3CDKA

Crystal structure of the co-expressed succinyl-coa transferase a and b complex from bacillus subtilis
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
229
structure length
229
Chain Sequence
GKVLSSSKEAAKLIHDGDTLIAGGFGLCGIPEQLILSIRDQGVKDLTVVSNNCGVDDWGLGLLLANKQIKKMIASYVGENKIFERQFLSGELEVELVPQGTLAERIRAGGAGIPGFYTATGVGTSIAEGKEHKTFGGRTYVLERGITGDVAIVKAWKADTMGNLIFRKTARNFNPIAAMAGKITIAEAEEIVEAGELDPDHIHTPGIYVQHVVLGASQEKRIEKRTVQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A
publication title Crystal structure of the co-expressed succinyl-CoA transferase A and B complex from Bacillus subtilis.
rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 67
structure length 229
sequence length 229
chains with identical sequence C
ec nomenclature ec 2.8.3.5: 3-oxoacid CoA-transferase.
pdb deposition date 2008-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01144 CoA_trans Coenzyme A transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1080.10 Alpha Beta 3-Layer(aba) Sandwich Glutaconate Coenzyme A-transferase Glutaconate Coenzyme A-transferase 3cdkA01
3RRLA 1OPEA 1M3EA 3OXOA 2NRCA 3QDQA 1XR4A 5DBNB 1O9LA 1POIB 3CDKB 2NRBA 3DLXA 2OASA 1OOZA 2HJ0A 3D3UA 3EH7A 5DBNA 3CDKA 1POIA 1OOYA 3RRLB 3GK7A 3K6MA 2AHVA 2AHWA 1K6DA 2AHUA 4KGBA
chains in the Genus database with same CATH superfamily
3RRLA 1OPEA 1M3EA 3OXOA 2NRCA 3QDQA 1XR4A 5DBNB 1O9LA 1POIB 3CDKB 2NRBA 3DLXA 2OASA 1OOZA 2HJ0A 3D3UA 3EH7A 5DBNA 3CDKA 1POIA 1OOYA 3RRLB 3GK7A 3K6MA 2AHVA 2AHWA 1K6DA 2AHUA 4KGBA
chains in the Genus database with same CATH topology
3RRLA 1OPEA 1M3EA 3OXOA 2NRCA 3QDQA 1XR4A 5DBNB 1O9LA 1POIB 3CDKB 2NRBA 3DLXA 2OASA 1OOZA 2HJ0A 3D3UA 3EH7A 5DBNA 3CDKA 1POIA 1OOYA 3RRLB 3GK7A 3K6MA 2AHVA 2AHWA 1K6DA 2AHUA 4KGBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RRL A;  1OPE A;  1M3E A;  3OXO A;  2NRC A;  3QDQ A;  1XR4 A;  5DBN B;  1O9L A;  1POI B;  3CDK B;  2NRB A;  3DLX A;  2OAS A;  1OOZ A;  2HJ0 A;  3D3U A;  3EH7 A;  5DBN A;  3CDK A;  1POI A;  1OOY A;  3RRL B;  3GK7 A;  3K6M A;  2AHV A;  2AHW A;  1K6D A;  2AHU A;  4KGB A; 
#chains in the Genus database with same CATH topology
 3RRL A;  1OPE A;  1M3E A;  3OXO A;  2NRC A;  3QDQ A;  1XR4 A;  5DBN B;  1O9L A;  1POI B;  3CDK B;  2NRB A;  3DLX A;  2OAS A;  1OOZ A;  2HJ0 A;  3D3U A;  3EH7 A;  5DBN A;  3CDK A;  1POI A;  1OOY A;  3RRL B;  3GK7 A;  3K6M A;  2AHV A;  2AHW A;  1K6D A;  2AHU A;  4KGB A; 
#chains in the Genus database with same CATH homology
 3RRL A;  1OPE A;  1M3E A;  3OXO A;  2NRC A;  3QDQ A;  1XR4 A;  5DBN B;  1O9L A;  1POI B;  3CDK B;  2NRB A;  3DLX A;  2OAS A;  1OOZ A;  2HJ0 A;  3D3U A;  3EH7 A;  5DBN A;  3CDK A;  1POI A;  1OOY A;  3RRL B;  3GK7 A;  3K6M A;  2AHV A;  2AHW A;  1K6D A;  2AHU A;  4KGB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...