3CDJA

Crystal structure of the e. coli kh/s1 domain truncated pnpase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
543
structure length
445
Chain Sequence
DITLLNPIVRKFQYGQHTVTLETGMMARQATAAVMVSMDDTAVFVTVVGQKKAKPGQDFFPLTVNYQERTYAAGRIPSEGETLIARLIDRPIRPLFPEFVNEVQVIATVVSVNPQVNPDIVAMIGASAALSLSGIPFNGPIGAARVGYINDQYVLNPTQDELKESKLDLVVAGTEAAVLMVESEAQLLSEDQMLGAVVFGHEQQQVVIQNINELVKEAGKPRWDWQPEPAIEKNVVRSRVLAGEPRIDGREKDMIRGLDVRTGVLPRTHGSALFTRGETQALVTATLGTERTDTFLFHYNFPPYEIGHGRLAKRGVLAVMPDMDKFPYTVRVVSEITESNGSSSMASVCGASLALMDAGVPIKAAVAGIAMGLVKEGDNYVVLSDILGDEDHLGDMDFKVAGSRDGISALQMDIKIEGITKEIMQVALNQAKGARLHILGVMEQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Escherichia coli PNPase: central channel residues are involved in processive RNA degradation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Polynucleotide phosphorylase
total genus 98
structure length 445
sequence length 543
ec nomenclature ec 2.7.7.8: Polyribonucleotide nucleotidyltransferase.
pdb deposition date 2008-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
A PF03726 PNPase Polyribonucleotide nucleotidyltransferase, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 3cdjA03
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 3cdjA01
3GCMA 2C37B 2BA0D 2NN6C 4OO1B 5JEAE 5K36B 4IFDE 5C0XA 3L7ZA 2PO0B 5JEAF 2PO1B 5JEAA 2JE6A 2PO0A 3L7ZB 1OYPA 4BA2B 5C0XD 4IFDB 2NN6A 3B4TA 2JEBB 1R6MA 3KRNA 2PO2B 5K36F 2NN6D 2PO1A 4OO1D 1E3PA 5C0XF 2WNRA 1E3HA 4BA1B 2NN6B 5K36C 2NN6F 2BA0G 1UDQA 4OO1C 1UDNA 4AIDA 4IFDA 2C39B 4AM3A 5C0XB 5K36A 1R6LA 2BR2B 4OO1E 5JEAB 2BA1D 2JE6B 3GLLA 3H1CA 4IFDC 4BA1A 3M7ND 3CDJA 2BR2A 1UDOA 5K36D 3M85D 2NN6E 2BA1G 3GMEA 3CDIA 3U1KA 3DD6A 3M85G 2C39A 2PNZA 2C38A 5C0XE 2WP8A 4NBQA 5JEAD 2C37A 2WNRB 2JEBA 5K36E 2JEAA 4OO1F 4OO1A 1OYRA 4IFDD 3HKMA 2JEAB 3M7NG 5C0XC 4AIMA 4IFDF 2WP8B 2PNZB 1OYSA 2C38B 5JEAC 2PO2A 4BA2A 1UDSA
chains in the Genus database with same CATH superfamily
2UXDI 4X62E 4LF9E 4DR5I 1ZXNA 1HNXE 5EKWA 5A2QC 3B8HA 4DR3E 2WW4A 4MYTA 4DU7A 1MG7A 4DV0E 1XNQI 3L7ZA 2PO0B 1A6FA 1PKPA 2IOQA 2HFSA 4IZJA 5EL9A 5JEAA 1N36E 1OYPA 4FW5A 4DR7I 1HR0I 4DV3E 3QT7A 3HULA 4LF5E 3PS3A 1YH8A 4LFBE 4MU0A 4PRVA 4NXMI 1Y6ZA 2NN6D 2PO1A 4WUCA 1H7SA 4DPWA 1P42A 2HHHI 4QNJA 4DPYA 4X65I 3OTOI 2NN6B 4HACB 3UHMA 3V5RA 1UEKA 3JAMC 1N32I 4LF8E 3NZKA 1H72C 4KHPE 4P52A 4JI1I 4X66E 1UDNA 2IERA 3T1HI 4DPTA 3PRYA 4JI3I 1H7UA 2ZITA 4YHHE 2CVEA 1Y60A 4WUDA 4JI2E 2HK3A 1N34I 2V8PA 3GLLA 3ZKBA 4DV5I 2BR2A 5BR8E 4JG4A 4LPFA 4MQYA 3ZKDA 2BA1G 3HJCA 1S4EA 2JT2A 2HKJA 1N0VC 3U1KA 2AE8A 5IWAI 4X64E 2BV3A 3PYDA 5IT9Q 1Z0TA 2C38A 5C0XE 3ZZ0A 3ZZUA 4FW6A 2A2CA 4JV5E 2WNRB 4LFCI 4JI5E 1NHJA 1ZM9A 1OYRA 4DR2I 3Q6NA 1XMQI 4FW7A 4DPUA 4LF7I 3WU6A 2E5LI 4OX9E 3PYEA 3ZM7A 2PNZB 4EMDA 1ELOA 4BA2A 4FN5A 4U3DA 1RREA 4N3OA 3V2UC 1IBKI 4IZJD 2Z5CA 2GQ0A 2ZM6E 1VI7A 2F4VE 1FNMA 4B3ME 4JI4I 2Z5CB 4DXLA 1HNWI 2PNLA 4B3SE 3J80Q 3J81C 4LF4I 4Z7YA 2V2VA 4GKJI 1VISA 4BA2B 4IFDB 2NN6A 4HACA 1MU5A 5L3JA 4DUZE 4LOMA 3U1YA 4DUYI 2JEBB 1IBMI 4GQUA 3KRNA 2PO2B 1QZRA 2DEIA 5LL6R 5K36F 4GKJE 4LF4E 1E3PA 4PU9A 4UT4A 3P76A 1E3HA 3F0NA 4UTGA 4B3MI 1K47A 2F4VI 4WUBA 1HK7A 3WU4A 4BA1B 1IBLE 2GO3A 1FJGE 1XNRI 3J7AM 1XMOI 1XMOE 5DRPA 1XNRE 1FJGI 1IBKE 1IBLI 2NN6F 2BA0G 2UXCE 5FLXQ 3D4JA 5GMDA 4AIDA 2GS8A 1B62A 4OX9I 4HXZA 4OO1E 1XHKA 2BA1D 2JE6B 2XEXA 1XMQE 3CDJA 1IBME 2AJ4A 1Z59A 4DUYE 1USUA 1ZM3A 4DUZI 1USVA 4JI5I 2NN6E 4LFCE 3P3GA 3GMEA 1EA6A 1ZM4A 3CDIA 1RHYA 4B3SI 3M85G 1N0UA 2C39A 1HNWE 4LCFA 4JI4E 4OKGA 2WP8A 2EFGA 3WU3A 1Z0VA 5JEAD 2ZM6I 1H74A 2JEBA 4DPXA 5K36E 1KVKA 1EI1A 3WU5A 2A2DA 4IFDD 5BR8I 4HYMA 2CGEA 4DV5E 1N34E 2E5LE 4JI2I 4J3DA 4IFDF 4B3RE 2J7KA 4IS9A 4PRXA 4LF7E 5JEAC 2E1RA 3T1HE 4JI3E 4DR2E 3P3CA 4X66I 1RR9A 4JI1E 1FI4A 2NN6C 2DEJA 3J7AG 4OO1B 4JV5I 2IOPA 5K36B 5FLXC 4X65E 4IFDE 4Z7CA 5DNLA 2ZBKB 2HHHE 4MU4A 5IWAE 4X64I 3PYFA 2PO0A 3L7ZB 3PS1A 4NXME 5C0XD 3GONA 3P3EA 2O1VA 4MDTA 1MX0A 5ELWA 4LF5I 2J65A 1NHHA 4URLA 4USKA 1HR0E 1Z0WA 1Z5AA 1ZM2A 4FWHA 4YHHI 1N36I 5C0XF 2PNMA 2WNRA 4DV0I 1XNQE 4KHPI 1Z0EA 4LF8I 1N32E 2BM0A 3PS2A 3OTOE 4DR5E 4HY1A 3LNUA 5K36C 3PYGA 1UDQA 4M1KA 1YHCA 1KKHA 5C0XB 2V34A 4U3BA 2BR2B 3B82A 3M7ND 4LFBI 3B78A 2GO4A 1Z0GA 2O1WA 1U2RA 1UDOA 4K0KI 2R3VA 4LCHA 4XTJA 2OI2A 3M85D 1N33I 2VESA 5GMEA 5K36D 4DV3I 3QT5A 4JI7E 5DNXA 4AQYE 4MU1A 4LF6I 4DV4E 5A2QQ 4OZEA 2UUCI 4DR7E 1NHIA 1Y5YA 1XXEA 1DARA 4B3TI 4ZVIA 2PNZA 1Z0CA 1H73A 2Z5BA 2F1DA 4NBQA 4DR3I 1HNXI 4NXNI 4OO1F 2R42A 4I3HA 4X62I 4LF9I 1ZXMA 4FW3A 4MU3A 2UXDE 4JI0I 2UXCI 4B3RI 3HKMA 4JYAE 4RPFA 4DV1E 3K85A 3M7NG 2CZ9A 2NPFA 1BKNA 4FW9A 1HNZE 1Z5CA 2V2ZA 4IZJB 5DRQA 1PIEA 2WP8B 5LMNI 4DV2I 1OYSA 3K17A 1I94I 3GCMA 2C37B 2BA0D 1KTVA 2VQEE 4KQVA 1FWKA 4GKKI 3P06A 4JI8I 1J5EI 5JEAE 1NZ0A 3T1YI 1OJ4A 5C0XA 2Q2EB 4IZKA 4JI6E 2HK2A 5JEAF 2PO1B 4LFAE 1Y4SA 4DV6E 2JE6A 2VQFI 2HKEA 4DV7E 2HFUA 2V2QA 4FWDA 5LMUE 4DR1I 4DR6E 4YY3I 3QT6A 5FWKA 5IT9C 3B4TA 2UU9E 3J80C 4YY3E 1R6MA 5LMUI 2X7IA 3JAMQ 3CWVA 2VQFE 4OO1D 2UXBE 4LFAI 2UUBI 3K1JA 2UUAE 4JI6I 4DR4I 3T1YE 4MYUA 1J5EE 4JI8E 3QT8A 4ED4A 3J81Q 1S16A 3LTOA 2VQEI 2LJPA 4OO1C 2Z5BB 4DR4E 2UUAI 2UUBE 1PVGA 1I94E 3Q6MA 1Z0BA 4IFDA 2C39B 4DV2E 4QNKA 4AM3A 2UXBI 4P7AA 4LCGA 5K36A 1R6LA 1HNZI 5JEAB 3H4LA 3M6AA 3H1CA 1FKAE 4BA1A 4IFDC 1KIJA 2UU9I 1B63A 2O1UA 4USMA 1Z5BA 4NXNE 2IESA 4DV7I 4DR1E 4DR6I 4IZKB 2BM1A 4FWGA 3DD6A 4DV6I 2Z5EA 4DU8A 4B3TE 2O1TA 4ISAA 5DRRA 1FWLA 1D6TA 4R1FA 2UUCE 2C37A 4DV4I 4FW4A 4AQYI 4LF6E 4JI7I 4GKKE 1Y4UA 2JEAA 2VF3A 1WUUA 1N33E 4OO1A 4K0KE 2JEAB 3LPSA 5LMNE 5C0XC 4AIMA 2C38B 2O3ZA 2PO2A 2X36A 5DROA 4DV1I 4JYAI 3Q1QA 2CG9A 3ZZTA 1UDSA 4JI0E
chains in the Genus database with same CATH topology
3GCMA 2C37B 2BA0D 2NN6C 4OO1B 5JEAE 5K36B 4IFDE 5C0XA 3L7ZA 2PO0B 5JEAF 2PO1B 5JEAA 2JE6A 2PO0A 3L7ZB 1OYPA 4BA2B 5C0XD 4IFDB 2NN6A 3B4TA 2JEBB 1R6MA 3KRNA 2PO2B 5K36F 2NN6D 2PO1A 4OO1D 1E3PA 5C0XF 2WNRA 1E3HA 4BA1B 2NN6B 5K36C 2NN6F 2BA0G 1UDQA 4OO1C 1UDNA 4AIDA 4IFDA 2C39B 4AM3A 5C0XB 5K36A 1R6LA 2BR2B 4OO1E 5JEAB 2BA1D 2JE6B 3GLLA 3H1CA 4IFDC 4BA1A 3M7ND 3CDJA 2BR2A 1UDOA 5K36D 3M85D 2NN6E 2BA1G 3GMEA 3CDIA 3U1KA 3DD6A 3M85G 2C39A 2PNZA 2C38A 5C0XE 2WP8A 4NBQA 5JEAD 2C37A 2WNRB 2JEBA 5K36E 2JEAA 4OO1F 4OO1A 1OYRA 4IFDD 3HKMA 2JEAB 3M7NG 5C0XC 4AIMA 4IFDF 2WP8B 2PNZB 1OYSA 2C38B 5JEAC 2PO2A 4BA2A 1UDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GCM A;  2C37 B;  2BA0 D;  2NN6 C;  4OO1 B;  5JEA E;  5K36 B;  4IFD E;  5C0X A;  3L7Z A;  2PO0 B;  5JEA F;  2PO1 B;  5JEA A;  2JE6 A;  2PO0 A;  3L7Z B;  1OYP A;  4BA2 B;  5C0X D;  4IFD B;  2NN6 A;  3B4T A;  2JEB B;  1R6M A;  3KRN A;  2PO2 B;  5K36 F;  2NN6 D;  2PO1 A;  4OO1 D;  1E3P A;  5C0X F;  2WNR A;  1E3H A;  4BA1 B;  2NN6 B;  5K36 C;  2NN6 F;  2BA0 G;  1UDQ A;  4OO1 C;  1UDN A;  4AID A;  4IFD A;  2C39 B;  4AM3 A;  5C0X B;  5K36 A;  1R6L A;  2BR2 B;  4OO1 E;  5JEA B;  2BA1 D;  2JE6 B;  3GLL A;  3H1C A;  4IFD C;  4BA1 A;  3M7N D;  3CDJ A;  2BR2 A;  1UDO A;  5K36 D;  3M85 D;  2NN6 E;  2BA1 G;  3GME A;  3CDI A;  3U1K A;  3DD6 A;  3M85 G;  2C39 A;  2PNZ A;  2C38 A;  5C0X E;  2WP8 A;  4NBQ A;  5JEA D;  2C37 A;  2WNR B;  2JEB A;  5K36 E;  2JEA A;  4OO1 F;  4OO1 A;  1OYR A;  4IFD D;  3HKM A;  2JEA B;  3M7N G;  5C0X C;  4AIM A;  4IFD F;  2WP8 B;  2PNZ B;  1OYS A;  2C38 B;  5JEA C;  2PO2 A;  4BA2 A;  1UDS A; 
#chains in the Genus database with same CATH topology
 2UXD I;  4X62 E;  4LF9 E;  4DR5 I;  1ZXN A;  1HNX E;  5EKW A;  5A2Q C;  3B8H A;  4DR3 E;  2WW4 A;  4MYT A;  4DU7 A;  1MG7 A;  4DV0 E;  1XNQ I;  3L7Z A;  2PO0 B;  1A6F A;  1PKP A;  2IOQ A;  2HFS A;  4IZJ A;  5EL9 A;  5JEA A;  1N36 E;  1OYP A;  4FW5 A;  4DR7 I;  1HR0 I;  4DV3 E;  3QT7 A;  3HUL A;  4LF5 E;  3PS3 A;  1YH8 A;  4LFB E;  4MU0 A;  4PRV A;  4NXM I;  1Y6Z A;  2NN6 D;  2PO1 A;  4WUC A;  1H7S A;  4DPW A;  1P42 A;  2HHH I;  4QNJ A;  4DPY A;  4X65 I;  3OTO I;  2NN6 B;  4HAC B;  3UHM A;  3V5R A;  1UEK A;  3JAM C;  1N32 I;  4LF8 E;  3NZK A;  1H72 C;  4KHP E;  4P52 A;  4JI1 I;  4X66 E;  1UDN A;  2IER A;  3T1H I;  4DPT A;  3PRY A;  4JI3 I;  1H7U A;  2ZIT A;  4YHH E;  2CVE A;  1Y60 A;  4WUD A;  4JI2 E;  2HK3 A;  1N34 I;  2V8P A;  3GLL A;  3ZKB A;  4DV5 I;  2BR2 A;  5BR8 E;  4JG4 A;  4LPF A;  4MQY A;  3ZKD A;  2BA1 G;  3HJC A;  1S4E A;  2JT2 A;  2HKJ A;  1N0V C;  3U1K A;  2AE8 A;  5IWA I;  4X64 E;  2BV3 A;  3PYD A;  5IT9 Q;  1Z0T A;  2C38 A;  5C0X E;  3ZZ0 A;  3ZZU A;  4FW6 A;  2A2C A;  4JV5 E;  2WNR B;  4LFC I;  4JI5 E;  1NHJ A;  1ZM9 A;  1OYR A;  4DR2 I;  3Q6N A;  1XMQ I;  4FW7 A;  4DPU A;  4LF7 I;  3WU6 A;  2E5L I;  4OX9 E;  3PYE A;  3ZM7 A;  2PNZ B;  4EMD A;  1ELO A;  4BA2 A;  4FN5 A;  4U3D A;  1RRE A;  4N3O A;  3V2U C;  1IBK I;  4IZJ D;  2Z5C A;  2GQ0 A;  2ZM6 E;  1VI7 A;  2F4V E;  1FNM A;  4B3M E;  4JI4 I;  2Z5C B;  4DXL A;  1HNW I;  2PNL A;  4B3S E;  3J80 Q;  3J81 C;  4LF4 I;  4Z7Y A;  2V2V A;  4GKJ I;  1VIS A;  4BA2 B;  4IFD B;  2NN6 A;  4HAC A;  1MU5 A;  5L3J A;  4DUZ E;  4LOM A;  3U1Y A;  4DUY I;  2JEB B;  1IBM I;  4GQU A;  3KRN A;  2PO2 B;  1QZR A;  2DEI A;  5LL6 R;  5K36 F;  4GKJ E;  4LF4 E;  1E3P A;  4PU9 A;  4UT4 A;  3P76 A;  1E3H A;  3F0N A;  4UTG A;  4B3M I;  1K47 A;  2F4V I;  4WUB A;  1HK7 A;  3WU4 A;  4BA1 B;  1IBL E;  2GO3 A;  1FJG E;  1XNR I;  3J7A M;  1XMO I;  1XMO E;  5DRP A;  1XNR E;  1FJG I;  1IBK E;  1IBL I;  2NN6 F;  2BA0 G;  2UXC E;  5FLX Q;  3D4J A;  5GMD A;  4AID A;  2GS8 A;  1B62 A;  4OX9 I;  4HXZ A;  4OO1 E;  1XHK A;  2BA1 D;  2JE6 B;  2XEX A;  1XMQ E;  3CDJ A;  1IBM E;  2AJ4 A;  1Z59 A;  4DUY E;  1USU A;  1ZM3 A;  4DUZ I;  1USV A;  4JI5 I;  2NN6 E;  4LFC E;  3P3G A;  3GME A;  1EA6 A;  1ZM4 A;  3CDI A;  1RHY A;  4B3S I;  3M85 G;  1N0U A;  2C39 A;  1HNW E;  4LCF A;  4JI4 E;  4OKG A;  2WP8 A;  2EFG A;  3WU3 A;  1Z0V A;  5JEA D;  2ZM6 I;  1H74 A;  2JEB A;  4DPX A;  5K36 E;  1KVK A;  1EI1 A;  3WU5 A;  2A2D A;  4IFD D;  5BR8 I;  4HYM A;  2CGE A;  4DV5 E;  1N34 E;  2E5L E;  4JI2 I;  4J3D A;  4IFD F;  4B3R E;  2J7K A;  4IS9 A;  4PRX A;  4LF7 E;  5JEA C;  2E1R A;  3T1H E;  4JI3 E;  4DR2 E;  3P3C A;  4X66 I;  1RR9 A;  4JI1 E;  1FI4 A;  2NN6 C;  2DEJ A;  3J7A G;  4OO1 B;  4JV5 I;  2IOP A;  5K36 B;  5FLX C;  4X65 E;  4IFD E;  4Z7C A;  5DNL A;  2ZBK B;  2HHH E;  4MU4 A;  5IWA E;  4X64 I;  3PYF A;  2PO0 A;  3L7Z B;  3PS1 A;  4NXM E;  5C0X D;  3GON A;  3P3E A;  2O1V A;  4MDT A;  1MX0 A;  5ELW A;  4LF5 I;  2J65 A;  1NHH A;  4URL A;  4USK A;  1HR0 E;  1Z0W A;  1Z5A A;  1ZM2 A;  4FWH A;  4YHH I;  1N36 I;  5C0X F;  2PNM A;  2WNR A;  4DV0 I;  1XNQ E;  4KHP I;  1Z0E A;  4LF8 I;  1N32 E;  2BM0 A;  3PS2 A;  3OTO E;  4DR5 E;  4HY1 A;  3LNU A;  5K36 C;  3PYG A;  1UDQ A;  4M1K A;  1YHC A;  1KKH A;  5C0X B;  2V34 A;  4U3B A;  2BR2 B;  3B82 A;  3M7N D;  4LFB I;  3B78 A;  2GO4 A;  1Z0G A;  2O1W A;  1U2R A;  1UDO A;  4K0K I;  2R3V A;  4LCH A;  4XTJ A;  2OI2 A;  3M85 D;  1N33 I;  2VES A;  5GME A;  5K36 D;  4DV3 I;  3QT5 A;  4JI7 E;  5DNX A;  4AQY E;  4MU1 A;  4LF6 I;  4DV4 E;  5A2Q Q;  4OZE A;  2UUC I;  4DR7 E;  1NHI A;  1Y5Y A;  1XXE A;  1DAR A;  4B3T I;  4ZVI A;  2PNZ A;  1Z0C A;  1H73 A;  2Z5B A;  2F1D A;  4NBQ A;  4DR3 I;  1HNX I;  4NXN I;  4OO1 F;  2R42 A;  4I3H A;  4X62 I;  4LF9 I;  1ZXM A;  4FW3 A;  4MU3 A;  2UXD E;  4JI0 I;  2UXC I;  4B3R I;  3HKM A;  4JYA E;  4RPF A;  4DV1 E;  3K85 A;  3M7N G;  2CZ9 A;  2NPF A;  1BKN A;  4FW9 A;  1HNZ E;  1Z5C A;  2V2Z A;  4IZJ B;  5DRQ A;  1PIE A;  2WP8 B;  5LMN I;  4DV2 I;  1OYS A;  3K17 A;  1I94 I;  3GCM A;  2C37 B;  2BA0 D;  1KTV A;  2VQE E;  4KQV A;  1FWK A;  4GKK I;  3P06 A;  4JI8 I;  1J5E I;  5JEA E;  1NZ0 A;  3T1Y I;  1OJ4 A;  5C0X A;  2Q2E B;  4IZK A;  4JI6 E;  2HK2 A;  5JEA F;  2PO1 B;  4LFA E;  1Y4S A;  4DV6 E;  2JE6 A;  2VQF I;  2HKE A;  4DV7 E;  2HFU A;  2V2Q A;  4FWD A;  5LMU E;  4DR1 I;  4DR6 E;  4YY3 I;  3QT6 A;  5FWK A;  5IT9 C;  3B4T A;  2UU9 E;  3J80 C;  4YY3 E;  1R6M A;  5LMU I;  2X7I A;  3JAM Q;  3CWV A;  2VQF E;  4OO1 D;  2UXB E;  4LFA I;  2UUB I;  3K1J A;  2UUA E;  4JI6 I;  4DR4 I;  3T1Y E;  4MYU A;  1J5E E;  4JI8 E;  3QT8 A;  4ED4 A;  3J81 Q;  1S16 A;  3LTO A;  2VQE I;  2LJP A;  4OO1 C;  2Z5B B;  4DR4 E;  2UUA I;  2UUB E;  1PVG A;  1I94 E;  3Q6M A;  1Z0B A;  4IFD A;  2C39 B;  4DV2 E;  4QNK A;  4AM3 A;  2UXB I;  4P7A A;  4LCG A;  5K36 A;  1R6L A;  1HNZ I;  5JEA B;  3H4L A;  3M6A A;  3H1C A;  1FKA E;  4BA1 A;  4IFD C;  1KIJ A;  2UU9 I;  1B63 A;  2O1U A;  4USM A;  1Z5B A;  4NXN E;  2IES A;  4DV7 I;  4DR1 E;  4DR6 I;  4IZK B;  2BM1 A;  4FWG A;  3DD6 A;  4DV6 I;  2Z5E A;  4DU8 A;  4B3T E;  2O1T A;  4ISA A;  5DRR A;  1FWL A;  1D6T A;  4R1F A;  2UUC E;  2C37 A;  4DV4 I;  4FW4 A;  4AQY I;  4LF6 E;  4JI7 I;  4GKK E;  1Y4U A;  2JEA A;  2VF3 A;  1WUU A;  1N33 E;  4OO1 A;  4K0K E;  2JEA B;  3LPS A;  5LMN E;  5C0X C;  4AIM A;  2C38 B;  2O3Z A;  2PO2 A;  2X36 A;  5DRO A;  4DV1 I;  4JYA I;  3Q1Q A;  2CG9 A;  3ZZT A;  1UDS A;  4JI0 E; 
#chains in the Genus database with same CATH homology
 3GCM A;  2C37 B;  2BA0 D;  2NN6 C;  4OO1 B;  5JEA E;  5K36 B;  4IFD E;  5C0X A;  3L7Z A;  2PO0 B;  5JEA F;  2PO1 B;  5JEA A;  2JE6 A;  2PO0 A;  3L7Z B;  1OYP A;  4BA2 B;  5C0X D;  4IFD B;  2NN6 A;  3B4T A;  2JEB B;  1R6M A;  3KRN A;  2PO2 B;  5K36 F;  2NN6 D;  2PO1 A;  4OO1 D;  1E3P A;  5C0X F;  2WNR A;  1E3H A;  4BA1 B;  2NN6 B;  5K36 C;  2NN6 F;  2BA0 G;  1UDQ A;  4OO1 C;  1UDN A;  4AID A;  4IFD A;  2C39 B;  4AM3 A;  5C0X B;  5K36 A;  1R6L A;  2BR2 B;  4OO1 E;  5JEA B;  2BA1 D;  2JE6 B;  3GLL A;  3H1C A;  4IFD C;  4BA1 A;  3M7N D;  3CDJ A;  2BR2 A;  1UDO A;  5K36 D;  3M85 D;  2NN6 E;  2BA1 G;  3GME A;  3CDI A;  3U1K A;  3DD6 A;  3M85 G;  2C39 A;  2PNZ A;  2C38 A;  5C0X E;  2WP8 A;  4NBQ A;  5JEA D;  2C37 A;  2WNR B;  2JEB A;  5K36 E;  2JEA A;  4OO1 F;  4OO1 A;  1OYR A;  4IFD D;  3HKM A;  2JEA B;  3M7N G;  5C0X C;  4AIM A;  4IFD F;  2WP8 B;  2PNZ B;  1OYS A;  2C38 B;  5JEA C;  2PO2 A;  4BA2 A;  1UDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...