VXTL 2HN7A 3Q6FB 4EI5B 1EK3A 5F9AC 1G7MB 3KPRB 5CLWA 4EVNB 4FZ8H 1J12A 2C3VB 2FSEA 1JNLL 3EFFA 3GFUA 5F7DA 1F00I 5SV4A 5D1ZD 2DS4A 5FB8B 3O2VH 1E27B 1YEDA 1IC4H 4ZUTB 4LPCA 1XIWB 4CN1A 3PP4L 1I1AC 1T4KB 3OJDB 3EOBB 3QUMH 3CDGA 1EEZB 4L9DA 3BDYL 2R1YA 3MREA 5GSVB 4YXHH 5LGKA 3C09C 4FXKB 4WWKD 4AT6B 4PP1D 4AEIH 1W0VA 3REWB 1JNHA 1MI5E 4BJLA 3IT8D 4BYHA 2WINB 4NO3A 4Y4KC 5JHDA 2LQRA 2DICA 4ZOCA 3RVXD 3MJGX 4I5BB 3GRWA 3KPSE 5LCVL 4WWKB 3GKWL 3PWPE 4H0IA 3C5ZB 1RZJH 2X4TA 2UVFA 3ARBD 1XR9A 4JDVB 4HC1H 1TCMA 3E2HA 3IVKB 2YRPA 1AO7B 4L3AA 1AFVH 4XP9H 4JM2D 1B9ZA 1PZ5A 4NQCE 1JF5A 4KJPC 1T04B 1UQSB 1HKLH 5DVNA 4APQC 3SKJH 3NFSH 1ETZA 3SCMB 3CD4A 2GKIA 5DQJA 1FZMB 1NCDL 4PJAA 3DHMA 4DUVA 5KANG 3B2UC 1FO0H 2WIIB 4GQPH 1CDBA 3AU1B 3EDFA 3UCRA 2ICEB 4DCQB 3KPSA 1K8IB 1KNOB 4WHCA 5B39A 2CMRL 4XAKD 1D9KA 4GRLA 1BMGA 2P5EB 4DKEL 2OX5A 3N50A 3BEVA 1G7IA 1KPRB 4NQCA 3A67H 2E9JA 4KROB 4PRIE 3L3DB 5C07D 4U6HA 25C8L 3WE6B 1FGVL 4JG1H 3NGBC 4G7YH 2ARJQ 4P4KC 5F96H 4FFZL 5HDQL 3IS0X 4BSWA 2DQEL 3BN3B 2R1WA 4BZ1H 4F7PA 1MRDH 4MA7H 3MOAL 1V3MA 4NQUA 2OJEB 2I9LB 3HI1A 1RHHA 4JKKA 1T5XB 3LKSA 3DTXB 1T2QL 2RGSA 3QDAA 5T1LA 3AS0A 1WAAF 4HMEA 4V3DB 2J6EH 3SJVA 5B4MC 1S9VA 4PJ8B 3BH9B 3B4NA 4P49A 3H8NA 4YO0A 5C0BB 4PRIA 4S2SB 1REIA 3S35L 2R0ZH 1JVKA 1MCNA 3FN9A 4R2GD 3JWOH 4M3JA 3U7YL 3AAZB 4IDLA 2BSRA 4FQXC 4O9HH 5JUEL 32C2B 5F89B 4M6ML 5ID1A 1KCLA 3IFLL 1SMOA 5T1DH 4U31A 4BH7B 3STLB 4WJ5A 3P40A 4KDTC 1I9IH 4AH2A 4HK0B 1HIMH 4WHTA 3VE0A 1FH5L 4DN3H 3JV4A 1D5IL 1C12B 3LQAL 1KIRA 4NQEA 5E1HB 1GGBH 5DMGC 1UENA 4TNWF 4K71C 4LLMA 1QTYT 5HI4C 5D7JD 4YHLH 4PJ9B 1OWRM 2UVEA 4P4RA 1TPXC 3QG6B 1EEUA 3EYVA 1DFBL 1EJOL 5I30L 1ADQH 2GK0A 5BQ7A 3BKCH 2BERA 2F54E 4TTGA 2R2EA 4XHJD 1AGDB 3QIBA 5LXGL 3QDMD 4HG4K 3SOBH 1FL3A 4TOYL 1DQQB 4MAYB 3VWKD 5J12B 3ZHDA 4KK9D 3VXSD 4AEFA 1W0WA 1ZWIA 4O2EB 1MWAA 3T1FA 5FYJE 3EJYC 3HPLB 4LEXH 4PYHA 5JNYB 2GYSA 4U1LA 4XX1G 3WDIA 5DHXB 5HY9A 4U1IA 1A7OL 2GJJA 5HDBF 1KEMH 3BIKA 4FFZH 1T6WA 5D2NE 4JM2F 4G59A 3JZ7A 1CGXA 2DQEH 1KYOJ 2EIZB 4PRHD 4OUUB 5IMLA 3O41A 1EXUA 2EIEA 1CFQA 3EW3B 2BMKB 1JZ2A 3BISA 4FXGB 3MRHA 4QRSA 5I1AB 1VACB 4XPBL 1MRFL 1Q0YL 2V7HA 5FKAB 1ACZA 5MEPA 1QRNE 1TIUA 2BOCA 3DX9B 4UIMA 2XWTA 1TTGA 4LCWD 5HYEA 1H15A 1UXWB 5GGUA 5CD3B 1AI1L 1BZ9B 3CK0H 3E3QE 5IMKB 1KCRH 3HS0B 3UYRL 3EOAB 5F3BB 3MA9H 4J1UA 3LQAC 1FJ1A 4JQVC 3VD9A 4PGEB 5IFJB 1HHJA 3TFKD 3GUTA 1NCAH 1BJ8A 3OJ2C 4PG9B 3BZEB 2VLRB 3FFDA 1VFAA 3CXDH 3NIDF 4ZFZB 1IGMH 4D0DA 4RDQG 3CH8A 1ACYL 1QFWH 4ERSH 4JPWH 1QRNA 5EPMB 1NDMA 3ARDB 3NCBB 3PWUB 2YPVL 3SPVA 4PJHF 2BCKB 4XZUA 5IW6A 3Q2CA 2W91A 3CDCA 2IAMD 4J3OC 2OM5A 2B4CL 1BQHB 1FFNB 3REVA 2FRGP 4M7LT 5EU6E 1I7TB 4M1CD 3VFVB 2ZPKL 3IJYA 1CE1H 4UT7L 4DTGH 4TOYH 5E0QA 2PYEE 1AR1D 4FQHA 4UQ2B 4C4KT 1JNNH 1WFOA 4M5ZL 1W72B 1ONQA 2IAMB 1OCWH 1IRAY 1A47A 3D2UB 1X5GA 3N1MC 4XP5L 3GI8H 3KS0H 5JQHC 3P4MB 5C2UB 1JPFB 5FV2A 3WJJA 5E6IC 3MUZ1 4X6EA 4KUCD 2DQCL 4X6CE 1CFBA 1FBIH 3BP4B 4C57C 1ZKAA 2Y6SD 4A6YL 3ULVH 4CVUA 3WXWH 2I24N 4X6DB 3WCYA 4EXPX 3R1GL 1E4XI 4X80L 1Z9SA 3PJSA 2DLHA 4TTDD 2VERN 2Q8BH 5JXAL 2DIAA 3FQTB 3SY0B 3MRIA 5JW3H 5IHUH 3MA7A 3HMXH 4L8SB 1FN4A 1A6WL 3MMEB 3OSKA 1FVEB 3O4OB 3OJVC 4NPYA 4HWNA 5EA0H 2ERJB 2PO6D 2YD4A 2HP4A 4DGVL 3RWGA 3MLUH 4X6CA 1SJHB 1I1FB 2PTTA 4NQXB 5HHOE 1KBGL 1QUNA 4JVUA 3S3SA 4U1HB 3PWNA 4OT1H 1J0IA 3VXUB 3BO8B 3ETBF 1RI8A 3KPMB 2HT3C 5HVFB 1J8HA 4QYOA 5ACMA 1CT8A 2YSSA 5C08A 2O5XL 1ZT4A 4PJGA 4K3DL 4ZO8A 3V5DB 1FZJB 2HT4D 2AJZA 1NMBH 4JJHA 2YPKA 2B4CH 4UV4L 3T2OA 4OSUH 5HHOA 3OKKA 3U2SB 4JDTL 2BY2A 3VGAB 3UZVB 4K8RH 4EUPA 4YXLH 2A2QT 1F4YH 1S7XA 3C6LB 4ODWB 5FOJA 3UTPD 3DNKA 3TO4C 3GI9L 1T20B 1NGPH 5FA3A 4DOHE 3BWAA 1NFDA 1UCTA 3MLVH 4QT5A 4R8WH 4M93B 1CDIA 3LQZB 4JRYE 3VRLE 4OZFB 2G75B 2VITA 3WYRA 2Z8SA 4AIXA 4A6YH 4C58B 1HILB 1S7QB 1YUHB 4TVPL 5C86A 4X80H 4KAQH 5KANI 4WV1B 3FONB 2ICWI 1OSPL 3AM8C 5B3JF 3TEUA 2HJLA 3DV6A 3FO9A 3L6FB 1JI1A 3U46A 1QEWA 2VDPL 1NCWL 3GRWL 3BIAX 3H6JA 3UJIH 1ORSB 3T2NH 3H7BA 2H9GB 4ZS7H 3MRGB 5DHVA 5GS1C 3FQXA 4JRYA 3RDTC 4X6DF 5BRZB 1P9MA 4E0RB 3LOWA 1I4FB 5FUOH 1G7JA 3AXLB 1KJ3L 2XN9B 3O81A 2LU3A 4YBLB 5E5MB 4CN6A 3T09A 1HZHH 3D69A 5GRJH 3RL2A 4HXAH 4KUCF 5MERA 2BSTA 2WBJA 1WEJH 2PW2B 4LSUL 1U3HC 1ZSDB 5HHVL 5FM5O 5FECB 5EIIB 5IK3A 1I8KA 2MHAB 1H3TA 5K9OA 1KIPA 3RWDA 3SDXF 5DUBA 1TTFA 1QSFE 3G04A 2VLLB 3QNXB 3NCCB 2FX9L 4QY8B 4KMLB 2FD6L 3G5XA 3BP5A 4R7NB 4NOBA 5DK2B 4MCYB 4HAFA 1F4WL 4Z7UE 3S5LB 3M17A 3QI9B 4JFYB 4ONFL 5LQBL 2CIIB 5C7XH 1WIPA 4JDTH 1DVFB 3C08H 3BH8B 4M7KH 4EOWL 3LKOA 3VD4A 1YEGH 2AV1A 5CLTA 2WP3O 3CU7A 2JKXA 4GAJH 5MP6H 5BS0A 1MFBL 1NC2A 1I8LA 2A6DB 1IL1B 5IG7A 3FZUD 2E8YA 3L9RA 4LIQE 4JLRA 4P2QB 3QXDB 2K1MA 3BKJL 3RVWD 1CXEA 3HI6H 4U1JB 2BXZA 5ALCL 4P2RB 3IXTB 4JM4H 4ELKA 3AREA 1S7TA 4Z7UA 4F37F 2F74A 5E7BA 5EBWB 4HUXB 2DQTL 1ZGLP 3QEQA 4DN4H 1G1YA 2H1PL 1MFDL 5SV3A 1FPTL 4M5YL 5DZLA 4PJCF 3E2HC 3MO1B 4PY7B 1KJMB 2NTFA 3O3EB 3TN0C 1MCEA 1UB6B 2BP3A 4TSBH 1A9EB 2N7BA 3S36H 1A5FH 3KDMB 1C1EH 1HSBB 5I74B 2O5ZH 3UROR 5HSFA 2B1HL 43CAA 4LMQE 4MXQC 1DBJH 1G7QB 1KB5H 3WS6C 2GJZB 1EO8H 4OKVA 3RY6A 4MVBD 2LV4A 2H2PC 4IOIB 4J8RA 2ICWA 4KVCH 2DIJA 3S4SB 3F5WB 5E2JA 5I73C 1DQDL 2Y06L 3HZYB 5E4EB 3W0WA 1C5BL 2HTLC 5GRVL 5C0FB 5DSCA 5B3NA 4XBPA 1D9KC 4GRLC 1SBBA 4KGJA 2FBJH 2NX5B 3DETD 1KTDA 1UKSA 5J13B 4AEHH 1X5KA 5JOFB 5K9KA 2APWA 4XCCH 5D7LA 3NZHL 3IGAA 1JGLH 3ZTJG 4Z7NE 1XR8A 3P11H 3PP3H 3HMWH 1NCBH 4G9FB 4ZO9A 1MWAL 5HYJD 4PP2A 4ODHL 1KPUB 3MODH 2X70A 4LOUC 2HRPL 4QXTA 4QHLA 3F58L 3BXNA 4O2FA 1R0AH 1FCGA 1VERA 1YY8A 4MJIB 4WDIB 4URTB 2NW3A 4M7LH 5IB4B 3UTZB 1N5AA 1MCWM 4P59L 4E41A 5B38B 4X7EC 1H8OA 4XCNA 1LEIB 1NAMH 5T1KD 3DX8B 4XNYL 1IAKA 4HJ0C 1P7QA 1PG7L 2AXGA 2DQTH 2R9HD 2X4RB 2P5WE 4GMSL 3FB5A 1OOAA 5I66A 4MGXA 2MPAL 5F3HA 5C09A 5I1EL 5TDPB 5DJ6B 5H94A 3FRUA 1DDHA 5T1KB 1Y6NR 2VYRE 5FYKU 4G8GE 2X4OB 4I18B 1D5ZA 4MS8C 2C3XA 1VESA 4ZOBA 4PRPA 5DT1L 1LEKA 1CIUA 4RFEA 1QZ1A 3SDCD 3QEGH 4I0KA 4XWGH 2BJMH 3U30C 4OIIL 2R23B 2NTSP 2CJUH 3H42H 2VXUL 5FYLD 3QIBC 2P5WA 4Q6IB 5C0EB 1SHMA 5FO9A 2ZSVA 1A1MB 4G42B 1YYML 4H8WL 5IOPB 3DUSA 4YX2L 4FABH 2QQLH 5HI3C 4FFEX 1YNKL 3RUGA 1LP9E 4RX4A 4DZBA 3H9SB 2A83A 1KCKA 1A0QH 1J05B 3HRPA 2CO7B 5F9JB 2BDNH 3QDGB 3CIQA 4M43H 2EDBA 4MNQA 1RJYB 1JYNA 4XVSH 3OZ9H 3U9PL 2Q86A 2VDNH 1A3LH 1F42A 1N6QH 4XVJL 5K9JL 3NACL 2A9ML 4D8PB 2X41A 2B7DT 1CFVL 5IMMA 4JR9H 4LL9A 4ODTH 5DYOB 3WIIH 1Q9KB 4NRYA 3UTTA 4NRZB 3VXMA 3OKYA 5JHLL 5KVGH 4Y4KD 4HXBH 3VRIB 3FOMA 1I1AB 3GSNB 3DV4B 3VXRA 3I3DA 1JGEA 5AYQA 1J0YA 2H6PA 3C09B 3IJSA 3HE7D 5C6TH 3UC0H 4A2LA 1MOEA 1TMCB 3PGDA 3WDHA 1EFXB 5FYKD 1CGVA 2FGZA 1KPVA 1RZGA 4KJPD 3E3QC 4OCNC 4PRBB 4X7TA 5J8OA 3PABA 4XPGL 3IFOB 4U4BA 4OIIH 3RZCA 2WBKA 2JIXD 1T1ZB 4K2UL 4Y19B 4WHDA 2DWDB 2FEDD 4V1DA 4NO2A 3DO7B 5MENA 3IFPA 3WUWG 2NY2B 3ZSSA 3LN9A 2EC9U 3EHBD 1UXSB 5ETUB 2HFTA 3KXFE 4APQB 5F7EH 3WSQL 5KSVB 1IGJB 1RZIA 5HJ3B 5CCKH 5IB2B 4PYGA 4C4KO 1KFAL 1NGQL 5I6XC 4PJ7A 1UCBL 5DD1L 1N64L 2ZUXA 2EE2A 1T83A 4OBRA 2G5RA 3FQRB 2VMFA 3B2VH 3VG0H 1JZ6A 2ED8A 1I85A 2C3HA 2XWBA 2LU7A 2UZYB 5EUOF 3L3GB 3HFML 2CIKA 4EDXB 5EWIL 4CKVX 4HMDA 1P53A 4PJFB 4LCCA 4P4KB 2DQGH 2DLFH 4YE4H 3K8MA 3QCVH 1ZS8A 4RQQB 1CVSC 4ZXBD 2VZOA 3VA2C 1FNEA 3BSZH 3MYJA 2Q6WB 1L7IL 1HI6A 1OT2A 4I0CC 4PGJA 3PDOB 4H5SA 4UDUA 1JFQL 3FO2A 3TBWB 4FQXD 3UBXI 1GZPB 4RMQA 4J7RA 1LWRA 2VDLL 4Y4HA 1MHPH 1I75A 5C6WH 2V7NB 3EO0A 1YMME 1E4XL 1FG2A 5ACZA 4XWOC 2K3TA 3OR7A 3NCYP 1ROWA 4LLQB 4LLYB 4QXUH 2EDKA 5DMGD 4MA3B 1LK2B 1I7ZA 4OZFH 4Q0XL 4BSVB 2GCYB 2AGJH 4XPGH 1YN7B 2BY3A 2APTA 3W5MA 4BH8A 1KGCE 1LQVA 2E5EA 4HPYL 3X14B 4FQIH 2B20A 4HULB 4WUUA 5J9PB 1GAFH 5CIPB 5E2VH 1HXMA 4H26B 3PHSA 4K71B 2IBGA 4MSWB 4GKZA 3BP7A 4BM7A 1YMMA 4HUNB 1K4DA 4JO1H 1QQDA 4GKNB 4NM8L 4KI5C 1TPXB 1KFAH 3MOQA 1R5WB 1FAIH 1A6UL 4OF7A 2X89A 5F7LB 3RJQB 2Z91B 1NBZA 5I0DA 3PL6C 4Z7OE 3SO3C 1KXVC 1UFUA 1G1CA 2EYSA 3CVHA 1XMWA 3BRFA 4PR5B 1NGWA 1LO5B 1QR4A 4LLDA 3CFDB 5HHQA 4ZUVB 4LSTH 3I02A 2FL5A 2WUCH 2Z31A 5SX4H 4L8BA 1TVHB 5K59E 4AZ8A 4CW1A 5EZJB 2E6JA 5D1QD 3P4NA 3IU3A 2HJFB 2JLLA 4U1NA 2V5SA 5I1IL 2EE9A 4FQ1H 1P9MC 1PFCA 3ZE2E 1MAML 4X6BB 2EEDA 4AYFA 4OM0L 1NBQA 3RAJH 1QBBA 3HCVA 3CFKA 3VJ6B 5HGBA 4YHYC 5JPNA 4Q9QH 1NJ9B 4KKBC 2CXGA 2WBJC 1A4KB 4NO0D 4PJFF 4MXWL 5CKGA 3U4AA 5C0NC 1JFMA 3SBWA 1JMXA 5BXFB 2X4UB 3F7YB 3FRPG 1INEH 5MEQA 4JQIL 1OM3L 3VFMB 5K93A 5KTEH 3RIAF 5BVPL 4PJBE 2V9TA 1NEUA 3BPNC 3CVIL 3MYZA 1TJGL 2DL2A 2EXYD 4LNRB 1L7TL 4HPYH 5IJVA 4Z78B 5GGRA 5L0QC 1RUML 4PJXE 3PDDA 1MCCA 5FCUL 1VB9A 4WW1A 2IPKB 4YXKL 2XKNA 3VGBA 1HHHA 4X8JB 2DM7A 1M05B 3QWOB 2WANA 3JUYA 1WISA 1I8LC 5JW4N 2CK0L 1YQVL 4D9LL 2J8UE 4IMKA 5AUMA 5I1JH 1U8MA 1YNLH 2ICCA 3ULVD 1VFBB 1CZ8H 2ZJSL 3U0TA 4AM0A 2AK4B 4XGZA 5E6ID 3AREC 3P9WB 3VFPA 3LH2H 4YH6A 3O9WA 4A2MA 3BVNA 1QSVA 4I2XA 5EBMA 4NGHH 2FB4L 4GKOA 3FT3B 3DRQB 2FZ3B 4WFHD 4GXVH 3RTQD 2XI9A 1B0GB 1HCVA 4NO5A 1JPTL 3ZKNC 5E99L 4F9LA 4IRJD 4WU7A 2BNUB 4PJEB 2EXWC 4JANB 5KSBA 4BK4A 2J8UA 3MV8D 1UWGL 4XMKH 5TGBB 3VD5A 1N26A 3ULUH 1B90A 2SEBB 3OX8B 1MIEL 3RY6C 2J8HA 1T89A 3O6LL 3WLBA 2Y5TA 4JY4B 2GJ6E 4HIHB 1EO5A 1X5XA 5EFIA 1C08A 3LB6C 4I0PD 5JW5B 1MCLA 2R15A 5KVEL 4YHIA 4QNPF 2AJUH 3GMQA 3HKFA 4WIQA 4LSSL 5ABDE 4K23L 1HNFA 3RWIA 1HKFA 4F2MB 4GBXD 2MNUA 2IBBA 2J4WL 4LSRH 1OAZL 4PB0H 1RFDL 4J3TA 5LAXA 1WZ1H 5IVXF 5ITBL 1OPGH 4RBPH 1BVZA 3CVIH 3NZ8B 3HPJA 4K8RD 4WFGE 4NQVB 1TZGH 4OFKA 3B3IA 5EO1B 1YJDH 4XPHH 5FGCE 1AR2A 4UBDD 1PLGL 4CL7A 4NFCA 1JV5B 4J3WA 2XFXA 2GTWB 1N6VA 2P8LB 4WO4D 2DWEA 3JSSA 3L5XL 3TJEH 1UYWH 2FO1A 3SDDB 4G6JH 3HG1B 4HZLA 2FBOJ 3IKCA 4DZ8A 4NQDA 4X98A 4ZOEA 4JB9L 3QIUA 4U1GC 1UZ6F 1MVUA 2QV2A 4HIXH 2VXSH 3GMLA 3T0WA 1MNUH 5DTFA 4EXKA 1YNTA 1G7PA 5DD6B 3BGMB 2ZG2A 3QUKB 4Z7WB 3NCFB 3D39B 3DMMA 4YHOH 3TO4B 4RMWA 2JE8A 1FFRA 3F12B 1TJIL 3ZT6A 5JLZB 2DLEA 1AJ7L 4X5WA 5D93C 43C9B 1P1ZB 1SJVA 5CP3A 1HINL 1JP5A 2AQ1A 2I5YL 4JRXD 4KRMB 1R3LA 3D3VB 3RJDA 4YUEL 1K3ZA 4OTXL 3MRDA 2GTZB 3F6IA 3H3PL 1SEQH 3C60D 3CPLA 1I9EA 1MSPA 2BRQA 4ELMA 4KGLA 3QR2A 4QWWC 5E8PA 4YFDB 2V17L 3DGGA 3QFJE 2WQRA 3SE9H 2C3WA 5D7IE 3QXTA 3Q3GB 1Q1JH 3WO4C 3ULVF 3LKPA 5A2FA 2DTMH 4N8VG 1NBVH 5E8NA 4NJAL 5KOVC 3ZKXC 2GY7B 3KPNA 5SWZB 4HCRA 3RWCB 2ZWLT 5C0CE 1YY9C 3EDDA 3LKNA 5GS1B 4QOKB 2XTJD 1OTUC 1K3IA 4MLSA 1XT5A 3RDTB 3T65B 4IHOA 4L4TD 5CEZE 4L3EB 4Z8FH 4FOMA 4MX7A 5JMOC 3DRTA 3UTSA 5BO1H 1NUGA 2P8MB 4LDOB 4X6FA 1JK8B 4H0HB 2HLAA 2IWGA 4OZHF 4YNYA 5TQ0L 2G60H 1GPOH 1U3HB 1IEAA 4LRNL 3QFJA 2OR9H 4LF3B 5D7IA 5JA9A 2AJYH 3FQWB 2BFVH 1NCNA 5EORH 5D5MB 4HF5H 2NY7L 1CXIA 1C7SA 3ZT5A 4U3CA 1MLCB 3ARXA 4RGNC 3ZDYF 2B39A 2HA1A 1PY4A 2VLKE 2HN7B 3G6DH 4CVZB 2CK2A 5DRWA 5F8QC 2YUZA 4WUKH 4KRLB 1R3HB 3P9LB 4TVPD 2FSEB 1MCPL 3EFFB 5F7DB 1DBAH 3NOIA 1XGUA 1M71A 3LVEA 4HDIB 4RA3A 4U1SA 4BUHA 5JHDD 1Z0NA 4OLVL 4PV9A 5AZEH 1E28A 5JPMB 3CDGB 3T77B 1CTOA 2R1YB 3MREB 5DJXB 4ZPVA 2NY5L 2R29L 5JIHA 3MV11 2BXYA 3TBTB 4OTXH 1JNHB 3W11D 4G6MH 5D9SA 2VE6B 2VLKA 7FABH 4NO3B 1S5IH 1ZANL 2O61A 5JHDB 2B0SL 2MKLC 3CH1B 1SVCP 2P49B 1U8JA 4G3YL 3QDJE 3RZCC 1U6AH 4D9QE 5J06A 1QR1A 4P57A 1L9NA 4BKLB 4UTAL 3WUWA 2X4TB 1XR9B 2H2PD 1S7SA 3V7MA 4X5XA 2PXYD 5T3ZE 3TN0B 5F9OL 1NMAL 1PZ5B 1M7XA 3CAFA 4OLWH 2YEZB 1BM3H 1GGUA 3ELAT 3QP3A 5SWSA 4YDLC 1ETZB 2HTLD 4Z7VA 1Z3GH 4N0CA 3F62A 4XCFH 1MI5B 1KC5L 1A3RH 1D9KD 1G7HA 1G9NL 4GRLD 5DQJB 2APVA 1FYTA 1LO2L 2YXFA 4LSDA 3BPOC 4PJAB 1HOCA 1T83C 5C6PB 3CU1A 2XZQL 3KPSB 5I73B 1EDQA 3QDJA 3LMJH 5B39B 3JV5A 2J1KA 5D2LF 3VDBA 2UY7A 2BRRH 2HKFL 2ESVE 1I85C 2XRAL 1QYGH 4KKCD 3BEVB 1ZA6B 5BVJA 5CEYA 1G7IB 4NQCB 2KZ1B 5I76A 3OKMA 4U6HB 4LNVA 3IDIA 4DQOH 4YZFF 5KBNC 3MRBA 3CVHL 1NGYA 1LNUA 2UWEF 4WTWA 2PNDA 4KK5C 1BGXL 5IIEA 3SJVD 2R1WB 1W8NA 1K8DA 4HIJB 3UMTA 3L5JA 3DYOA 2NY5C 4KK8C 1KELL 1RHHB 1FFPA 2D7MA 4KZDH 4V2CB 3QCTH 4EKXA 4NOFA 1XF4A 1MJJA 4HS3A 2E7BA 2ESVA 5T1LB 3SHSA 4AJ0A 4Y4HC 1A7QL 1S9VB 2YHGA 3HNTL 1FLRH 2ATPB 4PRIB 5JQ6H 4MDIA 4WW2C 1PKQE 2GUOA 3HE6D 2XZAH 5IJKA 4JFFA 3LY6A 1RK1B 2BSRB 4X9BA 4BQBA 4OZIA 4XP1L 1BQSA 3HNSL 5ACLA 3HLAA 3KYNA 3I6LE 4WJ5B 2Q8AL 4HW6A 4AH2B 3TBVB 5HVWA 4WHTB 1RZKH 3VE0B 3JV4B 4R26H 4G6KH 1HN1A 3C8HA 1KLUA 3HRZA 1TNMA 3VMPA 3INUH 1KIRB 2IGFH 4NQEB 2L0DA 5CGYD 1PG7W 4FA8A 3ROLA 2VKXA 4LLMB 5LVEA 3QIBD 4H25A 5T3XL 2VLME 4QRPD 2DJUA 3RGVA 4R4FH 5EU3A 1PKQA 3MGTA 3FFCE 1XGTB 3Q6GH 4IRSD 1S9XA 1RU9H 4G6FB 5BQ7B 5F21B 3MX0A 3I3EA 1MCJA 3S37H 1FL3B 1P2CA 2W9LA 3MJ8A 3U7AA 5IBUG 1W0WB 1OAUL 4H88L 2F58L 1IQWL 3EJJX 1C5CL 4XP4L 1MWAB 4ZAKA 1FL6A 5FO7A 2H3NA 1CDHA 1KG0A 1KENL 5KVFL 1XGRB 4U1LB 1ZLWH 4HWZA 5HY9B 4KQ4L 4U1IB 3BIKB 5DRZB 3VXOB 5L2JA 1EFQA 2Z31C 2F53E 4PGBB 4ZO7A 1XCQB 4PJAF 2JJSC 1ZT7A 3CSGA 3PWJA 5FOBA 4GXUM 2F54B 4HEME 4ESKA 3CJJA 3LCYA 2O93L 5GGQL 1FNGA 4XVTH 2ADIA 3O41B 1EXUB 4Y5XA 2A6IA 1S8DA 1X5YA 2QHRL 3JTTA 2CR3A 1MCQA 3EO9L 3BRDA 3HC0A 1OGAE 2W0PA 2V7HB 3EKCA 3L7FA 3CFCL 4X7SL 5TE6L 4UIMB 1CTNA 1YECH 2Q20A 4CMMA 3QULA 4OQ1A 1H15B 1TZHA 3CMOH 5GGUB 3SBWC 1HHGA 4FN0A 1KV3A 5EUKA 4GUPA 1BQLH 2C1OA 3LN4A 1MFNA 1TTUA 2AJVH 1FJ1B 3CXHK 1AE6H 3QUXA 5TE7L 1NH6A 4NHUE 3VFSA 4D0CA 3GUTB 4P0DA 1I9RL 3HUJA 4MXVE 1A7NH 1IEBB 1DUYB 5ADPL 1BIIA 2H2SC 5DUMH 1QNZL 3WFCL 1QRNB 5EO9B 1NDMB 3DX6A 3SGJA 1EERB 2QR0A 3HC4H 1BECA 3SPVB 2E27H 1Q9LA 4F7CB 3MV9E 4FRWA 4XZUB 5IW6B 4QEGA 1H3XA 4XBEH 5I8KL 3RVVC 3REVB 4IMKC 1U8NA 1KJVA 5FHBL 1NKRA 3IJYB 2EKSA 1JGVL 3FJTA 4FQHB 4JREC 1JGUH 4ZFOA 3O9WC 5F1IA 3X3GL 3RU8H 1VFUA 4HGMA 5I6XB 3EGSB 3QEHA 1IKNC 3OKNA 1INQA 1R3IH 2PETA 2XYCA 1NLDH 5IF0A 2GFBB 2NYYD 4JZOA 4F9LC 3ARZA 5E2UH 2JB5H 1EAPB 1A64A 3SQBA 5C9JA 3PQYD 3MRQA 1D6VL 5GGQH 4G43A 4C56D 3MLTB 4ZD3L 4ONGH 3PJSB 1J7VR 5T5FL 1NMCC 2CKBA 3PE9A 4WTZG 1WFNA 1T89C 2D4DA 2H32A 4NUGH 5E9DE 3TYFB 4S11A 1V3LA 1AY1L 4J6RL 4XPAH 3I2CL 4WY7L 3O6FD 2FJGA 1FN4B 1RIVH 1MEXL 1A6TA 4F7EA 2XY2A 5FGBA 2PW1B 4OLEA 3D25B 4ZUUA 3OAZK 2VKWA 4FS0A 4XWOD 3RWGB 4X6CB 1J8HD 2PTTB 3LDBC 1JPST 4M1DL 5C08D 4GMTL 3BOVA 1AHWA 4HCRL 4JZJA 4M7JL 2ITDA 1S7VA 1P4LA 1LDSA 1MUJA 3UJJH 1IKFH 2FATL 4OZ4B 2YSSB 4PJ5D 1E4WL 2OZ4A 3AUVA 4XNXL 1ZT4B 1HHIB 3ZTNH 4X4ZA 4OB5H 1KB9K 3ARFA 4P5TA 2AJZB 3LRHA 5J3HD 2EE6A 3K2UL 4KI5D 3MLXL 1AKJB 1CDCA 4LCYA 3IAPA 5HHOB 4D0BA 3OKKB 4K7PX 1K2DB 4WI4A 4CVXA 1OVZA 5DFVD 1EUUA 4MA8L 5GRWA 3DMMC 1URLA 1J8KA 1UEYA 4KK6C 5FA3B 3UDWA 3RVUC 3BWAB 1NFDB 3KPPB 5DJ0A 3MROB 2UZIL 2V9RA 4QT5B 3BMWA 5DR5H 4OCXL 2W9EL 3PL6B 2ZCLL 3PP3K 5E70A 3SO3B 4OCWH 4UOW1 1S9YB 5D1XA 5FDWA 1OARH 1G6RB 3C5SA 5DFWH 2JK5A 2QTEA 4FQ2H 3VU2A 1J1PL 2FH6A 4N8VA 4OCRH 1P6AB 4P9HH 1TETH 1RJLA 4FFWD 2HJLB 3DV6B 4S1SL 3I2CH 3FO9B 4G8IA 4JFEE 1RJZB 4E42A 1QEWB 3W5NA 4AIZA 3EZJB 1MEXH 1SJXA 1TITA 4WEBH 3MLPA 3T0VA 2VXQL 2WBJD 1A1OA 3QXAB 5DHVB 2H45A 3FQXB 4JRYB 4M6NH 2VQ1B 2AJ3B 4H1LG 5HHXH 3BD3A 4HWUA 1I7RA 3IJHA 1FLTX 1WAAE 4PTTB 3T0EE 3NTCL 5MERB 1HK6A 4R7DA 3QT2A 2WBJB 4IDJL 2V5TA 4UUJA 5ERWA 1FNSL 3KR3L 1IM9A 3MRCA 5D70H 5CZVL 2AJSL 4K3JH 1L9MA 1I8KB 2DQJH 1BD2D 4ZFFB 4HFUH 1KIPB 4L3CA 3P9MA 3G04B 3S6CA 5HYSG 4X6CF 2IQAA 2RR3A 1AXSA 4XVUD 3BPNB 3G5XB 1FAKT 5BS0D 1AQDA 4EN3A 3W81A 1U58B 1NC2D 1ZEAL 2Z35A 1RIUL 4NP4L 2MQ0A 5L0QB 1BLNA 2CSPA 5GRVK 4OCSL 2AV1B 4MA8H 4KHTH 4P3CL 35C8H 5GS3A 2DOCA 1X4YA 1OT1A 4PJGF 3FMGL 1PW3A 2AQ2A 5IG7B 3MSPA 3D9AL 3L9RB 4HUUA 1S3KH 3IDXH 4JLRB 3LEXB 2QLVB 1MCWW 5TF1H 4KKNA 3PF2A 5LGHH 3P77B 3PHOA 4ELKB 4JHWL 1D6EA 3AREB 1S7TB 4YWGH 4Z7UB 2F74B 2EXWD 4HGWA 4K07A 3U1SH 4N8PA 1RZ7H 3FAWA 2NPLX 3QEQB 4CRPA 3E6HA 1GOGA 4XAWH 4JAMA 4X83A 5I18H 2EIBA 3ILQD 4KI5F 3ARWA 3WJLA 5C0IB 4YPJA 1NFDF 4OBSA 2NTFB 2F5AH 5HDBE 5FAAA 2X1XR 4HUVA 3LB6D 5D71H 4GRMA 5JDJA 2FWOB 3ARGC 5HHPB 3W0WD 3A6CL 4Y4FB 4N0CC 43CAB 5E1AA 1CR9L 4Q9CA 2D4FA 2XPGA 2FIRT 3OAUH 5KVDH 1MJUH 2OSLA 5EU7E 4J8RB 2ICWB 3HR5A 1DR9A 1MJ8H 1YEHL 1WFUA 1QA9B 4LGSB 3FB6A 5D7LD 3GMPA 1KF9B 3DGCR 3W0WB 4YPGB 3DWTA 4YEFA 2Q3ZA 1SJEA 3GSOB 3CCHA 1OAXH 3QISA 4PY8J 3TNMA 1QLEH 5BMFH 5J1TC 4OV5A 5CJBA 3VI3E 3VRLF 5C07E 4N90D 4U6VH 3QIWC 3QRFM 3TM6A 3IGAB 2J88L 2EDHA 3VFGL 2HWZH 4KDVA 1XR8B 5D6CB 2VL5A 5I19H 3VXNA 3NIDE 4NDMA 2V2WA 5KSAA 4PP2B 1IGFL 2EZ0D 3BHBB 1IE5A 2X70B 4KHXH 4FMKA 5C0BE 2YWYA 5DD3H 4E41D 5J11C 4G6AD 4OCSH 4N9GB 3SKOA 4C83B 4R4ND 3BXNB 4LARL 1NANH 1YY8B 1CGSH 4FZEH 2HT2D 4G7VL 2X09A 4PJHE 2X42A 2MCG1 3BYYA 3QXVA 2YS4A 3KPTA 4YFLI 3MOBL 1N5AB 4GW1A 4YHPB 3BP6B 5IJKC 5L88L 3PV6A 2P42B 1BJMA 3O2DA 2EH8H 4OFDA 3STBA 4XCNB 4KUZH 1BBDL 1KUMA 5EOCL 1S9WA 3TZVA 1IAKB 1P7QB 2XXMB 3GHEL 1N5YH 1QFHA 5CZXC 1WBYA 5D93B 3FB5B 5IBTL 3W39A 4C59B 1IGCH 3SQOL 4HKZB 4X4YA 3NH7H 2Y36L 2VOTA 5GGTH 5C09B 4GG6A 3WNLA 2Y07H 4XP6H 1DANT 4KRPC 3FRUB 4KPHL 5DQ9B 1W0YT 3CGTA 2XIDA 1EEYA 3JV6A 4OCYH 1D5ZB 5CJ8A 4KXZI 5H37G 1LEKB 4PRPB 3RGVC 4RFEB 2HMIC 4U6YA 1NCTA 3IRPX 2PCPB 4FNLH 4BSJA 1PAMA 2GITA 4UTBL 1YY9D 1TENA 4AEEA 1T0NB 3OKLA 4AIOA 4HAGA 3WHXB 3KYKL 1XAUA 3RHWF 3WO4B 3C2SA 4U6XA 4JCLA 3M8OL 2EDYA 3HAEH 3L3OB 5ESVA 3QDME 4RX4D 3EYUH 2P5WB 3NPZB 3OR6B 1QPXA 5HYQB 3ZKXB 3V52L 1UWEL 1OF2A 4XNQA 1A14H 5FO9B 2ZSVB 4MNQD 4ODSL 5FYJH 3VXSE 5E8DH 5EZOH 4ZAKC 1JPSH 3DUSB 2DMCA 1EHAA 4G8GB 2EDRA 4Z7QF 5DD5L 1L6XA 3M1BA 3MLRH 1CBVL 4PD4J 4ZFOL 1A2YB 3MRNA 5DEZA 1R24A 3TNNB 4PRHE 1WT5A 3V4VL 4Y5XC 5D6DA 2Q86B 1DZBA 3T08A 4NJ9H 2FO4A 4MNHA 4RGNB 3VG9C 3SKNB 4W81A 1MHHB 3VXSA 1AH1A 1OAQH 4NKQB 4N5EC 5IMMB 3STZB 3ZLQC 1GJIA 1J0HA 3S34L 3V4UL 5DUPH 2CKBL 4O02L 5DMKA 2E6QA 3TVMA 4PPTA 2AV7A 4K3EH 3SGEH 4K9EL 4LQFL 4NRYB 3UTTB 4XXDA 3VXMB 1VHPA 2BNRD 1BBDH 3QUXC 4RAVB 3X13A 3NIFF 3FOMB 4NRXB 4XCYA 3GMOA 3KPOB 5AYUL 3QB7C 1DP0A 5ICYA 1EAJA 3VXRB 2P7TA 1V5JA 4UQ3A 1UA6L 3IJSB 1GH7A 3RZCD 4EEEA 3RNQA 2AK1L 3RKDC 5AZ2L 4BK5A 3ILPB 5HD8D 4V1DD 1S7WA 1MF2H 1KPVB 2DB8A 3KPLA 1RZGB 3KNBB 4FP8L 3SGJC 3O3BA 1F3JA 4LCWA 4UT9L 5DZOA 5DRXB 3AFLA 3PABB 4YHML 3TIDB 2DI8A 3MV01 1J86A 1FDLL 2OZ4L 5B3JE 3GK8L 4TSAL 4NO2B 5MENB 3IFPB 4JN1L 5CD5C 2YRZA 3HZVA 2YD5A 3TA3D 1BAFL 4YDLB 2ZUQB 5DJZB 3SE8L 2HKHL 2IALA 3IU4H 1SY6A 3BDBA 4ETQA 1DBKL 5GS0L 3ZHKA 3ARPA 3L3KA 4X6DE 4PGDA 3FO1B 4ZPTB 3BPOB 1OP5K 4YQXL 5FF6B 5EZIH 3FT2A 1CE6B 3K4ZA 1T1WA 3BKMH 1FRGL 1N0LA 1V7MH 1K6QH 2DQIL 4PLKD 2BZDA 5J1SC 5DO2D 2C1PB 1WWCA 3C6SB 1ZV5A 4KK5D 2Q76A 2XWBB 4JFDD 1R6VA 4WTZA 1ODAA 5IB1A 3I9GH 3SDXE 2CIKB 1J88A 1ZLUH 4OFPA 3KXFB 3ALWA 1DQML 3EDJA 4K9EC 3L1OH 2ENYA 3RUGF 1NLBH 4XRCB 2Z92B 5DZNA 3KLAA 4FTVD 3MLYL 2VDRL 3LS5L 4H20H 1LE5A 2LVCA 4O02H 1V7NL 1FNEB 4YHNA 3OKOB 2VDOL 5KAQG 1HI6B 4LQFH 4UDUB 2DD8L 1PY9A 3FO2B 1DN0A 5A2KH 1FP5A 3MJ6A 5CJQL 4B0MM 3H0TB 2ADFH 5IEHA 1DQLL 4Y4HB 4U3XA 2FIKA 1AHWC 5M94B 3EO0B 3MC0A 3DARA 1UB5B 4PRNB 1FG2B 4L5FL 5ACZB 4WW2B 2CKNA 2VXVH 4WUUD 3OR7B 4I3RL 1I7ZB 1MREH 5F44A 1HQRA 1BVLB 1KCUL 3ARFC 3QO0A 1KYOK 1YZZA 4JHAH 1KCGC 4LU5H 4LGPB 4HIIA 1G6RH 2FX7H 3GSRA 3DROA 5GS0C 4PJCE 3B6SA 3GK8H 3KPQB 4RDQF 1HXMB 1VGEH 3VWJD 1T22A 3OXSA 1CFTB 1BAFH 1CFSB 2IG2H 4GKZB 3V0AC 1YMMB 4UU9A 1KIQB 4G8EA 3UTPE 5HGHA 3MRKA 1A7BA 1QQDB 1U95A 5CGMA 4MQSB 4X4MA 2FCBA 1EHLL 3LPGA 3VGDA 3MBXL 4YDKH 4BELD 4RBPK 3QCUL 3MCLH 5GIRA 1CXFA 3SKUD 1X9QA 3WLWC 2QBWA 5I75C <