3CE1A

Crystal structure of the cu/zn superoxide dismutase from cryptococcus liquefaciens strain n6
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
153
structure length
150
Chain Sequence
IKAIAVLKGDSPVQGVITFTQEGPVTVSGEIKNMDANAQRGFHVHQFGDNSNGCTSAGPHFNPTGTNHGDRTAEVRHVGDLGNVKTDASGVAKVQISDSQLSLVGPHSIIGRTIVIHAGEDDLGKTDHPESLKTGNAGARSACGVIGIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Cu/Zn superoxide dismutase from the heavy-metal-tolerant yeast Cryptococcus liquefaciens strain N6.
pubmed doi rcsb
source organism Cryptococcus liquefaciens
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
total genus 38
structure length 150
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3ce1A00
2WWOA 1COBA 2XJLA 1B4TA 2JLPA 3GZOA 1E9PB 1UXMA 1S4IA 1Z9PA 2AF2A 2ZKYA 4OH2A 1SXSA 4A7GF 1KMGA 3K91A 1SDAB 3MKGA 1EJ8A 2R27A 1MFMA 2LU5A 3GTTA 1EQWA 1SPDA 1E9QB 4MCNA 1L3NA 1SXNA 1YSOA 2VR6A 2Z7ZA 3L9EA 4U4IA 3L9YA 2ZOWA 3CQQA 1QUPA 1P1VA 4A7UA 2C9VA 3S0PA 1XSOA 3CQPA 3SODB 3QQDB 3KBEA 5KBKA 2WWNA 4BD4A 2WYTA 1OAJA 3ECVA 1CB4A 1Q0EA 4FF9A 2AQPA 3KH3A 1YAZA 2JCWA 2E46A 2XJKA 2WZ0A 3LTVA 1F1GA 2GBUA 3GZPA 1IBBA 2WYZA 2V0AA 3F7LA 1DSWA 1PTZA 2AQSA 2WKOA 3PU7A 1TO4A 1UXLA 1SXZA 1IB5A 1B4LA 2VR8A 1XTMA 3GZQA 1JK9B 2AQNA 2AEOA 2APSA 2E47A 3T5WA 1N18A 1TO5A 3GTVA 2VR7A 2AQQA 1OEZW 2AQRA 1Z9NA 3KBFA 1OZTG 4MCMA 3H2PA 2SODB 4A7SA 3F7KA 1N19A 1SDYA 1YAIA 1IBHA 3HW7A 1SRDA 3KM2A 4L05A 1PZSA 3GQFA 2NNXA 2Q2LA 3H2QA 4A7TA 3ECUA 4BCZA 5KBLA 3CE1A 1E9OB 1SOSA 1CBJA 2C9SA 4A7QA 1JK9A 2WKOF 4OJAA 3RE0A 3KH4A 1SXAA 2GBVA 1XTLA 4A7VA 2K4WA 1BZOA 1RK7A 3ECWA 5KBMA 1SXCA 3QQDA 4A7GA 4BCYA 3HFFA 1E9OA 1AZVA 2Z7YA 1F1AA 1HL5A 4N3TA 1F1DA 2ZKXA 1F18A 4N3UA 1U3NA 1IBDA 5CU9A 1PU0A 1E9QA 2GBTA 1DO5A 3HOGA 1SXBA 4B3EA 2Z7UA 1JCVA 2ZKWA 3MNDA 1BA9A 2AQTA 1OZUA 2Z7WA 1E9PA 3KM1A 1IBFA 1OALA 1ESOA 2WZ6A 1HL4A 1FUNA 2C9UA 2WZ5A
chains in the Genus database with same CATH superfamily
3VXUD 5L88L 5J11B 2Y1AA 2AF2A 3CFUA 4RVBA 1DQDL 1RXLA 2X42A 4AKPA 3C12A 5ESQB 1BJMA 3K72B 1BQSA 4LCYA 1UWEL 5CKGA 1T22B 3UG5A 5BV7B 1FN4B 4F92B 1VKXA 3CFKB 1QFWM 1JZIA 4GT7A 2E6JA 4GT0A 5EB9A 4YSCA 2EEFA 5F6HI 2CXKA 1JHKH 5CP3H 2BIIA 3WUZA 5ACZB 5BO1H 2NRDA 2DTMH 1MWAL 2F61A 4U6YB 5HHOA 3FOLA 1WCBA 2JJUA 3U36A 3ULVE 2CWRA 5CGYD 2DY2A 1NFDA 5JQIB 2NY0C 3E6FA 3UO1L 2HFGL 4ZMXA 2WOBA 2FJGA 2WTOA 3R0NA 4FFZL 2FT8A 1EHNA 2RCSH 3CD4A 4F57H 4WWID 5SWZB 4MNQA 2HVKA 3U1QA 5CWSA 2VUYA 1OGAA 3GMQA 4X0KA 3VFWB 3B6SA 3NJLA 3PWJB 3UERA 2AJVL 3WEXB 4TUUA 1KCWA 2DYPD 3QWQB 2NR6C 1D6EB 4NUPA 1EVTC 3IAPA 1HEHC 1JI1A 1QBMH 4G3YH 1I3UA 2EVFA 5K5YA 2HPOA 4F3FA 2BVEA 4NO2A 1QLEL 2LLGA 2PW2B 1UVQB 3KPRB 1FRGL 1E4HA 2VE6A 4AE1A 4OSUH 3OJDA 1P7QA 2ZNWA 4KKLC 4WJ5A 5EZIH 4NXKA 5DD5L 4L8DB 5HI4D 3CMGA 3REVA 2DAVA 1SYVA 4B9YA 1GTNA 2VLLB 4ZUUB 2I07B 2XBDA 2WXIA 3CDFA 3EJPA 2RCSL 4U1GB 2X4SA 4QIRA 4PWHA 3T2NL 2H7WA 5C71A 4JO2L 4UUJB 4AC2A 1M7DA 1HDMA 1ZTXH 3C08H 4Y1AD 4NQDE 2OK0H 3A6BL 1B6DA 4M5YH 1XF5A 4HFUL 4PJHF 3TCTA 1IKFH 4Y5VB 1J88A 2FR4A 2DTML 4HPYH 5LGHL 5IOPA 5I6OA 2KYIA 1NICA 1XGYH 1ACXA 1E4KA 5DJYB 3RFZB 3V0WL 4HUNB 3ZU8A 2PWEA 3I84A 3T65A 2R23B 5TE6H 1E6JH 5BS0A 4Z7AA 5JHBA 3AS2A 2BOBB 4GSDH 3IGUA 4WFFD 2DQMA 1DLHA 2BP5M 2W38A 3FYEB 2EDXA 1EAQA 2FWOA 4CKVX 3D1MC 4Y5VC 3D9AH 1YEHL 3RLSA 1E4KC 3BLBA 3FFOA 3O6ML 4KGJA 4NS0A 3NIGE 4JPKH 4OI9A 4XPGL 2D8KA 3MRKA 4XP5L 5I8KL 4BK5A 2ZWNA 1T66D 4G6ML 1R3LA 2R7EA 5IBTH 1CFSB 2JJSA 4G6MH 4NQCE 5DQ9A 3FTVA 2JE8A 3KL0A 4G7QB 5D4QA 3VH8B 4AM0A 4BKLB 3WN6A 5C6TL 3VCLA 3WTUA 4AM0Q 4Z77B 4PTTA 3L6FB 3H3PL 4IRZA 4IS6B 1I7ZB 4IKLA 4GKNB 3TH2T 4PGEB 5C09B 4ZG1A 4RNRA 3UCQA 3KJ6H 1XGQA 3FDWA 3TA3A 3VW3L 5BVPH 1D9KC 4GW5A 4NDMA 5DUJA 4L3ED 2JCWA 2A6KA 4Q9CA 3Q13A 4N90D 5E08H 2K7QA 5KVDL 4GRMB 5BZZA 5AAWC 3RPIA 6CGTA 2OZNA 4YL4A 4ALAC 3QPQC 2XRAH 3MJWA 3LQZB 4JDEA 3O2VH 2FYYB 5DJ8A 1P4BH 4HPYL 2JB5L 4AYMC 1LO4L 1GGCL 1LQBC 3C5XA 3JWNH 3K6NA 4BUQA 5AW1B 3WTTA 4OZGA 2HG5A 4U6TA 1NCCH 1OV8A 2OPCA 5I0XA 2CQVA 3PNWA 5JPMA 1DBML 5F3BB 3B2PA 1NOAA 1QSFA 2X10A 3FONB 4PJAF 2VLKA 3VWKA 4JY4B 4OFYA 4MXVF 3LIZA 1KBPA 4HYTB 3KL3A 4U7KA 1MHEA 1Q38A 2OULB 3OWRA 5ADPL 1RIVH 2Z0BA 1AP2A 5ICXA 2O30A 1XVSA 1Z3RA 2DI8A 3O45B 2X05A 5BRZB 3LRLA 4DP2X 4XBPB 5LN8A 2WKOF 4L2LA 2A74C 2YUZA 4GSQA 4M4RA 1MHCB 3KYNA 3SDCD 1YNLH 4GKSB 3HVNA 4Y4HD 3TIDB 2VXTH 1TENA 3L9BA 1UACL 3H6AA 5I6XB 2DKSA 2EDBA 2ADYA 1BFSA 4K07A 4JKWA 4ZMWA 5AW3B 2RJMA 4XVOA 3IFLH 3V0EA 3AT0A 1HILB 1IC5H 5INDA 3PYCA 2ZKXA 5ALBL 2KC0A 2QL1A 2A74A 2AI0H 2DN7A 2QMKA 2W60B 3FUKA 5CIPH 4EN2A 3IVKA 4HHAB 3QRLA 5DURB 1DO5A 2UWEF 4JY4A 4YWGL 5IROA 5IVXA 1QPXA 3L9RB 1Z5HA 2RQEA 4UTBL 4JN2A 3HC3L 5F7EL 1TCMA 4JFDE 4L0ZA 2NYYC 5DMKA 1CICD 4GRLD 3U1SL 2YXMA 2WUCH 4IRJB 4PG9B 2GC4C 1WF5A 1AR1B 2JK5B 1BZ7A 4JM2B 4HKXB 1XXDC 2BIMA 3GJFB 3VXUB 1TQCB 1NCAH 1KFGA 3FRUB 5A2IH 1YEGH 4N2AA 4AEEA 5D7JD 1ZVNA 4X4YA 1EQWA 3MX0A 1WPCA 2BWDA 3VRJA 3BKYL 4KOCA 1P1VA 3LMJL 2H6PB 3KLHC 3ZHNA 2GPZA 5AOLA 3ZY7A 5HHME 4WFHE 1G94A 4TUJB 1SN0A 3VI4A 3BAYA 5CBAA 3T0EC 5E2WL 2Z3FA 1K85A 1F42A 1BYPA 2DMGA 3GIVB 5D4JA 3O2WH 4JFTA 3R1GH 2YPLE 4AT6A 2Q6WB 4E9LA 3TNNA 4F7KA 1I8IA 2ESVD 4PD4J 3VXSB 4KXDA 1SOQA 2R0KH 1XBRA 1UYWH 4G6JL 4XNYH 4MD5B 4FZEL 1DBKH 2OMZB 2J43A 3MLWL 4H1LG 2OQJA 4LU5H 3EOTH 1J0KA 1CI5A 3HUJB 1ZY9A 1TTBA 2BP8B 3KW7A 2G5RA 1IGCH 3L7EA 4GAGL 4RFEA 3SPJA 5HY9B 3GSRB 1SJMA 1FNGB 1C1EL 4A7SA 5B1JA 5TDPB 4O02A 4FFVC 3C87A 3QRBA 3CFDB 3GUTA 4LSTL 3RGBA 5CUSL 4U1MA 1MCJA 3H2QA 4GKLA 2Z65C 1WIPA 4KX9A 1ZLVH 3L1EA 3DROA 3O3BA 1EEYA 2XTSA 2A4EA 1GGTA 4I9WD 3K0YA 5D8JL 2DQIH 3BUQA 1KG0A 5CD3B 2A6JB 5KTEL 1A65A 2GBVA 5CJOL 5KYWB 5HJGA 1HDMB 1PNDA 1TZIB 1XCQA 3ARED 5ANMB 3QDME 5JXEA 1ZS2A 1XIWD 2X44D 5GZNC 4LSUL 4PJDF 3ARWA 4NHCH 3SZ6A 1U8MB 3EFDL 4EI5D 4Y4KA 1IKNA 2F08A 3S37H 3VI3E 5JDJA 2DYRB 5ACLA 1QSEE 3QCTH 3DHPA 2R39A 2D0HA 3ZYZA 1Z6JT 4FMKA 2K1MA 1SXBA 2OTPA 2Z7UA 4M5TA 3RI5F 4MVBC 4WW2B 3QYNA 5FOBA 5HGDB 1IGTA 3GRWA 4Y4HC 5F7BA 4XH2A 2QHRH 1X3DA 3APCA 2JKJA 3LHAA 4POUB 3AU0A 1BQ5A 2CIKB 3E1ZA 4PS3A 3FFCE 3QXUA 4WI0B 2IH1B 4LGRB 3LRSB 3N1PC 2HN7B 1KZQA 1I31A 2NY2B 2O6FA 3L3OB 4MDRA 2E7CA 1JNNL 1KIRB 2EXYC 4NZ8A 4WU5A 5HYSA 2C3VB 4YFDB 3KPSB 4Z95H 3BCFA 1JV2B 3CPLB 4KUCF 2W9DL 1EDQA 4C56E 1HE7A 5BS0E 2CUAA 1CFBA 3GSUB 3MODH 3TCLA 4D9LL 1WFMA 1B0IA 4KDVA 4OCXH 4NLAA 2EDEA 3FC8A 4R7LA 4XBEL 5FFOA 4HD5A 1TT6A 3V10A 4H88L 2NY2C 3OAUL 3OF6D 3RVUD 3PHSA 1GZQB 2V17L 4XB8A 5DUMH 4F15C 3RDTA 1N5AA 1CB4A 2ZOLA 1ZHNA 2G2NA 3PNRB 3F6IA 4HEME 4TLTA 4UM8B 1W0YT 5LN4A 5TE4L 5DT1L 1KJVB 2IBBA 4YK4C 3DX0A 4G80A 4XNMB 3HFMH 3EOBA 5DHYB 2VTFA 4ILDA 3BE1L 4NP4H 1F58H 2CDEA 4IYKA 3DLQR 4NEHB 5SWZE 4CADA 3GMMB 3BT0A 4L29B 4K23H 3S35H 1I9RH 5ABDE 5KZCD 2ZWYA 1XF3A 1I8MB 1EVUA 4R4ND 5LUMA 1UXSB 1B3JA 1UJTA 3HFML 1F6AB 4G43B 4FXGC 3QIUB 3HBZA 3MRFB 2UX6A 3HMXL 2HKHH 5FB8A 5DT1H 1UD4A 1KUMA 1KLUB 1UOWA 1NCDL 2VN4A 3NYKA 4FKEA 4NB7A 4X5PA 3D06A 4JZOA 1UXSA 5EDXA 3RIAF 2ID5A 5FUZH 3IGFA 3U46B 1NL0L 2CA3A 4HC1L 1ONQA 3QJTB 4OAWB 3VQ2C 2NY4C 1XMEB 3LOWA 4CMMB 3PWVA 3OB0K 2QPUA 2XCMC 5AVRB 2Y7LA 2AJSH 3RUGA 5GRYA 5J3HC 3V0JA 3W0WA 3TWCL 1NEUA 1BG1A 2CCLA 2P5ED 3OKLB 3L5WB 4U1HB 1W15A 4KZ0A 2J56A 1SBSH 2YC1B 4LASL 4LSVH 4WDIB 5CEZE 3ILPA 4R2GD 3EYVA 4UI2A 2NXZB 4Z78A 1QRNA 4E0RB 2X3CA 1NGXB 2DM7A 3J7HA 4G6AC 3V6FB 4XP4H 5FFGA 4UYPA 4I18B 2AV1B 1PDKB 1ZGLB 1J48A 2K70A 5EBWA 4OTXL 3BGMB 1KC5L 3IJSA 4S1DD 2NY6D 4OCYL 5JIKA 3BDBA 2ED6A 3O9WC 3OX8B 5CEXA 1IC7H 2ZE0A 1JP5A 1JPFA 2XICA 1FLTX 2ADIA 2VGLM 1JK8B 4LIQE 4BQ8A 1ULVA 2KH2B 3MNZA 2QKSA 3RX8A 1GGYA 4E41D 3LIUA 2BVUA 3NIGB 4YSDA 4PLJD 5DTFB 4A39A 2IH1A 1AGFA 4I18C 1OM3L 5T33L 2VDKL 1CFNB 5CZVH 5D2NC 4ZUWA 3ZGHA 3T4AA 1ACZA 4MHHG 1L3NA 5KTEH 3ZKQD 4OZGF 1HK6A 3O9WB 5KS9F 3WNNA 4P46A 5EO9A 5KBDA 4Z7VE 2HAZA 2VQ1B 5IESH 3FQ1A 5DVLA 1OF0A 4PVBA 5KVFH 3AGVA 4ZX6A 5CEZH 5MEOB 5ILTL 4ERSH 3DYOA 4M5ZL 4XWOC 2VO8A 3VYPA 5JXAL 4S1RL 3T9WA 2V2TA 2P4AB 4MS8D 1TVHB 1A3LH 2CO2A 2WSKA 1TJHL 5IB1B 1ZA6A 3Q8FA 3N06B 3QO0A 5IOKA 5G4NA 3T1WA 4XC1H 1DSWA 4GO8A 4UZGA 1YEJL 3HI1A 2ADIB 3T8VA 3P4OB 4HSQA 4DF9A 2P1YA 3ARGB 2BNQA 4I2XA 4BINA 3BP4A 2UXGA 3M88A 3CZLA 1ND0A 1OP3H 1GYAA 1CICA 4GRLA 3O3BB 2WZAA 3IGLA 3GLDA 1F4HA 4WJG3 4PJFF 2GKIA 3S48A 4DKEH 3SE3C 3V6FA 4Y19B 2DQFB 1YYMH 3IJYB 1NGXA 2X2JA 2P5WD 2HRLA 3PP4L 5J1AB 3QUXB 3CSGA 1UEYA 3ZR5A 4JHVA 2E7MA 3QUGA 2R8SH 5BRZE 5F21B 2BVPB 4URTB 4Q4IA 5C8JB 3LEVL 4LCCA 1L7IL 1MWOA 3UC2A 4X4KA 4BZYA 4HC1A 4X6CF 4YC2C 4HUMB 4MXVE 1FORL 1M9WA 1XD1A 4NRYB 1P5UA 5BOPA 4YPGA 3MLZL 3AREB 4N2FA 2AP2A 3LD8B 3CBKB 3ECWA 4L5FH 4LCCB 3G5XA 5I1KL 2H3XC 1HSAA 1P4UA 4KJYA 3FUEA 4L37B 2CHWA 5IB4A 3QYMA 2QLVB 2IOIA 3IFPA 3O8XC 1QLRA 3TPKA 4E2OA 1L5GA 1CQYA 3ZTDC 3NJFA 1QEWB 3HC3H 3HLKA 4JK0D 2O5ZH 4JGMA 3LNEA 2WBWB 1A7RL 3RVWD 3VRJB 3EGDB 3FB7A 3WDJA 4JFSA 4G7VL 5E7BA 4L8CA 4KY1L 4ZOAA 2CZNA 1KCUH 1J8SA 1PZDA 1QW8A 3L17A 5DUBA 2WY3B 3FO0H 4B97A 3EYSH 3VXUE 4P59L 1MW3A 4UQ2A 4E9XA 3R4RA 4WO0A 2JJWA 4OLXL 1IGIL 1TXKA 3QO0B 3ARBD 2DJMA 4LGSB 1AAJA 3ZDXF 4R84A 5JOFA 2OYKA 4CC4C 1AQDB 2OCCB 5C08E 5HHMB 4NO3A 4AYFB 1G7JB 2FGZA 1Q72L 5JXED 3P4LA 1FDLH 4M7KH 1MFNA 1I85A 4LLMB 2B14A 4MA1B 3PDOA 3GO1H 4V2BA 3VNYA 4ZTPH 1KN2H 2YPLB 4LVNC 2PMZA 3AG3B 1TVDA 1OGTA 4GPVA 3WENA 2WLNA 4NC0B 2RA1A 5GRJL 3SQOL 1QAWA 2KI6A 2CIKA 4PJ7A 3QAZC 4Q2ZA 3EBIA 3L4CA 4KTYA 5GZNA 1U30A 1WD9A 1GGCH 4FD0A 3SGKC 3NCWA 1A21A 3S3DB 1N5YL 2HFTA 4WWKA 3KDMB 3L7FA 2XIBA 2CXGA 4U1GC 1DP0A 5F9JB 5KVDH 5E70A 5CU5A 1IC4H 3HNTL 4JQVC 4NZRL 1T7YA 4IU2B 2AXFA 3N85H 4O4YH 5F88B 2FD6L 3IDMB 4KHTH 3V2AR 2VDOL 1XSIA 3O11B 1NBVH 3KYMB 1WTLA 3CSYA 3LPOA 3SE9H 4C58B 2KLTA 5B39A 1AQKL 5SWSD 5JOPE 1DO6A 4HDIB 5KS9A 4BA0A 2YOCA 3H56A 3TS8A 2XV6B 3ZHFA 3V4PL 2CKBB 4ODTL 1XGTA 3OKMA 4RESB 2P5EB 5AL0A 5DS8B 5FM5M 1BAGA 5JUEH 2ADJB 4AE0A 4LCIL 2CBOA 1RSFA 3MDJA 4LOUD 3V0IA 1T4WA 1G5AA 5L8JB 4GW5B 4FQHB 3GRGA 4MA8L 1YEHH 2PYFA 4UDTA 3H0TA 3RVVC 3WE1A 4FFWC 4L0PB 3WMQA 4NZDA 2ITCA 3CXDH 3W11D 3O41B 4HIEB 3EYQD 1J86A 4FYTA 2WVVB 2OQJB 1U2YA 5D1ZD 4IBWA 5I71C 3X12B 3WE6B 4ZTEA 3JXAA 1FFNB 1I7UA 5IKCA 4BA8A 3LN9A 3SEPA 3KLKA 5H35A 5DLML 4KJWD 4EZLA 1UATA 3OLGA 1N5YH 2WPGA 2BW4A 2CNYA 3LS5L 1CD9B 1BEYL 3HEIB 5KZCB 3L4YA 4HA1A 4ODWB 3C6LD 4NFCA 3SDDA 4E41B 4F7TB 3EGSA 1KJ2L 4PJFB 4CVUA 3LRMA 3MRDB 4EN3B 1DFBH 3E1F1 3UAJD 3GS0A 3HR5A 4FQQA 5B1CA 3TFBA 1O7DE 1UUNA 4ELMA 3K6OA 4FQJL 2Q8AH 1PFOA 4N4YB 5IK3A 2PYFB 4UDTB 1F3JB 1MLBB 4QF1B 1MG2C 2R23A 4QRPA 4Z23A 3AITA 5CGBA 3TFKC 5DDHA 3VGDA 3RFZA 1AO7A 5IR1B 2XX0A 2UX7A 3FT1A 4YHZL 3N44B 5G5DB 2CPUA 4OQTA 1H6FA 4KO6A 3VXQB 4WWOA 1EFXB 3VXSE 3A0OA 3ABKB 1VHPA 2DLIA 3X1NA 4AENB 4H0IA 4M8QA 1YEFL 2VITB 3EADA 3Q8BA 1ZPLA 1YO4A 3QEHA 2NXZD 3QXTA 4NM4H 4H8UA 4WWKC 1A0QH 4JFED 2GSIA 2HFEB 2VR5A 1DCEA 4JDTL 1AQMA 4MRCA 2GK0B 3L3GA 1UH4A 3TPUB 5LNDA 2E8YA 2ETWA 4DP7X 2EACA 2D7MA 2VLLA 5EBMB 4ZUUA 5AB1A 3US1A 1U91B 1YN7B 3MLTB 4KVCH 3KWXA 1A1NA 3HJ0A 3DJRA 4H26A 3HG1D 4DT2A 5D71L 3R7RA 1WISA 3MRMA 1TZHB 2A74B 4Y0GA 1A7RH 3L7FB 1A4AA 3AQYA 4WWKB 1UVQA 3RGVC 3WJLA 4N5EC 3C6LB 4WTQA 1N19A 4M4PA 5AW7B 2AJUH 4N0CD 4JPVH 2XV3A 3I3BA 3H6JA 3Q8EA 1OE3A 2BFVL 4H8QA 5FHBH 4NWTH 2WB1A 1CT8B 3OAZH 4G8AC 4QXWA 43C9B 3FT4A 1NPNA 4M4RB 2Z8SA 5MI0B 3OPUA 5DCCA 3TO4C 5JPMC 3U7YL 5LXGL 3F7PC 2GK0A 2ESVE 1IC1A 3MV9E 4PJDB 4OV5B 2K4WA 1TDQA 2FBRA 1BVKB 2CDGB 2FJFA 2QKIB 4LF3B 4GUQA 3IDIB 3JWNG 1T1YA 2VDQL 1AR1C 4JCMA 4GXVH 3LKSB 4PS4H 5F9DC 4U1MB 4K3GA 5JPMB 1F11B 3EOYG 1AGDA 1TQCC 1D6VL 3GDCA 4HQQH 1NMBL 2XV0A 3CFDA 1YPZA 5DDHB 2M1KA 4JFWA 4G42B 5ISZA 4PLOB 3ULVH 1QVOA 3OKKB 1MFEH 2WXNA 4X7SL 1INQB 2G30A 5KN5A 4EIBA 1EA9C 5B8CA 4BSVA 1PZCA 2WZ6A 2PWDA 4KRMB 3GLEA 2Y07H 4NQTA 2XXCB 3A67H 4K2UL 1MN4A 4MD5A 4GLRI 4P2RA 3ARSA 4J4PA 2R27A 3D7PA 1I7UB 4MNGE 4LBEA 1AD0A 4YXKL 1YHPA 4YIQA 2OTUA 3IT8D 2FZ3A 3TNMB 5LLIC 1HOEA 3AG1B 3K2MC 4Z7VB 1S9YA 2PP7A 4S1RH 4R4BB 5F6IB 2LV4A 3W1ZA 4XMUA 2L3BA 2BNRD 4RX4A 4JJHA 4OFQA 4AEIH 5IV2A 1N2RB 4HIIB 4DGIH 4XVSL 3BWUF 5B1KA 5C07E 2Z35B 3A47A 3BP7A 5C0CB 1CG9B 4FOMA 3WOVA 2R83A 3P02A 4N2GA 4AYSA 1OM9A 1M2VB 1RV6X 1WDAA 4BSVB 2P3YA 3RKDC 4ZOBA 4DP0X 1ROCA 3I50L 1FF5A 1K72A 2WLYA 1EV2E 3ESPA 3KYOA 4ZFOL 5EIQA 3CHRA 1RZGA 4Z3HA 2BSTB 2H3NA 1INEL 2AABH 4LHUD 1UQSA 5LCVH 5C7XH 1SLUA 3GBML 1WFTA 2AANA 2XLLA 1OZTG 3BD5A 5C0EA 3LHPH 4KKAD 4MMZB 5T1LD 4V2CB 1QFUH 2H8PA 1T04B 3IBOA 3KPQA 4ZD3H 3L9RA 4MLSA 3HZ3A 2XHNA 4MJ2A 5JHLH 3NFPB 4GAYB 5ELIA 1FVCB 3GFUA 2GFBA 3M8OL 2ERJB 3NP3A 2RALA 2HT4D 3HKFA 2G3MA 3JBG7 4NN5C 4F9LA 3B8YA 3KPRD 4UAHA 3UABA 5F1IA 2PLTA 4PWFA 3QZNA 3BW9A 4Y4HB 4HT1H 4F5CE 3H54A 3MHZA 2NNAB 4FYRA 5GGTA 3RNKB 2HT3C 3QPXL 4L1DA 1HNFA 1SXCA 4XPTL 4EKJA 1EHXA 1KSRA 1U3HC 2YO3A 4PRIE 4X6CE 3RTQC 4G7YH 3V5HB 3WTWA 1KXHA 1TETL 2QQNH 3HRPA 4PJ8B 3SGEH 3CFIC 2ZKHL 5HDQH 2EADA 2ADGB 1AE6H 3GXTA 2A9DA 1M57B 4QOKA 1AGFB 1CS6A 3FU0A 4JO3H 2BRQA 3NAAL 4W9ZA 5CIPA 1AXSB 3BPCB 3WNKA 1CR9H 3CH8A 2H0JA 1SVCP 2Z91B 3HCVA 4K4KA 3S35L 3AY2A 1J12A 1DVFD 1ASOA 1L0QA 2D7QA 4UV4L 4QXGH 1IM9D 2OMTB 1MIMH 2FYYA 3WFCL 3FO9B 4KQ4L 3V0DA 1KYFA 3AXHA 4TTDC 3PGFH 2IGFL 4M7LH 1QWUA 4YXLH 4U4IA 1C8QA 4ZW5A 1OCZB 4K71B 4GAAA 5D7LB 4ZRGA 1XCTA 4PJCF 2BZDA 4ZZKA 3BVVA 2P24A 4YAQA 3LIZH 5FYKD 2BIPA 3WHE0 4G8IB 2WYTA 3DJ9A 3OKLA 1JWMB 5D1ZC 3O6FA 2ZYHA 3KH3A 3W0WB 4X7DC 1UGNA 5CSZA 1AS7A 4N8VG 3PWPB 2XQBH 3EOAA 4WEBL 1E28A 4RAUA 5ITFA 3VFSA 4GQRA 4IOSD 5GRXG 3S37X 4I0PB 1TG8A 1V5JA 3QQ3A 4RWHA 4YHIB 1QZ1A 3VXOB 2IDFA 2NPLX 5SV3A 1B9ZA 4C4KT 3FB8A 3HRZC 3B8SA 2YXFA 1NCJA 5FB8B 1D5ZB 2D2CC 4XR8C 4HZAA 1ORQB 4DN3H 3GKWL 2CLVB 4EBQH 4B9ZA 1GGIL 3BISA 3BKJL 5IBLC 1YY9C 5BV7H 1QA9A 3W37A 5J1AA 4GQQA 1PSKL 3ZTJG 1WAPA 2JF1A 2J1YA 5GGSY 1YJDH 4DKFL 3LHPL 3MYJA 5SX5H 3ARPA 2LLNA 1BQLH 5C7XL 4TSBH 2BJML 4KXAA 4W9FC 5KYXA 2EE6A 1BXAA 2WBKA 1CL7L 3FQRB 1U8OB 5TF1L 2CKBA 3NZUA 2EIZA 3JVFC 1ND0B 4XNMA 1FNSH 3VD9A 2WXPA 5AVVB 2FYVA 3UYPB 3P3SA 1CK0H 5I16A 1CD1A 4ECNA 2WXRA 5D8JH 2XG5A 3WGUB 1DQKA 3FSOA 2XSKA 3QA3B 1IO4C 4F2MB 4UQCA 2WLZA 3D39E 1E65A 2BSBA 4ORGB 5H4YA 4JFOA 3OJDB 1T89C 1J0IA 1A47A 3MRBB 4RGOL 4MMXA 1GVIA 1WHOA 1WH0A 4XPFL 5KYUA 1YNTA 4NBYB 2B3IA 1KNOA 5B3JF 1VPOH 2QTVA 2JCCF 3CHQA 3U6XS 2IAMA 1E9PA 5DS1A 5C0AD 3CUPB 1IARB 4MNGA 3SPVB 2CCVA 1HKFA 2CIIA 2VDPL 4WI0A 3QFDB 1Z0NA 4XE5B 2EDKA 3W9EA 3GSNB 3P0VL 1XCWA 2EILB 4J5VA 4PJFE 1ZLEA 3T2PA 2QPSA 4QRAA 2E4TA 1DBJH 5CEYA 3F85A 4LLMA 5I2IA 3BAEH 1UM6L 4AJWA 4LCVA 3M17A 9CGTA 1NUFA 1R6VA 2PCPB 3GD1C 3IDJA 5DC9B 3ETBJ 3GSWB 3OWEA 3BGMA 3IJSB 4N2BA 4ZXBD 3VX0A 4A7UA 5I9QC 5EZJA 4F2MA 2AV1A 3L4VA 4HQQL 2VW4A 4I18A 2ZUTA 4F8LA 4GEJA 1T5KA 3K7UA 3L3HB 5AAPA 3L3OC 3ZL4H 4GSRA 3K5SA 1LE5A 3RY6A 1N3NA 1NIAA 2F53A 1BF5A 1RUKL 4GI6A 3F7RA 3BKYH 1U4FA 4PUBH 3CFKA 2PXYA 3QEUA 3UYRL 1EEYB 3HHSB 3TVMC 2V0AA 5I74B 2XBTA 3UPRB 3K72A 2JKNA 4HU8A 3CXHJ 4F27A 4I85A 4P2RE 2ICCA 2VR8A 1I1AA 1OKEA 1YEGL 2E74C 2YK1H 3IFOB 4EVNB 2VLME 3W39A 2VR3A 1E50A 2APTA 3O4OC 1ITBB 1HVXA 4ZFQA 2VMEA 4F33B 1DJSA 1CLOH 3V7AE 1EPFA 1OSPH 3IYLW 3RWHA 4LAQL 1IJ9A 2GY5A 4UDUB 2X1WL 3Q6GH 2CLVA 5GZOC 1OY3B 2BP8A 4FQPA 1XH1A 4DTGH 2ZUQC 4WUUB 3QIUA 4K3DL 2GABA 5CMAB 1YPZE 4GUOA 1ZV2A 4MA3A 1EUTA 3UGUA 5IHZB 4Z7UA 3AXLB 1H8OA 3MJ8B 3P77A 4XOBA 3SQBA 1A6AA 1MG3C 3JZ7A 2VMCA 5E2UL 1HOCB 4AJ0A 3SDCA 4G9FD 1M05A 3D18B 3QUXD 2LE9A 2MCG1 2K8QA 1QFWI 4FXGB 5D7EA 4PJDE 4Y2DA 3RY5A 1YMHA 3ZTNL 5I6KA 2DQCH 3MXWL 1R3IH 3GTNA 1EMTH 3DVGB 1RIUH 3EGXB 4XPAH 2LOEA 1JZ5A 1WITA 4PRAA 4AG4L 4B6ZA 3DK2A 3FUDA 3JWNE 4JO8A 3P40A 2M26A 1OAYH 3MRNB 3THML 5E5UB 4E5XA 1Q9LA 3D25A 2ENPA 3NJGA 2XYBA 4J3OH 2PCFA 5ESAB 3UGXA 1YC8A 1KJ2H 3LS4L 1LP9E 4UU9B 4WFEE 1UWYA 2IBZY 3V0AC 5F8RC 1DVFB 1KCKA 2R56H 3NH7L 4AQ8C 1EZLA 5C6WH 5MHSE 2YAHA 1BG9A 1IM9B 4G8FB 3QQNA 1TJGL 3O6LH 2GC7C 1XF1A 3MA9L 3X11A 1GS7A 5DMIL 3VMOA 2G0KA 4HHAA 3BFQG 3NBNA 2DBLL 4JJOA 2O6PA 3ORJA 3QAZB 1BLNA 2IBGA 1KWKA 2BP3A 4N5ED 1D5XB 1WZKA 3TVMA 1UZ6F 3KJ6L 4P4KD 4KJPC 3TIDA 3WD5L 3BEWB 4ABQA 4Z7QF 3Q2NA 3DIVA 5IEHA 5AZ2H 4LCIH 5IEKA 3WFHA 2CJTA 4NO5A 5A6IA 2J21A 3GSWA 5D2NB 3OB0H 5C0CE 1EJFA 4OCRH 4LZKA 2NY3C 1UCBL 3F58H 3MNZB 4I3SL 1XGPA 2IALB 5AZEL 4LSQH 3CDGA 1JPFB 3BVNB 1RSYA 2VH5H 3HG3A 3FQ2A 2NNFA 3DXAB 1ZT1A 2BIQA 1PIFA 1T04A 3BEVB 3GRBA 4GQZA 2PPAA 3RURA 4FABH 5C9JB 5LGJA 5HJ3A 3EH5B 4LPUA 2JQMA 1X5MA 2WYHA 3MLXH 1UXWB 4O9HH 1MI5D 3NT0A 2Q87A 1QNZL 4AC4A 3T0DA 4XP6H 1JVKA 3JTBA 1IAKA 2XQYK 5EC1B 1PGRB 5CCGE 1E5AA 3U0PB 4D9QD 4LVOC 4OW6A 3MRBA 3ARGC 3OG4B 4YX2L 2OMWB 4S1SL 5KW9L 4BHUA 5EWIH 43CAA 1KXQA 2K6ZA 4YS4A 4KJQC 1MCLA 4Y5XA 2C9SA 1CIDA 4OJAA 4PGBA 1I82A 1MRFL 3L5IA 4KNSA 5DI8A 2HX9A 3AG4B 4JO2H 1HNYA 5T5NF 1XGQB 3ZKMC 2JKIS 2Y2TA 1MVFA 1T66C 4N9OB 5IT2L 4W9IC 3WIHH 3GIVA 4KMQA 1NUGA 3PHQB 4PRIB 2O6EA 4YL9A 5D5MF 1Z9OA 1JV5A 1J1XL 1FSKC 3IJHB 3PWPD 4OSUL 1T7XA 4NQVB 3II3A 1DBBL 4K15A 1HH9B 2CHDA 4KK5D 3CVCA 2DEXX 1MFCL 4FJZA 2QZ5A 1MQKH 1S7XA 3AY4A 1U8LB 4AWJC 4PJ9C 4HJ1A 4JFQA 4TUOA 3QEQA 4PRHA 4UIMA 2WQ8A 3TBSA 4DKAA 3EYSL 1J05A 1B4TA 1EEZA 1QNIA 2V8MA 3HIZA 3KEDA 4HS6B 5EEVA 5FS5A 5E2UH 3D2UA 1R46A 3RB7A 3TBVB 3OKKA 3DV4A 1YVLA 1BOGA 3U6RB 2OL3B 3BO8A 4NQDD 5AKVA 3ZE1E 3EBHA 3PL6A 1WWCA 5DMKB 4U0RC 3JSSA 3US9A 3UO1H 4IGBA 3FU9A 4LDLB 4NUQA 2NX5A 3RDTD 3S0PA 3ISRA 3MRCA 4JKKA 1OSPL 5D1XC 1R24A 1MCKA 5DJ6A 4Z0XB 4HPHA 4ZQTA 3VFRB 2AXJA 4N8VA 3F62A 5IB2A 3ARFD 2BOLA 4JDVA 3KPSA 5DF0A 1QBLL 3NIDE 3OPZH 1YAZA 2MPAH 3X1EA 2A5UA 2PPDA 5IW1A 2B2XL 3O8XA 4X8GA 3TEWA 5FLUA 3F12A 2OSYA 4K9EL 3UYRH 4PY8I 5D1XA 1GKEA 2GUOB 1PTZA 4AQAB 5A2FA 3IDYB 3L3IA 1CI3M 1ZCRA 4CUCA 1NKOA 2IAND 4G5ZH 2GB2A 2EXYD 1MFBH 1RUQL 2NY7H 4XMKH 1IGTB 3OLEA 3MNWA 4BE5A 4G82A 1UD3A 1BECA 4MX7A 5HI4C 2J20A 3FHAA 4ODVH 1Z9NA 5CIPB 5JHDD 1D6EA 4NPJA 2EXSA 2Z64C 3KWUA 3E8VA 2IPKA 4DNLA 4ELKA 1N6QL 5F3BA 4Y4KB 3G6DL 3VUAA 3BUYB 2QQLL 4ZO6A 3NCXA 3TN0C 5IM7A 1NAKL 2WM0A 2IDQA 2ATKA 1RZIA 3H9YA 3BMVA 2EUVA 2FATL 4RBPH 2P45B 3GF8A 3GXMA 2FX9H 1ORSA 4LCWE 3N1QC 3MCLH 4JFXA 4ZMTA 1KXTA 4L1BA 3NFNB 1NIBA 4HGMA 4TQEL 1T1XA 4PJHE 1LEKA 1TR7A 5ANME 1TJHH 1K4CA 3PXJA 1UM4L 3QDMB 4U2YA 4Y4KC 1WFJA 4UT6H 3LB6C 5E2TL 7FABL 2B4CH 5JIHA 2IPUK 3V8CA 4R8WL 2Z7YA 4F2ME 6FABL 4Z7WA 3D39B 4Z7UF 2LR4A 2A38A 3VI3B 4M5ZH 4N0UE 5I6NA 1EBAA 1F3JA 1MLBA 1GKOA 2XTJC 2GFBB 3AY4C 2F5BH 4C4BA 3D0AA 2W92A 5DEJA 5FDYA 2F5AH 3LXUX 4FMVA 3JV4A 3T1FB 4U6VH 4F9PA 4DW2H 4HU2A 3WTVA 2BX5A 1GTFA 1BXXA 4GLRH 1R3LB 3UDWA 1KGCD 2WNKA 3FFCB 3VXRD 2XJLA 3D2UB 3PDGA 3U83A 4YLQT 4F2EA 2C3XA 3EKCA 3TBSB 3W2DL 1HZKA 1CL7H 2V9UA 4OZFA 2BJMH 3FCGA 3EO0A 4FULA 3QJHA 3CMOH 4C56B 3DO7B 4HJUA 3HS9A 2WTPA 5E1HB 1JYVA 5BS0B 2DQTL 1UH3A 4FQHA 1YG9A 4WWNA 5ENWA 2Z35A 4DJMA 2Z8VC 5AUMA 1VEMA 4P2QA 4U1JA 2EEDA 3CHPA 2CRYA 5JDSA 1ZK9A 3RRQA 1HKLH 4J6RH 2YJQA 2FK9A 2L8AA 3DIFA 3GB7B 1NLDH 3QC5X 3IM1A 4YNYB 4MAYC 3DO7A 3N6YA 4NCDA 1ODAA 2HFFA 4CBZA 4AGPA 1U92B 1IT9L 1FVEB 1HQ4B 4NKMA 1GW0A 5GSRA 3K1KC 5SWSB 3SJVE 1RI8A 4LSVL 4B60A 2WXKA 3VXUA 3FHEA 4XAKD 1TVBB 2B15A 2XQBL 4MAUH 1BQHB 3WXWL 1T0PB 1UD2A 5B7MA 2X4SB 4P2RB 1KGCE 3WMSA 1A4JA 1PD6A 4L9DA 1BVLA 3L48A 1U8IB 4PPTA 1LO0H 3O2DL 4R97C 4XXDA 3B9KB 4JGJA 3KXFE 3FUJA 3B1UA 3B2UC 2WXOA 1Q8MA 1OEZW 3TOPA 1A3QA 3I6SA 3QFJD 3EFFB 1E4XH 1ZVYA 4WUUE 1CIUA 1HHHA 4RMRA 2EDTA 3MCYA 1H3PH 1YPZB 4AQ1A 4QLWA 4QNPF 1OD7A 1DLFL 3KR3H 4XN2A 5FYKL 1AGDB 3QWNA 1FFPB 1I9RL 1ZHLA 2DWYA 4QXGL 3ARDA 3FK3A 5E1GA 5FF6B 2IH3B 3HS0A 1YECL 1VCBC 3G9AB 2BC4B 5EU3B 4E9WA 3RWDB 1P1ZA 1VSCA 4XBPA 2WXHA 3HBQA 1CR9L 2NY1C 4LDCA 2V7NB 3FB5A 3FTYA 4H2CA 4YZFF 5FYLH 3RUGE 5BO0D 4MZ2A 1CFTA 2BC4A 2WSDA 5GRVK 1JPSL 2FJSA 4P4KB 5E00A 4QYOB 4J7RA 2EEAA 2KDGA 2UZXB 3EDEA 5F7LB 4A2DA 4G7YL 1N7ML 5IVNA 4PH8A 2CNZA 2OM5A 5ACZA 2WLIB 3HPJA 4XBEH 2WCPA 1G1KA 1V7MH 2Y36L 4LEOB 4K9EC 5CCKH 5A2BA 3CVHL 4JFVA 5CBEA 5IVZA 5DGQA 1OARL 2HRHA 4JKNA 4KXBA 1MI5A 1LTXA 3LQZA 4H8WH 2HJKA 3P69A 4Y2LA 3MRLB 4P4KC 2ZJSL 4GRMA 1COBA 4DUVA 3EGDA 3FB7B 3DARA 1NAMA 2V5TA 3QZLA 5LB1A 3L3GB 1P9MC 4NC1E 4OGYL 2C1PA 3NZHL 1JZ8A 4XBGB 2JI3A 4KC3B 1CMOA 5EF2A 2Z7ZA 3QHFL 1W72L 3DBXB 1JL8A 1V05A 1DN0B 1FH5L 3BH8A 3RQ3A 4CMHB 3O0RH 4UYQA 2NW2B 3O8XD 1DZ0A 1BM3H 4DP6X 4FP8L 4PVMA 3UBHA 3LZFH 1QSEA 5T3XL 1EXUB 1UT1A 5E8OA 5C0BA 3KWTA 3SKUD 3CK0L 3J07A 4KTEH 5INCB 3T6XA 5HHOD 1I3GL 5D2NE 5C08D 2CJUH 4QHLB 3RL2A 2XJKA 4LCWA 2CPCA 1SYSB 3V6OA 2WTRA 5GGUB 1QACA 3U4BH 2IWGA 4F37K 3SCMC 5AVXB 1JN6A 2NDGA 2RD0A 1DLHB 3QORA 5CSBA 1FAIL 5AAMA 1JI2A 4BM7A 3VQ1C 1MJ8L 2ROXA 3PWNB 5CGYC 1MDAA 3QIBD 3NCJL 5HSFA 1EJOL 4PRHD 3WIIH 3D33A 2DICA 5M94B 5AALA 2J8OA 2OJEA 5TQ2L 1ZLVK 4DO5A 1OSZB 1RPKA 5IOPB 3F83A 3QQ4A 4OJFL 1NINA 1F6FB 1PKOA 2J88H 4Y4FD 5JNYA 2BNQB 2IPTH 2NY6C 2NYKA 4I2XB 4LQFH 4OCSL 2VSKB 3HZYA 4XWGL 4AKOA 3I9GL 3EOTL 4U7SA 5C2BH 4X8XA 3A67L 3MGOA 4X6FA 5J12C 2J44A 3VRIB 2BVTA 1Q90A 2C9RA 4M61A 2P26A 3G6AA 4N9GB 2ZWKA 3RHWF 1FZJA 1I1AB 2NDFA 3IFOA 4NJAL 3SE8H 4EVNA 2WKGA 5DRZA 4Q97A 3NCYP 4HWNA 1KWGA 4RDBA 5T8IA 5IB5B 2EH7H 1KB5B 1RURH 1AGEA 3O2WL 3ERXA 4GY4A 4X7FC 1JZGA 3WKML 3CSYB 4A55A 2F68X 3U0PA 4N1CA 3MRRA 1T0NA 2NT0A 1Y18B 4PV9A 4BFEA 5FGBC 3IDUA 3OLIA 1PQZA 1BGXL 1GGUA 5EIIB 3S36L 1HH6B 5IFHH 3US0A 4TLKA 3WEXA 3GSQB 5TGBA 3RVXC 1KGWA 1BREA 2WQXA 3L81A 5ESVB 3E3QE 4CSTA 2CHXA 5F9JA 3AUWB 3CFTA 4UQIM 2G4EA 1QABA 4EDXA 3RU8L 1GJUA 3BJ91 2A9CA 4LARL 5I2IB 3O3EA 3KDMA 1PAZA 2YPVH 4WTWA 5EU6B 2NXYB 1KELH 1MEXL 5I30H 3BGAA 1I1FB 4IHOB 4RISL 4MYPA 3F6LA 2PP8A 3QZOA 1JFQH 2D7PA 4JQIL 5GS1C 2FWLB 3V4VL 3ZE1B 2I85A 1E8WA 2UY6A 5IJBC 3DMMB 3WKYA 4OM0H 5I5JA 3P0YL 1A7QH 3FQUB 4HWUA 2ZCKL 2BCMA 2X4NB 3VD7A 5HYJA 2XZAH 1C5CL 4N0FA 3MACH 2ZG3A 1IBGL 1O5PA 4PVLA 4DWHA 3DUUB 1M71B 4N9GA 4JVWA 2Q86A 3B9EA 1RZKL 4U1LA 1KXQE 3TO2B 4K71C 3B7SA 1PG7W 4IDJL 5E94A 3RDTC 4DUXA 5D6CB 2HLEB 2VLMD 4ZNCD 3WY4A 4L4TB 2OYMA 4G43A 4UF7C 2K7PA 2YZ1A 3QIWA 5CLXA 1PX4A 3N41B 1S3RA 2VZSA 3SCMD 3H2PA 3SKOB 1HH9A 4GBXC 4FQJH 1YAIA 1MIEH 2RFXA 1IBHA 4QTHB 3T0XA 1LDPL 5HDOA 3K5RA 5DQDH 3MJ9L 2BRRH 1CYGA 2FEJA 2OV0A 3HRZB 4Y2DB 1ACCA 3LRHA 3ZDXB 4BRVA 2NUPA 2ESVA 1DL7H 1ACYH 1N10A 3B2VL 4LCWB 5GS0H 3HZVB 4TUKH 1IX2A 5I1HL 3NJMA 5L4IA 4JY6A 2WCSA 2XZCL 3IS1X 1ZSHA 4HPOL 4X9FA 5E08L 3EOAB 4AEHL 1R17A 5F7NC 3MGTB 2P5EE 2LAAA 2UYLB 4RMQA 1UT9A 1EUUA 4BELD 4YBHA 1R75A 5E9DD 4X9YA 4JY5H 1K6QH 3VJ6A 5KVEL 4N3UA 1T7ZA 2QADC 1LJMA 3JWDL 4MA8H 4FA8A 3UJTH 1JNLH 5T1LA 1QTSA 4HUVA 3BH9A 4XMZA 4LLWA 2OJZL 3DX9A 3NACH 3FMGL 4ZS7H 1U42A 3HI6L 3V9EA 4Z0BL 1HWHB 5EZPA 4JFZH 3MNVA 5HHVH 2XVGA 4JFHD 2YHGA 2HJKB 5HGBA 3PHOA 3VFPA 1NM9A 5C9JA 3HHSA 2H0EA 5DHVB 3BGFC 1NBVL 2Q0ZX 4U05A 4E41E 1E4JA 3EO1A 3IDGB 5FA4B 5EU4A 1SHMA 1S7WB 1R4XA 5B1AB 4QHMB 1NFDF 4CNIB 5FO9A 1NBZA 1SPDA 5DO2D 5LHDA 1AZBA 2VJXA 3PREA 1RK1A 3DGCR 1FLRH 1B2YA 2KZBA 2K78A 1KPVA 1C5BL 1R5WA 2VXSL 1RUPL 2VAAA 1CCZA 2N7SA 3NSFA 2J1XA 3EH4B 4W93A 2X1PA 4DP4X 3CWGA 3U1PA 2H1PH 2WLKA 1XGYL 2BXZA 3S2AA 3UH8A 4ANUA 1MCEA 3KLAB 3IRPX 3ILQD 1WA1X 1LWRA 3SHSA 5SWSE 4EI5B 12E8L 1FBIH 1TJIH 3UBXB 4MAYA 4OD1H 4AK1A 5GRJH 5IHLB 1WS8A 3T4AB 3CN0A 3DROB 3QFDA 1ERNA 4G6KL 2X6MA 4DPRA 5C0AE 2XDHA 1IEBA 1IGMH 2CKBH 1HL8A 1KN2L 1IM9A 4G8FA 5IQNA 4LVOB 4JB9H 4P2AA 4KK9C 3MSPA 1EO7A 1YLBB 2APSA 3LNDA 4JFDA 1RFDL 3QAQA 4FNSA 1N0LB 1LO3H 1RJZB 3ESMA 1TUPA 1HWGB 2NUTB 4HFWA 4DKTA 3BKCL 3W5NA 1OE2A 2HKFL 1VLXA 1NFIB 4XOCA 1UT2A 1V8HA 2UZYA 4YHMH 3LH2H 3B2XA 1QLEH 4RFEB 3MOQA 5TFSH 3CDZA 1H8LA 4M6ML 2DL2A 1PDKA 1ZGLA 2VLJE 3F04A 3HC4L 4ZPVA 3GSNH 3IMSA 2XWTB 2AXGA 2ZCZA 3IGAB 1GGBL 3HN8A 2C9XA 1PJWA 4ZW8A 3KCPA 1OSEA 5EEYA 5E8DL 5BRZD 3ILPB 1A9BA 4QWWD 3AABA 3MLUL 3EG9A 1KFAL 4QT5B 1N6VA 2ESVB 4N25A 3E3QC 1ETB1 3HBPA 4TSCH 5IMLA 3SYCA 5I26A 3RUGB 2H0FA 1U6AL 3MRPB 4LOVA 1XH0A 2CA4A 1KIQA 5KBMA 4PJ9B 5I1LA 2R4RL 5DJAB 4OF3A 2SEBB 1BPLB 4XAKE 1BIIB 2Q2EB 1RQ5A 4P3CL 4QRRA 5CXPA 5B3SB 1JSYA 5I76B 3P77B 4N2OA 4BUGA 2OA9A 3DJSA 1ORQA 1KCLA 1OP5H 2WINB 3ZUCA 2HH0L 1II4E 4XP1L 5GGTL 4KUZH 4JZJC 3UGEA 1KBKA 1FHGA 2GJ6B 3WS6A 3I6KB 3RIFF 1G7LA 2WWOA 4R90H 5D96B 3W39B 1Q4NX 1RLBA 5L88H 4L29A 1QTYT 3G04A 3CXFA 2VERN 5IHBA 5HHPB 3DV6B 3SYQA 1X4YA 4CW1B 3FF7A 5IUSA 1G0XA 1P7HL 3SOTA 4JFFE 3KS0H 4A2HA 1JWMA 5DZVA 1PX8A 2VXVL 3EJJX 2OFQA 5CFAA 2OW7A 5IVZB 4BH7A 4HOWA 3QPQD 5DC0A 3NVQA 1Z3GL 1N8ZA 3H9ZA 3RTQD 2N7BA 4NRXB 3O6FD 3DMMA 3HNSL 3RPKA 3D0VA 1N4XH 3A6OA 1O9WA 4GKSA 4HUCA 2BSDA 3CH1A 5IW6A 1J0HA 3UTQA 3ECVA 4ZPTB 2B0SL 3K2KA 3OF6A 3IPBA 5C07B 2WUBH 4IJTA 2XI9A 1N67A 1LO5A 5FWQA 5I6PA 3P30L 4HCIA 1T3FB 4XC1L 2VW7A 4OV5A 4LPYA 3AT9A 1AGCA 4LLUB 1HI6A 3X13A 4EUPH 1A3LL 3L5XL 1NAMH 4MQ7B 3WUWB 5FKAB 3IETB 1MFDH 4BFNA 2H4EA 3FN0H 5HGHA 3SPVA 3SKJL 3CX5J 3D4CA 1W8NA 2B0SH 3NGBC 1OCOB 5I0WA 4HUWA 2G9HB 4L3AA 1T5XB 1BF2A 2F7QA 4UOW0 1SUJA 3EO9L 4WV1A 2BNQE 3FQTA 4I2XE 5DJ8B 3OHXC 2ZPKH 3BSGA 1JPGA 2I9TA 2CUMA 4OGQC 1W9XA 3F12B 5CZKA 4L8BB 5IW1B 3N1MC 1CTNA 2GSIB 3QUKB 3DO4A 2XVKA 4B9GA 4WGKA 1KYAA 2VISB 1KY7A 3BPLC 4FCAA 4GKNA 3K80A 1I7ZA 4I1PA 3LNIA 1DJGA 3VVVA 2EIZB 4KKQA 1U92A 3RVTC 2HZHA 3FQRA 2QSCH 5DLLA 3CZSA 4YHNB 1KBWA 3F3HA 2BINA 4YFEA 3QIUD 2W65B 4JVUA 4OU3A 5DGRA 3DURB 1OTTC 1D9KA 5BQDA 2HCZX 2ED8A 4AMWA 1SF5A 2X53A 3QNFA 4CN1A 1J8HB 3ALWA 5DD3L 3HUJA 4F37F 1DQML 1NCWL 5FM5O 5EU6E 4NKIL 1A7NL 2YAPA 2VRKA 1BXVA 2G60H 4N2CA 1IGYB 4M7JL 3CVBA 2ZG1A 4NJ9L 1EXUA 1IAIH 4TVPH 5IV2B 5BUGA 3ZKND 1LWHA 3BZDA 4NENB 3WN5C 1QLEB 3GSNL 4OJCA 3OR6A 2I9LB 5D7LE 2Z34A 25C8L 2ZCLH 3V52L 2FEEL 4IMKC 3RGHA 5H2BB 2KZWA 2YGQA 2NOYA 4RZCB 3FNKA 1BVNP 3W0WE 3B2UD 1PLGH 2ZWSA 2H6UA 4Y1SA 4PGBB 3K6FA 5I8CB 1WWAX 4HVBA 5L4JA 4RSVA 1K4CB 3VACA 3C6LC 3WN5B 4WEUD 2HVJB 4H5SB 4CJ0A 1TO4A 2NQDA 4JFXB 2BIHA 4PJ6A 3G08A 4H25B 1A64A 2E47A 1LD9B 1MW0A 2BP0B 3TO4B 1ZLSL 5F9OH 4IM8A 2X70A 1NCIA 1TTUA 4B5ZA 2LFGA 5HJ3B 3QEGL 1J8KA 3F7KA 1OGAD 4LE8A 2XTLA 5FKAA 2Q8BL 4NM8H 5EG6C 4Z95L 3P3TA 4XMVA 3MBEA 2WQRA 2Y3NA 4LLQB 3FQNA 5D1ZA 3ZDXE 4J28A 3MUHL 1MFVA 1OCWH 3L1FA 1MAML 1CE6A 2FJGB 4KK8C 3IWVA 1UH2A 4IQHA 2UZIL 4KVNH 4NBXB 4S0HA 3NABL 2ATAA 3DK0A 3UROR 1P4LB 1OQOA 4XCCL 1R3HA 3F2LA 1KBGL 3VE0B 2LU7A 1UFUA 4XHJC 4KTGA 1F0LA 4PRNA 5DEGB 4TTDD 3TN0B 5EUOF 3MOAL 1ECZA 4LOFA 1F8TH 4NRXA 5DVNA 3LAFA 3VO0A 1AZZC 3MXVL 1G7JA 4OF5A 2AEQL 4D7BA 2K9UA 1ZXQA 3KDPB 1AQDA 5L6YH 2DTSA 1MQ8A 3KPQB 4K5PA 2K8MA 2Z31A 3JWDH 4ELMF 2P52A 4Z3JA 4ZSOA 1PX3A 3UZEA 2CG9X 3V0HA 3L1OL 3KJ4C 4F1SA 2C4FU 4QXTB 4YSTA 2WANA 4Z7IA 2NY4D 1U8NB 2VKWA 4N2MA 3BOVA 2I27N 4JBSA 5DYOA 1RZKC 5FV1L 1JTOA 1TVBA 1YEKH 2UV3A 2KLRA 2JLPA 3WG7B 3D25B 3FUMA 1AZRA 1CD8A 4FHBD 4PVNA 4U3HA 2HUHA 1F4AA 4MJ6A 3P9LA 1ZDQA 4TUOB 5KVGL 1ACYL 1GH7A 1AJ7L 1KYOJ 2K9FB 3B2VH 4K55A 4NGHL 4WF7A 5GS0L 1H3GA 2FQDA 1CFQB 4NQXB 4EQ2A 4MZRA 3VFOB 2G9KA 3SGJA 3TVMD 4FQIH 4J39A 3LNGA 4YLCA 1NBCA 3UBXI 1G9NH 1E3FA 1L9MA 1PVHA 3LN5A 5D7SL 4HOMA 3NA9L 4A68A 1HHJA 4X6BA 2D3LA 3D50A 8CGTA 1JBJA 1IZKA 2UXVA 2NTFB 1Q9OB 4LKCB 5BQ7A 4H20H 1GJIA 3OZ9L 3BVUA 2BERA 3AQXA 5DK0A 1ZAGA 3RWFB 4RFOL 3LDBC 4YDLC 4NENA 1QLFA 1UYWL 2GHZA 4FKKA 1JZJA 3OQRA 4HEPG 2IAMC 4HS8L 1N70A 2QR0A 3V0FA 2N7AA 3N04A 1AD0B 1DSYA 4MMZC 3UP1A 4G1MA 3SPIA 4KQ0A 5IQ9A 4LESA 5HGGS 5C0AB 4PY7B 5J13C 4GXUN 5T3XE 2I7OA 1PIGA 3CU1A 3UAJA 1A7PH 4ZPVB 3K74B 2EUZA 1J7VR 4NNXB 4IRZH 5DZAA 4WFGE 2N56A 3KVQA 5KYYA 4OZ4A 5I0VA 1EERB 3D30A 3PGDA 1F4XH 1CU4H 2IQ9H 2WBJA 5C3IA 4K94L 2Q76A 3QO1A 1YC7A 4HH9A 4U2ZA 5K9KB 5DZPA 3LMJH 1SDDB 3I74A 4Y16D 2ZCHL 3UTSD 2IANB 2CO6A 4OM0L 3TBYA 1VFOA 3ASOB 3KVPA 1SRDA 5C86A 1UXWA 1NMAH 4Z7VF 3L5HA 1MREL 2FH6A 3EIFA 1JZEA 3C9NA 4ONFH 1MWAB 2EZ0C 3SPGA 3DSFH 4MS8C 3UPRA 4KI5E 1A9EB 1H15A 3WIHA 3AAZA 4YSEA 1TEGA 3KZ8A 3IDIA 1CVSC 2YQGA 4XVTL 1MJUH 2A7BA 2WUCL 2B08A 1CXIA 4MWFB 2JIXA 4RWYL 1CBVH 1QFOA 2DLEA 2DQEH 3BPOC 1AKJB 4PIBA 1AYOA 1LMKA 1Z66A 2W88A 3D4GA 3QQDA 1X4XA 2W9EL 3RU8H 5EZJB 3MBXL 1L9SA 1QG3A 1NIDA 4S2SB 2KLSA 2VZVA 2MNJB 4ZDHB 3UBXG 1NEZB 3BHBA 5MEOA 3D12B 4OGXL 3P11L 3POCA 3S36H 2D9QB 1F4XL 3G5YA 1PYWA 1SGKA 2X0VA 2ZUWA 5FA4A 1T5XA 1LK2B 3A4AA 1EANA 1YNLL 3HKZA 5D6DC 2EDWA 4WI6A 4O5LH 1TPXC 2B1OA 2L0DA 1WV7T 3D3VA 1IBFA 3T77A 3T6QC 2Z8WC 3TASA 3C8HA 4YE0A 1KJMA 1LP9B 2FO8A 5FO7A 4ODHH 5GJTL 3S3PA 1A6ZA 2F54B 1THCA 1TQBB 4YJZL 4FQXC 2BY2A 3IXAB 3F5WA 5DR5H 3ULUD 5EO1A 2BVQA 3AMLA 3I2CL 2VCOA 1MFMA 4JFFB 2F8VA 2FT6A 4WU7B 4V1DB 1R33A 4X7EC 1T3FA 1TPXB 4KZDH 1KIPA 2HTKD 3SGDH 4K8RH 4WI5A 4I0PC 3NA9H 1TMQA 2UY7A 4BSWA 1OPOA 5FWRA 3RY4A 4PFEA 4ZFGL 1BBDH 1GAFL 1LO4H 3WSQL 2YD9A 3KLQA 2EE0A 5EDSA 3SY6A 1CDIA 5L9DH 3Q2LA 4QF1A 3U79A 5I5RA 1IQDA 2ZYRA 4J3OC 4LEBA 3L5WA 4D0DA 1QBBA 4K8RC 4M1DH 2X88A 1UXLA 4QUOA 1MCNA 1I9IH 3ME0A 3CIAA 3Q2VA 3GIZH 4X0NA 1S7XB 4DFIA 1CXKA 2F58L 4C4UA 3MUUA 3P1VA 3DXAE 3ESOA 4HHWA 2CK0H 3MGAA 1DQTA 4WKXA 2E6QA 4XZUA 5BVPL 5JMRA 1IAIM 3LXAA 1PL3A 1WIUA 4W9KC 3U46A 4IBQA 3KLHD 1A6AB 3DPBA 5KAQG 5LWYH 4GXFA 4WSJA 5FM8A 1FNEA 1JPTH 3ISWA 3SKMB 3A3YB 4HJJH 1F2XK 3QUZA 1BQRA 1MCCA 7PCYA 5I8OL 1VERA 1DUYA 1OTSC 4XP5H 2F7PA 4AL8C 4JZJA 1VFAA 4I0KA 4OZFG 5IROD 4NRYA 4BHUI 3OVUB 4RSYA 4EDWH 4Q9QH 2R2EB 4P06A 4R7DA 5JW5A 4JCWA 3CG8A 3NZHH 3MPCA 3D9AL 5ETUB 4CADB 4FHJA 2Q10A 2B16A 4OLWH 2BHYA 2OTWB 2VZOA 3P4NB 2G75B 4LLYA 2K0RA 1AFVL 4IHBA 1E6JL 4P05A 1YRKA 2ITDB 3FS9A 4AL8H 1E5YA 4N87A 4U7MA 3UBFA 5D7LA 1MRDH 1QD0A 3V95A 2UY6B 5HJBA 5T5FL 3TZVD 2HUEA 1NGYB 1NLBH 5JPNB 3ZDWA 4E68A 5FW7A 5ERWA 1GZPA 3OKEA 1D7CA 3IAQA 4UTBA 5E51A 4JLRB 1O7DC 2VDLL 5K59F 2YSSB 5JQ6L 1RUML 3DO3A 3D4ZA 4UMGA 3T3PE 4M03A 3ARGA 3ARDD 5D70H 3QNXA 2VDMB 4OUOA 5IFAH 4FQ1H 4WEMB 2IALA 3EUDA 1ZANH 4PCYA 2RIKA 1BXUA 1VGEL 4PGDB 1ED3A 4ODSH 1ZT4A 4PW3A 4ZMVA 4GB9A 4JGNA 3PL6C 4W9GC 4MB5A 2WAHA 3WL9B 1BPVA 3QWRA 3X17A 4QXUL 3LSOA 1PQZB 4NAQA 4XHQA 1B2WH 2O5YH 3QZWB 3TVMB 1T0NB 4JHWH 2D0GA 4PMFA 2QQKH 1QUPA 4MB4A 4G3YL 3QUYB 4HG4K 5L2KE 4AIZB 4LP5A 4NO0D 4FQCH 5IGXL 1A1MB 2VDNL 3EYUL 1Z1WA 4Z7WF 4NN6C 1E42A 5FCUH 3NIDB 1ET7A 4BZ1A 1B0WA 1EGJH 3UTOA 1FZJB 3MV11 1AVAA 1DVFA 4L23A 2F7IA 1CF8L 1ZRUA 1D5IL 1YMMB 1CD1B 2A9ML 2JIXB 3BAIA 3SBWA 2WXGA 3S8GB 1WICA 3AQDA 1FVCA 3DTDA 3IDGA 5GS3A 4QRSB 3QT2A 1IU1A 4R7NA 1URIA 1EH9A 3Q7JA 4HK3N 4QY8A 5GGRB 3NOIA 4PBXA 1YYLL 3HN5A 5BO1L 5J1SC 3ECBA 2AITA 1FHNA 2DQJL 5JPNA 3NRFA 4UV7L 5EN3A 2VW6A 5DRNB 2CDFB 3QG7H 4PB0L 3BH9B 1BVNT 1YMHB 3WFBH 3UJJL 1ZJBA 3ABLB 4N2HA 4HGWA 3CMOL 2PYEE 4LCWD 2DM2A 2O5NA 2IAMD 4FXGA 2IDSA 3F8UB 1CBJA 1GHFL 5HYEA 5I66A 2CLRB 3QP3A 4UAOC 3UTZB 2H1LM 4WTXA 1KCVH 3F84A 4YE4H 3KH4A 3MV8A 2R2EA 4XPHH 2LU4A 2EH8L 2VDKB 2ICEA 3NJVA 4G1MB 1T1WB 4PJHB 4Y4FC 2BZCA 4JZJB 2B1AH 3MV8B 4OD3H 4F8QA 4W1TA 4KFZC 2OR7A 4K7FA 5DEFB 2CGZA 2YXVA 3ARBC 2BVPA 5C8JA 2D31A 5L2KA 1G9ML 3AVEA 3EJYD 4MRBA 4N0UB 3HE7B 4JW3A 1EHKB 5AG8A 2OI9B 3K8KA 1DFXA 5CJ8A 5ITBL 4P4RB 2P24B 4YAQB 1T83A 4JANB 2ZYSA 2H6PA 3X1GA 1BD2A 35C8H 1BJ8A 3ELQA 4MJJA 4N0YL 3GMOB 4XO3A 4IBUA 1OAKL 5GRVL 3WO4B 4R8WH 2ZP8A 1V3MA 3ARBB 2DDQH 4Q6IC 1XFPA 2DDQL 3P4MA 1L6ZA 5E2TH 3DX7A 4M56A 3EOBB 4O58H 3UTSA 4P2OD 2IMMA 1BAFH 4R7NB 1M6OB 2MNUA 4N2NA 4XVUC 3SBQA 1O7SA 1R5IB 3IJ8A 1KN4H 1YMMA 3HPJB 3JT0A 5ID1A 3S3BB 3EH2A 3M1OA 3PAVA 3JV5A 5C9KA 2PWHA 3SKNB 3BAWA 5C0BD 4TNWK 4JFYB 3GBNH 1DSFH 4S1DC 1KEGL 4PJ8A 4PTUB 3BGFB 1BVKA 1E6OH 2CDGA 2B1AL 2OR8A 2J2ZA 3P2TA 2V7NA 3ZE2B 5INDB 3D69A 3NFSL 4DK3A 3UP6A 5AWNH 1S8DB 3SJVB 2NSXA 1AHWC 1L4IA 2GTQA 1TLMA 1XSKA 2J4WH 3RGVD 2WQWA 4KH2A 5F1NB 4G83A 4CA4A 1E2VA 1YQVL 2L4OA 4BZ1L 3S97C 3U9PL 3CCHB 3HE6A 1CFNA 3LRSA 4ZUWB 4GG8B 2WW8A 4DGUA 1A6WH 1P6WA 3BC9A 4KO7A 4P23B 1VA9A 3F7QA 2ZKMX 2WNXA 3KXFB 1CDCA 3DX2A 2WQAA 3APFA 5F7KC 4HBQA 2MPAL 2QGEA 1RIHH 1CFVL 4P5TC 3NFPA 4K9JA 1H0DA 1SMOA 4K3JL 1DQJA 1K2DA 3IPEA 1CDBA 4ORGA 2VT0A 4ENZA 3UBGA 1RZJL 3QA3A 4ZFFB 1ZSDB 4XXCC 1AKJA 1UURA 3II1A 4M7LT 2HG5B 5FYJE 5DMGC 3T3MF 3TA4D 1CGSL 1ETJA 1N59A 1WVZA 5ES4B 4IBVA 1CF8H 2PWFA 3A6CH 1IAOB 1Q9KB 3BD3A 1KFAH 4P04A 5E6ZA 1KPUB 4IK7A 5GHWH 3JWOH 4V1DD 5CP7B 3P4NA 4LLYB 4FI7A 4OZFH 3RWCB 2HFFB 3F6JA 1YEEH 1F3RB 4P5SA 3X3FH 3UAJC 1DZBA 4QO1B 1UD8A 4KKBD 5IR1A 2YBRA 4ACPA 4OCNC 4XN4A 1P6FA 1P7KB 2P5PA 5FC9A 4Z3TA 5HHQB 5C0CD 3RZCB 3CXHK 2XUWA 4JZNA 4CL7A 2B1HL 2FO4A 2O5XL 2R1YB 2XY1A 1F00I 2ZOUA 2ZKWA 1R3JB 1R5VA 4NNYB 1CFMA 2I24N 3WJJA 3MRGB 2OMZA 4J3VA 4QXTA 4U0RB 3FTGA 3SO3C 1JFHA 4YIQB 3TJPA 5IJKC 4W70A 4KK6D 2C1OA 1FO0H 3JYCA 5LCVA 3E9UA 1XF4B 3P2BA 3GI9L 5C0AA 2E9WA 4WY7L 3E80A 1MLCA 4Y9FA 4EXKA 2F54E 3QXDA 1BYOA 4XZUB 2AAAA 4M43H 4OD1L 2JJSC 2KZ1B 4G7RB 1JXDA 3VWJB 1BQHG 2V5MA 2JMRA 3H1ZA 3N1FC 3NEEA 3T1FA 1S46A 2YAOA 2IADA 1DDHB 2MOQA 3AJ7A 4HF5H 3D87B 4V1DE 1XH2A 4G8IA 4BKSC 1USQA 1CGWA 5BRPA 2RGSA 2Y72A 4X99A 2WLJA 3CLFL 2VXUL 5EOQH 2GTWA 5FYLE 4JM4L 4YSUA 4F91B 5D96C 1C5BH 2P8PA 4APQB 4XP6L 1IL1A 1AFVH 3A4FA 4MQSB 1KY6A 1BVZA 2JELH 4HAFA 4I9XA 1RZ7L 4X4YB 5F7HA 3GGWB 4OLUH 3SDYL 2Y7QB 4OLWL 4MJ6B 5IMOB 1ORSB 2QKIA 5I1DA 1F1GA 2J3SA 4H0GA 5CILH 2IWKA 5K1JA 3FZUD 4HIJB 5E6IB 2ZAHA 3L3KA 2D03H 1FPTH 3VTMA 3SCMA 3TT1H 1MPAL 4FNLH 1JXFA 4JRYD 4QOKB 4BJLA 2R0WH 4P2YA 1UWGL 1KB3A 4MX7B 4HWBA 3HB3B 4JG1L 5E6YA 3UJTL 3ABGA 3FCUB 3LEYH 4NO2B 1K5NB 3G5YB 1A6PA 3QS3A 1K6QL 2XPZA 1JGLL 4K8RD 4PJ5B 4TQIA 3M1CA 3RNKA 4HW6A 2CR6A 1WZAA 1CGUA 4ISVB 4DZ8A 5FOJA 4PSPA 4YSQA 3SJVD 2D3NA 1U8MA 2XPGB 4TNVK 1GC1H 1MCWW 1JK9A 3DRQA 3PWUB 3TPUA 5E6IA 5AOIA 2V33A 5L9DL 1SXAA 1HI6B 2R56L 3F00A 1IKOP 5T3XD 3UYOD 2BSRB 3VSUA 3B56A 1MF2L 1YJDC 4IRSD 4RZKA 5FO2A 2C7UB 2WLHA 5EZOH 1MWAA 4IJ3C 1IBDA 1OAUH 4UBDC 5ID1B 3ATDA 5C09D 3V4VA 1P7QD 3H42L 1U95B 1PZ5A 3VA2C 2N59A 3ULAB 2FO1A 4MXQC 2IG2H 2Q1EA 1V3LA 4OLYH 5IMKB 1OK0A 1A25A 1O6SA 1IILE 1LQSR 2VLRE 3MJ6A 1RULL 3ESVF 5SX4I 4HUVB 1GY1A 1ESOA 3D08A 3MREB 5FV2A 3QRGL 4FG6C 3CTTA 3WN5A 5KYYB 1U8LA 3TJEH 1OB0A 3KNBB 4I48A 1G7MB 1A4JB 3QNYA 1P5UC 4MBOA 4HG4J 5FO8A 1MLCB 1BFVL 1YQ2A 4XTRC 5G2NA 4O00A 3I6LE 3LDBB 4LOUC 4YDLB 2NTSP 5GIRB 1A5FL 1BP3B 4TN9A 3V4PA 2VRQA 5BW7C 2EVGA 4DCQA 2EDOA 3WFZA 4KJYB 1N8OE 5F44A 2B9BA 5L2KB 3N44F 4KPHH 3O41A 3G5XB 4HIEA 3VG9C 3BIAX 2NTFA 4LKCA 1G6VK 3B9KC 1P5UB 3Q6GL 1MAJA 3O3UN 1BIIA 4LBEB 1TTGA 5JW4Q 3ZT6A 2B9AA 2IXQA 4M6OL 4HZ1A 1HHKA 3SDXB 1UB5B 4O51A 3VMNA 4PBDA 4PJ9A 5I1LB 3UTZA 1DVQA 4LSPH 2DD8H 3I6GB 1NUNB 4YHLL 1HX0A 1YMME 1AO7D 4G71B 2ICWI 3AZUA 5D1QE 2E7LC 3P9LB 4OB5L 4KZEH 3QJFA 3W56A 5C6PB 2QDVA 1NGQH 4L4TE 3WFEH 2HP4A 2O6CA 4X6EA 1SLWA 2AXGB 3ZIMA 5IFHL 1G43A 1VACB 4Q74A 4K94H 3UXFA 3LV3A 5JOEA 2HRPH 2WIMA 3MU3A 1WWBX 4FJ6A 2WQUA 2C7UA 4HJ0C 5KANG 3VFNA 4OY9A 5HYQB 3ZGIA 3MMEA 1KEMH 5HDBB 4UOW1 3N91A 1X5KA 2EH7L 2WLLB 5HVHC 4I3RL 1RJZA 4LIQL 3I02B 1U0QA 2QSQA 1VFBA 2PYEB 3RNQA 1RK0B 4X5WB 4GJTB 3EF4A 5AVSB 2YBGA 5DJ0A 1E27A 1R47A 4KZCA 3UG4A 2I07A 3VYNA 3UFIA 4WAFA 4F8NA 2WWMC 4B9IA 3KYAA 3KYNB 3CCHA 3HE6B 2PW1B 4HJIA 3MV8E 3BEWA 5E9NA 4CVXA 3CZFB 1ETZA 2FQGA 2Y6SC 4G59C 4JMXA 4M7ZB 1PZUB 1H6UA 3VFTA 1ZHBB 1G9NL 3VWKD 2CBPA 2XN0A 1CZ8L 2YS4A 3TT3L 1ZIBA 4BQ9A 2VKXA 2EDJA 3CVIH 4H13C 4BXVA 1IVTA 2N0MA 2ADFH 5CCHE 1IFHL 4OBRA 2AVGA 1OAXH 2B20A 3RKPA 4DVBA 3UCRA 1OOWA 1ZT4B 5C3LD 3FPYA 5EEZA 4Q58C 5FKPA 1HL4A 3N41F 1GY2A 4EUPB 3TBTA 1J0YA 4W9EC 5IQOA 2GAZB 1E4WL 1JGLH 5I1DB 5LBGA 2Y5EA 2CU9A 1NFDB 1Q0XH 1QHQA 2CJUL 3QQXA 5EBWB 2Y7QA 1EAOA 1OB1A 2RBLA 2ZUSA 2VM4A 4GG6A 1UKTA 2AEQH 4LPXA 3WJLC 4C83B 2BWIA 1XQ4A 4RGMC 5FYKU 1AI1L 4KROC 4ZAKC 4M8UA 3ESUF 1QI5A 4NUGL 1P9MA 1T20A 1VADB 1F90L 3DI3B 5FUCE 4IIQC 1KBGH 1FN4A 1PSKH 3HR5B 4FQQB 3A22A 5E2JA 4JREC 1OTUC 4Z3EA 2XQYG 4Z7WE 5E99L 2FGWH 2LVEA 2H5UA 3GKWH 4EBQL 5C0FA 5F3HA 2OLDA 1KCRL 4J2XA 2V2XA 3WXVL 1YZZA 3EJTA 5K39B 5A6MA 3QJZA 2XIDA 2Z31C 3LPGA 2B39A 1M9SA 4X83A 3FCSA 4FFYA 4UOZA 1OCCB 2IDCA 3DGGA 3D0LA 2KQMA 3FU3A 3CLFH 4R4FL 4WUUA 3CZJA 4YUEH 2WVSA 4HULB 3QEGH 2Y36H 4JPWH 4JZNB 4XC3L 2NY0B 2P8LB 4ZS6C 3QI9D 4MQXC 1BF8A 3S3SA 3MV7A 2D7TL 1QSZA 2NW3A 1T21A 2X4PB 1UM5H 4F7CB 4MVBD 3EHBB 2VLJB 3ARYA 3PP3K 2FTAA 2LQRA 4CU6A 4NI6A 4QO1A 3MRPA 3GQFA 1WEJL 2EAEA 4BFIA 1EJ6A 4L2YA 4M48L 2ZF8A 1HXMA 3FJTA 3B7UX 2BZ7A 4QY8B 5GGRA 4D0DB 3UZVA 3BP4B 1TU2A 1DJYA 3ZPDA 5TDOA 1RVFH 1UWXK 4N1EA 3BRGC 5B39B 1FJ1A 4FTVB 1XBDA 4H0LC 2B3RA 1ZT7A 3EHBC 2FBOJ 2ZCLL 2C5DC 1MOEA 1G7QA 4JE0A 3X3FL 3ML9A 2ZF9A 4L8SB 2R69H 4TNWF 2X4RA 9PCYA 3VXTB 1JTTA 3Q1SH 2EE3A 1RUAH 3KXFA 4XN8A 5GS1B 3UTPE 3V7AG 4E9SA 3A6CL 3AU1B 1AXTL 3DXAD 3KM1A 1A7NH 4HX1B 3OMIB 2GJ6E 4KY2A 2RQ8A 2A9NL 2HYMA 3WEMA 1LEIB 5LGJB 3BT2H 4X7CC 5EA0H 3UG3A 3GSVB 1JVOA 3U25A 4PJGF 1OAQL 4U0QB 5L8KB 2XNAA 3BQUC 1E7VA 4JRLA 4F58L 3AU1A 4QOKD 3D6GA 2BDNL 3WUWG 1KOAA 2OXHB 3C8KA 4RMTA 3TXAA 4FXKB 2R2BB 3PDOB 2OKMA 3D69B 4ODUA 5I0YA 3NTCL 2DWSA 3M8OH 5GSVA 2QSCL 2DW5A 2YWZA 4PTUA 3ET9F 3S8FB 1NLDL 2W1NA 3NRQA 5DHMC 4S2SA 3S8WA 1HKLL 4X6DA 4HIHA 3REWB 2R9HC 1AGBB 1GZPB 3QQDB 3CHSA 4OLVL 5ERWB 3X3GL 1QFUL 1TQBC 2NYZA 4DGVL 3QORC 1R9FA 4MB3A 3U9PH 2ZSVA 3CC1A 4FFVD 3WJJC 5EU4B 4ZOEA 1M6OA 2J4WL 3ILDA 4ZX4A 3WYRA 2N1KA 3EW3B 1B90A 4E42A 2Z92B 3NFSH 1HXMB 5D5MB 3KL5A 2BSSA 5HGBB 4M8RA 3O6FC 1XTMA 1D5BA 1X5JA 3BDYL 4PGCB 4A67A 5JW5B 4WKZB 5AW0B 2OCJA 5DHXB 3TIEA 4U1IA 2H47C 1JHLL 5IIEA 4I77H 3STZA 4QOKE 3NPZB 1AMXA 3GMPA 3GBEA 4W9JC 3D4YA 2QEJA 5GISH 1M7IB 5T1LB 3BVXA 1Q9LB 4AEIL 4E5XB 2UZPA 2F5BL 1KPRA 1ZLDA 3GRWL 3L4UA 3LQAH 4PREB 1T2JA 4LPVA 3BD4A 3SDAC 3NSXA 5DZJA 1HEZB 3VFUA 2BMKB 4PJ5E 3AREA 1WSST 2VDPB 3G9VA 5KOMC 2FNBA 1EXHA 3E0GA 1WHPA 2QADB 1SEQL 1MRCH 1AANA 2NLJA 3OHXA 2CLRA 5CSZB 2DS4A 3ROLB 4DHLA 5JIIA 1DTUA 3RX9A 4XX5A 4J8RA 1ZGLP 1FZKB 4LEXL 1FV1B 3QQ9C 3V5DB 3VB9A 4JO1H 4KKCC 3FULA 4PY8J 2CDFA 1E0OB 2FQEA 5KG9A 3SKOA 1SY6H 3H7BB 1DEDA 3IKCA 3P9MA 4TULH 4W81A 3VFUB 1FYTD 1NMBH 2VXQL 3CDZB 3GSUA 3QDJD 1W72A 4H44C 2P80A 3RVUC 5FLVA 4XRCA 1SJEB 2VLRB 2AJZA 1JE6A 4MA7L 4NI3A 4XBGA 5TK4A 4OVVA 5IHHA 1J8HE 5GRUH 2AEWA 4K7PX 1KIRA 4HD9A 1EZVY 3BPCA 4DEUA 3QG7L 4PGCA 4KQ3H 5JPNC 3ULSB 1X6NA 2B2XH 5GGQL 4MKMA 3HC2A 4EI5C 2LU5A 3FRPB 1ZDSA 2Z92A 3QW9A 2YUWA 2TRYA 4C8XA 4P2OB 1FL6A 2FRGP 4CU7A 3R06A 3WHXA 1NC4B 4P3CH 3SYAA 4NWTL 2F74A 1ETZB 4KAQH 1MNNA 3KLAA 3PIQA 4QTFA 3BI9X 3UPAA 5D93C 3RWIA 5ADOH 3BW9B 4JFFD 3BAJA 1AGBA 4CN6A 4ZMQA 5GPRA 4GW1A 3BSZA 3SDXE 1IGJB 2CSPA 1RL1A 1QSED 1N9PA 1E27B 1V55B 4Z76A 5FIEA 4WO4C 3ZKNC 3F7LA 4FHKA 2N4IA 2IOMA 2R69L 1CTOA 4L9LB 5D1QB 5L2JA 3TCXA 1MHEB 1KG0B 5CD3A 3QNXB 1B4LA 1J8HD 4GAJL 4B53A 3RWDA 5BMFH 3HC4H 2WWKT 3WDIA 2I7SA 2F15A 3IKKA 5AVTB 3VWKB 1VJSA 4OI7A 4YHPB 5AKRA 3LZRA 3KPLA 3JYBA 3QIBA 4QRTB 3MRRB 3PJNA 5AVWB 1RZGB 5I1AA 4XHJD 3L2NA 4LL1A 3PJSA 4XNZC 1YNTB 4ZW6A 1RJYB 2IH9A 4HLZH 2IDTA 5IT2H 2CKBL 2G2PA 4WIQA 3CC5A 3RVVD 4EJ1C 2IQAA 3SE4A 4OZ4B 2E7HA 2FECL 1FAKT 1OAZH 3UZQB 1IIKA 3W82A 2F8OA 1MHHB 4YQXH 2CGRH 4DPCX 3L1GA 3AADB 2A6KB 5DZOA 3A23A 5E9DB 2YKKA 4PIRF 1DQQB 4KWUA 5HYJE 1SEQH 2UXTA 4RNRB 3AQZA 5TDOB 5ICZA 5C70A 1JRHH 3R4DA 5TPWH 3JQOB 1CVRA 2I9LA 2A4CA 2F53E 4IMLB 4LNRB 5DK0B 3RWFA 1HJCA 2Z0UA 3PQYA 4RGNC 5EU5A 1RUPH 2YD6A 1E8XA 3QXVA 3QZMA 1F6AA 2EIKB 4KO5A 3LQAL 4WFHD 1PW3A 3B34A 2DYPB 5KSUA 3VWJC 3MLXL 5HPOA 5GISL 1G1CA 5JHMA 1UCTA 4FABL 4OLZH 1JHLH 1FGVH 4MZIA 1KXVA 3BDYH 2CDEB 3CFNA 2YJLA 4KUCD 3SE6A 2VR9A 4PRDB 3GS7A 4MAYD 3MOBL 3DGGB 3ETTA 4X50A 2F19L 1JRHI 4JJ5A 5IMMA 5IMKA 1VAHA 2YAQA 5L4FA 5AZ2L 3PFUA 4WI3A 4N5UA 5HI5D 4R0LC 4TRPH 1GC1C 2Y7MA 5EHFA 5SX5K 1E5BA 1URZA 1KTKE 2YWYA 1Q0XL 3F7VA 3INUH 3WD5H 1INDH 3L4TA 3ZQWA 3BSZH 3NN8A 1H5BC 3K6IA 4YR6A 3ARZA 1WO2A 4OLVH 3TF7C 5E8PB 4UILH 4AW7A 3LZQA 4LF3A 5F7DB 1AR2A 1IFGA 1QYGL 1T5WB 1ITCA 4JFEE 4PJDA 3VTTA 5A6LA 2X87A 2IH8A 1DDTA 4UUJA 4Z7WB 3C6SA 3UPCA 3IXAA 1U8JB 4L8BA 4QYAA 3L95B 1E8ZA 3Q8AA 1DL7L 5DZNA 4BBWA 2FHBA 3CVIL 2GY7B 4GG6B 2HKAA 1OAQH 5IJCC 2VIRB 3NEXA 3MJ9H 4HXBH 3OXRA 5EUOE 3LPFA 3B2DC 4GP5B 3ELAT 3Q48A 2AQNA 3RWEB 3OSVA 1YUHA 4LPTA 5ICXB 2WOYA 1W8EA 5DURD 4APXB 1OAYL 2QFRA 4N20A 4EDXB 2IFFH 2PO6D 2WKLA 3BAXA 4KU1A 1G9NC 3I2CH 4M7KL 3UX9B 4F7PB 1URLA 2X9WA 1JF1A 1S6NA 2IANE 2PUQT 3QIWD 3FUHA 4OQTH 1WBXA 3MO1A 4ZQKA 3VU2A 1UWXH 2YD4A 1OOAA 5HBBA 3V79C 3FW6A 1SY6A 4KKNA 2Q2LA 2V5YA 5AYTA 3G6JB 4XX1E 1Y07A 4PWGA 1MCDA 1RZKH 2VDQB 4WSKA 2KDYA 1GOHA 4HBCH 1IQWL 3M45A 2XKSA 2F0CA 1E43A 4ETQB 3QIUC 4JGUA 2J8UF 5GJSL 4MXQD 5G5DA 1FFPA 4N8CH 5IUCA 1TSRA 4F7MB 4NQEE 2CHNA 1A8ZA 1OK8A 3G6AB 3QDAA 1MJ7H 3LRGA 4JPIA 2OP4H 2XWBA 4L4TD 4I13B 2CO6B 4PLKD 3J27A 3TBYB 4UT9H 2O5ZL 4PV8A 5F7DA 4DPBX 1FNGA 2JSFA 1MHPL 4GINA 2JQZA 5TH2B 3DSNA 3A21A 4MGXA 3LKNA 3L7EB 2EJ1A 4WFGD 1MJUL 2UUDK 1A4KB 5BZXA 3LYRA 3G04B 4EOWL 4M6OH 2QGDA 1XL4A 2R2HA 1OALA 3K8LA 4BCXA 1UQSB 1IEAA 2NXZC 3PWNA 1NMAL 4KPHL 4MSWA 4KMLB 2P43B 5EU6D 1FORH 5FW6A 3VWJD 2KKQA 5BOJA 1LK3H 4KRNA 1WT5A 4N8CL 2YEZB 1DBAL 3LEVH 4WTZA 5E99H 4POZD 4PJEE 2R8SL 4TUJA 5LAXB 2H2SC 3GB7A 1SYSA 4D3CL 1BFVH 4N0RA 1UB5A 5INCA 1Z0MA 1X5YA 2YD2A 1J9RA 2W65A 1TOXA 5CR1A 3BIKA 3KWWB 4JFPB 5D4IA 3GM8A 1HIMH 5FPIA 4YH6A 3LEXA 1WZ1L 2Y69B 4FQXD 3SYPA 3OBAA 1A9BB 2NX5D 1BWMA