3CDJA

Crystal structure of the e. coli kh/s1 domain truncated pnpase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
543
structure length
445
Chain Sequence
b'DITLLNPIVRKFQYGQHTVTLETGMMARQATAAVMVSMDDTAVFVTVVGQKKAKPGQDFFPLTVNYQERTYAAGRIPSEGETLIARLIDRPIRPLFPEFVNEVQVIATVVSVNPQVNPDIVAMIGASAALSLSGIPFNGPIGAARVGYINDQYVLNPTQDELKESKLDLVVAGTEAAVLMVESEAQLLSEDQMLGAVVFGHEQQQVVIQNINELVKEAGKPRWDWQPEPAIEKNVVRSRVLAGEPRIDGREKDMIRGLDVRTGVLPRTHGSALFTRGETQALVTATLGTERTDTFLFHYNFPPYEIGHGRLAKRGVLAVMPDMDKFPYTVRVVSEITESNGSSSMASVCGASLALMDAGVPIKAAVAGIAMGLVKEGDNYVVLSDILGDEDHLGDMDFKVAGSRDGISALQMDIKIEGITKEIMQVALNQAKGARLHILGVMEQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polynucleotide phosphorylase
molecule tags Transferase
source organism Escherichia coli
publication title Crystal structure of Escherichia coli PNPase: central channel residues are involved in processive RNA degradation.
pubmed doi rcsb
total genus 98
structure length 445
sequence length 543
ec nomenclature ec 2.7.7.8: Polyribonucleotide nucleotidyltransferase.
pdb deposition date 2008-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
A PF03726 PNPase Polyribonucleotide nucleotidyltransferase, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 3cdjA03
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 3cdjA01
2C39B 3GMEA 5C0XD 5JEAF 2NN6A 2WP8A 2JEBA 2BR2B 2NN6F 3DD6A 2C37B 1UDQA 2JEAA 4IFDD 4BA1B 5K36B 2NN6D 4AIMA 4AM3A 2PO0A 1R6LA 1R6MA 5C0XF 4IFDE 2WP8B 3L7ZA 5C0XA 3M7ND 1OYSA 3GLLA 5JEAC 3B4TA 3KRNA 1UDOA 2NN6C 3M7NG 3H1CA 2NN6B 4IFDA 1OYPA 4OO1C 1OYRA 1E3PA 4BA2A 2BA0D 5JEAA 4OO1A 4BA1A 5K36A 5C0XC 2PNZA 2PO2B 4IFDC 5C0XB 2BR2A 3GCMA 2C38A 2C39A 5K36C 2BA1D 2WNRA 2BA0G 4OO1D 5K36E 2PO1A 3CDJA 4OO1F 2C37A 3HKMA 2JEAB 5JEAB 4IFDB 5K36D 4AIDA 1UDSA 2BA1G 1UDNA 2PO0B 5C0XE 2C38B 4IFDF 3CDIA 4OO1E 2JE6A 4OO1B 3M85G 2WNRB 5K36F 3L7ZB 2JEBB 5JEAD 2NN6E 1E3HA 5JEAE 4BA2B 3M85D 2PO1B 2PO2A 2PNZB 4NBQA 2JE6B 3U1KA
chains in the Genus database with same CATH superfamily
4DV7I 2X7IA 1FNMA 4LF4E 2F4VI 4WUDA 4LOMA 4MU0A 1FI4A 4IZJA 5LMNI 2NN6F 4NXNI 4X66E 4JV5I 4JI3E 4KHPI 1HNXE 2AE8A 2HKEA 3PYFA 1HNZI 1NHHA 5ELWA 1DARA 4X64I 2AJ4A 5DNXA 2PNMA 2PO0A 1I94I 3CWVA 5C0XF 4OX9E 4DPXA 3JAMQ 1Z5BA 4DU8A 4JYAI 2WP8B 5BR8E 4DV3I 4DV1I 4X62I 5JEAC 3GLLA 1Z5AA 4FN5A 4X66I 2CZ9A 4NXNE 4WUBA 5L3JA 3H1CA 2NN6B 2VQEE 4LF4I 2E1RA 4Z7CA 1MU5A 1A6FA 2A2DA 3ZKBA 4LFAI 1J5EE 3P3EA 4YHHI 2BA0D 4BA2A 4BA1A 1FJGE 1N33I 4DPWA 2PNZA 2PO2B 5EL9A 2VQFI 2Z5BB 5C0XB 2VESA 2O3ZA 4K0KI 2HK3A 4FW6A 4DR6I 4DR5E 1ZM3A 1Z0EA 3T1YI 3V5RA 4PRVA 1K47A 1IBLI 1ZXNA 2BA1D 4DR7E 4DR2E 4DV3E 3K1JA 1ZXMA 5GMEA 3QT7A 4J3DA 4IZJB 5K36E 4HY1A 2BM1A 2V8PA 4P52A 4JG4A 4URLA 4FW4A 3PRYA 4IFDB 1UDSA 3D4JA 2UXBE 1WUUA 3OTOI 5FWKA 1KTVA 1XMOI 4OO1E 2JE6A 1IBKE 4OO1B 4WUCA 2WNRB 2DEIA 2V2VA 4X64E 2JEBB 4IS9A 1IBME 2E5LI 4YY3E 1HNZE 2O1WA 4UTGA 4AQYE 4PRXA 4U3DA 4DPTA 2UUAE 1S4EA 2UU9I 3LNUA 2IOPA 2O1VA 5JEAE 3M85D 4NXME 1KKHA 4LFBE 3P3GA 5A2QC 4LFBI 1Z5CA 4JI8I 4NBQA 1N0UA 4P7AA 2UUAI 1S16A 4DV1E 2O1TA 2F4VE 2C39B 2R3VA 5C0XD 4M1KA 2E5LE 3P3CA 2HK2A 4B3TE 1ZM2A 1N34E 4JI8E 3Q6MA 3WU3A 1Y60A 2X36A 2ZBKB 3WU6A 4LFCI 1N32E 4DV5I 4DUZE 2IOQA 4JI6E 1Y5YA 4JI3I 4IFDD 4B3ME 1FKAE 1RHYA 2UXBI 5LMUE 3ZZ0A 4YHHE 1IBMI 3Q6NA 2NN6D 3K17A 1FWLA 2UUCE 1D6TA 5FLXQ 1EA6A 4DR1E 4MYUA 1R6LA 2F1DA 1R6MA 1H73A 4FWHA 4GKJE 3M7ND 3KRNA 1UDOA 2IERA 2HFUA 5DRPA 1NZ0A 2CGEA 4HACA 1HR0I 4OX9I 4OO1C 4LF7E 1HK7A 4DR2I 1B63A 1FWKA 4DV4E 1OYRA 1PVGA 2XEXA 2V2ZA 5DRRA 3ZZTA 5JEAA 2ZM6I 3H4LA 4IFDC 4MU1A 4GQUA 4U3BA 1N32I 4DR4E 1XNQI 5LMNE 2HFSA 4HYMA 2UUCI 1U2RA 1Z0BA 4FW3A 1N0VC 1VI7A 2GO3A 3JAMC 2BA0G 2J65A 1N36E 4LF6E 2PO1A 4XTJA 3M6AA 4JI2E 4DV5E 4IZJD 5K36D 1USVA 4B3TI 4IZKB 5C0XE 2C38B 3HJCA 1HNWE 3QT5A 3T1HI 2GO4A 1Z0CA 3M85G 3B82A 4JI5E 1RR9A 3UHMA 1Z59A 3WU4A 4JI7E 2HHHE 1PIEA 5JEAD 1PKPA 4DR3E 3LTOA 3J81C 4FW5A 1Y6ZA 2NN6E 4DR3I 1YHCA 4BA2B 4DV2E 4HACB 3QT6A 3GONA 3PYGA 1XNRI 2PO2A 2PNZB 2UUBI 2O1UA 4GKKI 1IBKI 4DV7E 2PNLA 3OTOE 3NZKA 1MG7A 2WP8A 4LPFA 4UT4A 5LL6R 2IESA 3DD6A 1UDQA 4JI2I 1ZM9A 4JI0E 4RPFA 1Z0TA 4FW9A 4FWDA 5K36B 4LF8I 4LF9E 1YH8A 4LF9I 5DROA 4N3OA 4MYTA 4X65I 4IFDE 3PS1A 4B3SI 2UXDE 4B3SE 2UXDI 2GS8A 2CG9A 5C0XA 1OYSA 1NHIA 3B4TA 1NHJA 4KQVA 4PU9A 5IWAI 4QNJA 4DPYA 1ZM4A 4DV4I 3M7NG 4USKA 4EMDA 2R42A 1Z0VA 2ZITA 5GMDA 4R1FA 2Z5CA 3PS3A 1OYPA 1Y4UA 1XXEA 5DNLA 2A2CA 4ISAA 1E3PA 2UU9E 4OKGA 4X62E 4FWGA 4HXZA 2BR2A 4KHPE 1N36I 4MDTA 3Q1QA 1HNWI 4JV5E 2V2QA 4DR1I 4B3RE 3LPSA 2Q2EB 3WU5A 1XNQE 1H72C 2WNRA 4NXMI 1KIJA 1Z0WA 4OO1D 2VF3A 2NPFA 3PS2A 1HNXI 3CDJA 4OO1F 4OZEA 3HKMA 4YY3I 3J7AG 2HHHI 4DUYI 5IWAE 2Z5BA 2BA1G 3B8HA 3J7AM 4Z7YA 1UDNA 2PO0B 4QNKA 3CDIA 4JI1E 2UXCI 4LF5E 4DU7A 4X65E 5K36F 5IT9Q 4LF8E 4LF5I 1USUA 3K85A 4AQYI 4DV6I 4JI0I 1E3HA 3ZM7A 2CVEA 5IT9C 3P76A 2UUBE 2BV3A 5EKWA 4ED4A 2PO1B 5LMUI 4LF7I 4MU3A 3T1YE 2JE6B 4LCFA 4JI6I 1Y4SA 3U1KA 1XMOE 1KVKA 3GMEA 4IZKA 5A2QQ 2NN6A 5JEAF 2ZM6E 1FJGI 1N33E 2JEBA 4FW7A 3B78A 2BR2B 1J5EI 4JI5I 4DV2I 2C37B 5FLXC 5DRQA 2JEAA 2WW4A 4GKKE 4BA1B 4DUZI 3PYEA 1I94E 4JI7I 4AIMA 4DV0E 4AM3A 4DUYE 3HULA 1IBLE 3QT8A 1OJ4A 5BR8I 4LF6I 3T1HE 4GKJI 3L7ZA 1Z0GA 1P42A 2NN6C 1EI1A 1RREA 2V34A 2EFGA 4IFDA 4LFCE 4DV0I 1N34I 4B3RI 4OO1A 5K36A 5C0XC 4DR4I 1XHKA 2Z5EA 2JT2A 4I3HA 1HR0E 2OI2A 3GCMA 2C38A 4LCHA 2C39A 5K36C 3J81Q 4LCGA 4JI4I 3U1YA 1VISA 4ZVIA 1ELOA 4K0KE 1XMQI 3PYDA 1QZRA 3ZZUA 1H74A 2C37A 3V2UC 4MQYA 2JEAB 5JEAB 1MX0A 1H7SA 1UEKA 2BM0A 2Z5CB 4AIDA 1B62A 4DXLA 3J80C 4B3MI 4DV6E 4IFDF 4DR5I 1BKNA 2GQ0A 1XMQE 2VQEI 2VQFE 4USMA 4JI4E 4MU4A 3J80Q 3L7ZB 3F0NA 4LFAE 4JI1I 2UXCE 4JYAE 1H7UA 2DEJA 4DPUA 4DR7I 1XNRE 2J7KA 3P06A 2HKJA 2LJPA 3ZKDA 4DR6E
chains in the Genus database with same CATH topology
2C39B 3GMEA 5C0XD 5JEAF 2NN6A 2WP8A 2JEBA 2BR2B 2NN6F 3DD6A 2C37B 1UDQA 2JEAA 4IFDD 4BA1B 5K36B 2NN6D 4AIMA 4AM3A 2PO0A 1R6LA 1R6MA 5C0XF 4IFDE 2WP8B 3L7ZA 5C0XA 3M7ND 1OYSA 3GLLA 5JEAC 3B4TA 3KRNA 1UDOA 2NN6C 3M7NG 3H1CA 2NN6B 4IFDA 1OYPA 4OO1C 1OYRA 1E3PA 4BA2A 2BA0D 5JEAA 4OO1A 4BA1A 5K36A 5C0XC 2PNZA 2PO2B 4IFDC 5C0XB 2BR2A 3GCMA 2C38A 2C39A 5K36C 2BA1D 2WNRA 2BA0G 4OO1D 5K36E 2PO1A 3CDJA 4OO1F 2C37A 3HKMA 2JEAB 5JEAB 4IFDB 5K36D 4AIDA 1UDSA 2BA1G 1UDNA 2PO0B 5C0XE 2C38B 4IFDF 3CDIA 4OO1E 2JE6A 4OO1B 3M85G 2WNRB 5K36F 3L7ZB 2JEBB 5JEAD 2NN6E 1E3HA 5JEAE 4BA2B 3M85D 2PO1B 2PO2A 2PNZB 4NBQA 2JE6B 3U1KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C39 B;  3GME A;  5C0X D;  5JEA F;  2NN6 A;  2WP8 A;  2JEB A;  2BR2 B;  2NN6 F;  3DD6 A;  2C37 B;  1UDQ A;  2JEA A;  4IFD D;  4BA1 B;  5K36 B;  2NN6 D;  4AIM A;  4AM3 A;  2PO0 A;  1R6L A;  1R6M A;  5C0X F;  4IFD E;  2WP8 B;  3L7Z A;  5C0X A;  3M7N D;  1OYS A;  3GLL A;  5JEA C;  3B4T A;  3KRN A;  1UDO A;  2NN6 C;  3M7N G;  3H1C A;  2NN6 B;  4IFD A;  1OYP A;  4OO1 C;  1OYR A;  1E3P A;  4BA2 A;  2BA0 D;  5JEA A;  4OO1 A;  4BA1 A;  5K36 A;  5C0X C;  2PNZ A;  2PO2 B;  4IFD C;  5C0X B;  2BR2 A;  3GCM A;  2C38 A;  2C39 A;  5K36 C;  2BA1 D;  2WNR A;  2BA0 G;  4OO1 D;  5K36 E;  2PO1 A;  3CDJ A;  4OO1 F;  2C37 A;  3HKM A;  2JEA B;  5JEA B;  4IFD B;  5K36 D;  4AID A;  1UDS A;  2BA1 G;  1UDN A;  2PO0 B;  5C0X E;  2C38 B;  4IFD F;  3CDI A;  4OO1 E;  2JE6 A;  4OO1 B;  3M85 G;  2WNR B;  5K36 F;  3L7Z B;  2JEB B;  5JEA D;  2NN6 E;  1E3H A;  5JEA E;  4BA2 B;  3M85 D;  2PO1 B;  2PO2 A;  2PNZ B;  4NBQ A;  2JE6 B;  3U1K A; 
#chains in the Genus database with same CATH topology
 4DV7 I;  2X7I A;  1FNM A;  4LF4 E;  2F4V I;  4WUD A;  4LOM A;  4MU0 A;  1FI4 A;  4IZJ A;  5LMN I;  2NN6 F;  4NXN I;  4X66 E;  4JV5 I;  4JI3 E;  4KHP I;  1HNX E;  2AE8 A;  2HKE A;  3PYF A;  1HNZ I;  1NHH A;  5ELW A;  1DAR A;  4X64 I;  2AJ4 A;  5DNX A;  2PNM A;  2PO0 A;  1I94 I;  3CWV A;  5C0X F;  4OX9 E;  4DPX A;  3JAM Q;  1Z5B A;  4DU8 A;  4JYA I;  2WP8 B;  5BR8 E;  4DV3 I;  4DV1 I;  4X62 I;  5JEA C;  3GLL A;  1Z5A A;  4FN5 A;  4X66 I;  2CZ9 A;  4NXN E;  4WUB A;  5L3J A;  3H1C A;  2NN6 B;  2VQE E;  4LF4 I;  2E1R A;  4Z7C A;  1MU5 A;  1A6F A;  2A2D A;  3ZKB A;  4LFA I;  1J5E E;  3P3E A;  4YHH I;  2BA0 D;  4BA2 A;  4BA1 A;  1FJG E;  1N33 I;  4DPW A;  2PNZ A;  2PO2 B;  5EL9 A;  2VQF I;  2Z5B B;  5C0X B;  2VES A;  2O3Z A;  4K0K I;  2HK3 A;  4FW6 A;  4DR6 I;  4DR5 E;  1ZM3 A;  1Z0E A;  3T1Y I;  3V5R A;  4PRV A;  1K47 A;  1IBL I;  1ZXN A;  2BA1 D;  4DR7 E;  4DR2 E;  4DV3 E;  3K1J A;  1ZXM A;  5GME A;  3QT7 A;  4J3D A;  4IZJ B;  5K36 E;  4HY1 A;  2BM1 A;  2V8P A;  4P52 A;  4JG4 A;  4URL A;  4FW4 A;  3PRY A;  4IFD B;  1UDS A;  3D4J A;  2UXB E;  1WUU A;  3OTO I;  5FWK A;  1KTV A;  1XMO I;  4OO1 E;  2JE6 A;  1IBK E;  4OO1 B;  4WUC A;  2WNR B;  2DEI A;  2V2V A;  4X64 E;  2JEB B;  4IS9 A;  1IBM E;  2E5L I;  4YY3 E;  1HNZ E;  2O1W A;  4UTG A;  4AQY E;  4PRX A;  4U3D A;  4DPT A;  2UUA E;  1S4E A;  2UU9 I;  3LNU A;  2IOP A;  2O1V A;  5JEA E;  3M85 D;  4NXM E;  1KKH A;  4LFB E;  3P3G A;  5A2Q C;  4LFB I;  1Z5C A;  4JI8 I;  4NBQ A;  1N0U A;  4P7A A;  2UUA I;  1S16 A;  4DV1 E;  2O1T A;  2F4V E;  2C39 B;  2R3V A;  5C0X D;  4M1K A;  2E5L E;  3P3C A;  2HK2 A;  4B3T E;  1ZM2 A;  1N34 E;  4JI8 E;  3Q6M A;  3WU3 A;  1Y60 A;  2X36 A;  2ZBK B;  3WU6 A;  4LFC I;  1N32 E;  4DV5 I;  4DUZ E;  2IOQ A;  4JI6 E;  1Y5Y A;  4JI3 I;  4IFD D;  4B3M E;  1FKA E;  1RHY A;  2UXB I;  5LMU E;  3ZZ0 A;  4YHH E;  1IBM I;  3Q6N A;  2NN6 D;  3K17 A;  1FWL A;  2UUC E;  1D6T A;  5FLX Q;  1EA6 A;  4DR1 E;  4MYU A;  1R6L A;  2F1D A;  1R6M A;  1H73 A;  4FWH A;  4GKJ E;  3M7N D;  3KRN A;  1UDO A;  2IER A;  2HFU A;  5DRP A;  1NZ0 A;  2CGE A;  4HAC A;  1HR0 I;  4OX9 I;  4OO1 C;  4LF7 E;  1HK7 A;  4DR2 I;  1B63 A;  1FWK A;  4DV4 E;  1OYR A;  1PVG A;  2XEX A;  2V2Z A;  5DRR A;  3ZZT A;  5JEA A;  2ZM6 I;  3H4L A;  4IFD C;  4MU1 A;  4GQU A;  4U3B A;  1N32 I;  4DR4 E;  1XNQ I;  5LMN E;  2HFS A;  4HYM A;  2UUC I;  1U2R A;  1Z0B A;  4FW3 A;  1N0V C;  1VI7 A;  2GO3 A;  3JAM C;  2BA0 G;  2J65 A;  1N36 E;  4LF6 E;  2PO1 A;  4XTJ A;  3M6A A;  4JI2 E;  4DV5 E;  4IZJ D;  5K36 D;  1USV A;  4B3T I;  4IZK B;  5C0X E;  2C38 B;  3HJC A;  1HNW E;  3QT5 A;  3T1H I;  2GO4 A;  1Z0C A;  3M85 G;  3B82 A;  4JI5 E;  1RR9 A;  3UHM A;  1Z59 A;  3WU4 A;  4JI7 E;  2HHH E;  1PIE A;  5JEA D;  1PKP A;  4DR3 E;  3LTO A;  3J81 C;  4FW5 A;  1Y6Z A;  2NN6 E;  4DR3 I;  1YHC A;  4BA2 B;  4DV2 E;  4HAC B;  3QT6 A;  3GON A;  3PYG A;  1XNR I;  2PO2 A;  2PNZ B;  2UUB I;  2O1U A;  4GKK I;  1IBK I;  4DV7 E;  2PNL A;  3OTO E;  3NZK A;  1MG7 A;  2WP8 A;  4LPF A;  4UT4 A;  5LL6 R;  2IES A;  3DD6 A;  1UDQ A;  4JI2 I;  1ZM9 A;  4JI0 E;  4RPF A;  1Z0T A;  4FW9 A;  4FWD A;  5K36 B;  4LF8 I;  4LF9 E;  1YH8 A;  4LF9 I;  5DRO A;  4N3O A;  4MYT A;  4X65 I;  4IFD E;  3PS1 A;  4B3S I;  2UXD E;  4B3S E;  2UXD I;  2GS8 A;  2CG9 A;  5C0X A;  1OYS A;  1NHI A;  3B4T A;  1NHJ A;  4KQV A;  4PU9 A;  5IWA I;  4QNJ A;  4DPY A;  1ZM4 A;  4DV4 I;  3M7N G;  4USK A;  4EMD A;  2R42 A;  1Z0V A;  2ZIT A;  5GMD A;  4R1F A;  2Z5C A;  3PS3 A;  1OYP A;  1Y4U A;  1XXE A;  5DNL A;  2A2C A;  4ISA A;  1E3P A;  2UU9 E;  4OKG A;  4X62 E;  4FWG A;  4HXZ A;  2BR2 A;  4KHP E;  1N36 I;  4MDT A;  3Q1Q A;  1HNW I;  4JV5 E;  2V2Q A;  4DR1 I;  4B3R E;  3LPS A;  2Q2E B;  3WU5 A;  1XNQ E;  1H72 C;  2WNR A;  4NXM I;  1KIJ A;  1Z0W A;  4OO1 D;  2VF3 A;  2NPF A;  3PS2 A;  1HNX I;  3CDJ A;  4OO1 F;  4OZE A;  3HKM A;  4YY3 I;  3J7A G;  2HHH I;  4DUY I;  5IWA E;  2Z5B A;  2BA1 G;  3B8H A;  3J7A M;  4Z7Y A;  1UDN A;  2PO0 B;  4QNK A;  3CDI A;  4JI1 E;  2UXC I;  4LF5 E;  4DU7 A;  4X65 E;  5K36 F;  5IT9 Q;  4LF8 E;  4LF5 I;  1USU A;  3K85 A;  4AQY I;  4DV6 I;  4JI0 I;  1E3H A;  3ZM7 A;  2CVE A;  5IT9 C;  3P76 A;  2UUB E;  2BV3 A;  5EKW A;  4ED4 A;  2PO1 B;  5LMU I;  4LF7 I;  4MU3 A;  3T1Y E;  2JE6 B;  4LCF A;  4JI6 I;  1Y4S A;  3U1K A;  1XMO E;  1KVK A;  3GME A;  4IZK A;  5A2Q Q;  2NN6 A;  5JEA F;  2ZM6 E;  1FJG I;  1N33 E;  2JEB A;  4FW7 A;  3B78 A;  2BR2 B;  1J5E I;  4JI5 I;  4DV2 I;  2C37 B;  5FLX C;  5DRQ A;  2JEA A;  2WW4 A;  4GKK E;  4BA1 B;  4DUZ I;  3PYE A;  1I94 E;  4JI7 I;  4AIM A;  4DV0 E;  4AM3 A;  4DUY E;  3HUL A;  1IBL E;  3QT8 A;  1OJ4 A;  5BR8 I;  4LF6 I;  3T1H E;  4GKJ I;  3L7Z A;  1Z0G A;  1P42 A;  2NN6 C;  1EI1 A;  1RRE A;  2V34 A;  2EFG A;  4IFD A;  4LFC E;  4DV0 I;  1N34 I;  4B3R I;  4OO1 A;  5K36 A;  5C0X C;  4DR4 I;  1XHK A;  2Z5E A;  2JT2 A;  4I3H A;  1HR0 E;  2OI2 A;  3GCM A;  2C38 A;  4LCH A;  2C39 A;  5K36 C;  3J81 Q;  4LCG A;  4JI4 I;  3U1Y A;  1VIS A;  4ZVI A;  1ELO A;  4K0K E;  1XMQ I;  3PYD A;  1QZR A;  3ZZU A;  1H74 A;  2C37 A;  3V2U C;  4MQY A;  2JEA B;  5JEA B;  1MX0 A;  1H7S A;  1UEK A;  2BM0 A;  2Z5C B;  4AID A;  1B62 A;  4DXL A;  3J80 C;  4B3M I;  4DV6 E;  4IFD F;  4DR5 I;  1BKN A;  2GQ0 A;  1XMQ E;  2VQE I;  2VQF E;  4USM A;  4JI4 E;  4MU4 A;  3J80 Q;  3L7Z B;  3F0N A;  4LFA E;  4JI1 I;  2UXC E;  4JYA E;  1H7U A;  2DEJ A;  4DPU A;  4DR7 I;  1XNR E;  2J7K A;  3P06 A;  2HKJ A;  2LJP A;  3ZKD A;  4DR6 E; 
#chains in the Genus database with same CATH homology
 2C39 B;  3GME A;  5C0X D;  5JEA F;  2NN6 A;  2WP8 A;  2JEB A;  2BR2 B;  2NN6 F;  3DD6 A;  2C37 B;  1UDQ A;  2JEA A;  4IFD D;  4BA1 B;  5K36 B;  2NN6 D;  4AIM A;  4AM3 A;  2PO0 A;  1R6L A;  1R6M A;  5C0X F;  4IFD E;  2WP8 B;  3L7Z A;  5C0X A;  3M7N D;  1OYS A;  3GLL A;  5JEA C;  3B4T A;  3KRN A;  1UDO A;  2NN6 C;  3M7N G;  3H1C A;  2NN6 B;  4IFD A;  1OYP A;  4OO1 C;  1OYR A;  1E3P A;  4BA2 A;  2BA0 D;  5JEA A;  4OO1 A;  4BA1 A;  5K36 A;  5C0X C;  2PNZ A;  2PO2 B;  4IFD C;  5C0X B;  2BR2 A;  3GCM A;  2C38 A;  2C39 A;  5K36 C;  2BA1 D;  2WNR A;  2BA0 G;  4OO1 D;  5K36 E;  2PO1 A;  3CDJ A;  4OO1 F;  2C37 A;  3HKM A;  2JEA B;  5JEA B;  4IFD B;  5K36 D;  4AID A;  1UDS A;  2BA1 G;  1UDN A;  2PO0 B;  5C0X E;  2C38 B;  4IFD F;  3CDI A;  4OO1 E;  2JE6 A;  4OO1 B;  3M85 G;  2WNR B;  5K36 F;  3L7Z B;  2JEB B;  5JEA D;  2NN6 E;  1E3H A;  5JEA E;  4BA2 B;  3M85 D;  2PO1 B;  2PO2 A;  2PNZ B;  4NBQ A;  2JE6 B;  3U1K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...