3CE1A

Crystal structure of the cu/zn superoxide dismutase from cryptococcus liquefaciens strain n6
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
153
structure length
150
Chain Sequence
IKAIAVLKGDSPVQGVITFTQEGPVTVSGEIKNMDANAQRGFHVHQFGDNSNGCTSAGPHFNPTGTNHGDRTAEVRHVGDLGNVKTDASGVAKVQISDSQLSLVGPHSIIGRTIVIHAGEDDLGKTDHPESLKTGNAGARSACGVIGIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Structure of Cu/Zn superoxide dismutase from the heavy-metal-tolerant yeast Cryptococcus liquefaciens strain N6.
pubmed doi rcsb
source organism Cryptococcus liquefaciens
molecule tags Oxidoreductase
total genus 38
structure length 150
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3ce1A00
1PZSA 2GBTA 3GTVA 3GZPA 3L9EA 4A7GA 3QQDA 4A7TA 4BCZA 1E9OA 2ZKXA 4A7GF 1PTZA 1OZUA 3MNDA 2VR7A 1SRDA 4A7UA 1SDAB 4OH2A 1IBHA 4N3UA 4OJAA 2AQSA 2GBVA 1F1DA 1OEZW 3HW7A 3T5WA 2E46A 2AQNA 2ZKWA 2WYZA 1JCVA 1SPDA 1YAZA 4MCNA 3SODB 1XSOA 1BA9A 1B4LA 1MFMA 1SXBA 2WZ0A 2AF2A 1F1AA 1SOSA 1QUPA 1YAIA 4BCYA 2SODB 1HL5A 2AQPA 1IBFA 2Q2LA 3GQFA 1KMGA 2WWOA 2WYTA 4L05A 1SDYA 4A7SA 3KBEA 1SXSA 1UXLA 3CQPA 1YSOA 4N3TA 1E9OB 3CQQA 1DO5A 1SXZA 2ZOWA 3ECUA 2R27A 2WKOA 3ECVA 5KBMA 1XTLA 1IBBA 1E9PA 1P1VA 3K91A 1F18A 2WKOF 1BZOA 3KM1A 1JK9A 1S4IA 1E9QB 4A7VA 1DSWA 1OAJA 3KH3A 2JLPA 3H2QA 1IBDA 1OALA 2VR6A 2XJKA 1SXNA 5KBKA 1N18A 2WWNA 1CBJA 4U4IA 2Z7WA 3QQDB 4B3EA 4FF9A 1FUNA 1U3NA 1AZVA 2LU5A 1UXMA 1N19A 1ESOA 2WZ5A 3F7LA 3KH4A 3KBFA 4MCMA 1HL4A 1EJ8A 2NNXA 1Q0EA 2APSA 1E9PB 1TO4A 1CB4A 1L3NA 1JK9B 1SXCA 2Z7UA 3CE1A 2GBUA 1F1GA 2AQQA 1EQWA 3KM2A 2AQRA 3GZQA 1RK7A 1PU0A 3RE0A 2Z7ZA 3F7KA 3S0PA 2AEOA 3LTVA 1TO5A 1E9QA 5CU9A 2ZKYA 4A7QA 2V0AA 3GZOA 1XTMA 2WZ6A 3ECWA 2K4WA 3GTTA 2C9VA 5KBLA 1B4TA 1OZTG 1Z9NA 1COBA 2AQTA 1Z9PA 3L9YA 2VR8A 2C9UA 2JCWA 3HFFA 1IB5A 3MKGA 3PU7A 2Z7YA 2C9SA 2E47A 4BD4A 3HOGA 3H2PA 1SXAA 2XJLA
chains in the Genus database with same CATH superfamily
3I50L 3D85A 4F9LC 1NSNL 5F9JA 8FABB 1KYOJ 5SV3A 3LIZL 5AOZA 1TZOA 1ZSDB 5E03A 4CDGC 4ENED 3GKWL 5E6UB 4MDIB 4M5ZL 3RUGA 4JMXA 4MD0A 1RIVH 3FB5B 3O0LA 3MFFA 1Q9LB 3PNWA 1QFOA 4U1HA 2OW6A 3BDXA 4FQIH 2JCCB 4JFFA 1HXKA 4KY1L 1KIUA 4W9IC 4XO8A 2VJ8A 1WF5A 1GJIA 1N5YL 5HHME 1XSOA 1PYWB 4UOJA 1NEZA 1QG3A 5HHNB 1E5ZA 2ILLA 3C08H 5F89A 3OHXC 3FHEA 1FFPB 1HWHB 1X5XA 3VXQA 1WBZA 1MHPH 2Q2LA 4O00A 1X7QA 1IC4L 3SY6A 4OUUA 2F74A 2WYTA 4ODUB 1TYEB 3U36A 1G6VK 3U2IA 2X70A 3VFVB 5D8JH 2MJWA 2P46B 3FAXA 2ZONA 4GQQA 4RRPA 2YO3A 1IO4C 2LU7A 5D93B 5BUAA 5FS5A 5L8KB 1NL0L 5DWUL 1A1MB 1ZLSH 1FZJA 3D18B 3PAUA 2UY6B 2RCSH 5A2BA 1N64H 5DLML 5E1GA 4C55A 4GBXD 3WEBA 1QEWA 3DX8B 1AIFB 2GIMA 4NWUL 4IRZH 5F1IA 4UTAL 1X7SA 2FECI 2I85A 1NWOA 3CIQA 3Q8FA 1DANU 4CVZA 1YUHA 1INEL 5D1QA 3ZYOA 1ND0A 1QSFE 1KTKE 2ADFH 3ATDA 1A7NL 1JGVH 1XR9B 1JHLH 4HIEB 2P5ED 4I3SH 3E3QE 4DN3H 3GF8A 3VFOB 1QAWA 3AREA 5DSCA 2MCG1 1NMAH 3C5SB 5LGJB 4Y1SA 2HRPL 3ALXA 3AT0A 5IBUG 1MFCH 5BPPA 3S6CA 2LGNA 3OMAB 5K1JA 3TVMD 4PLKD 2IH1A 3P73A 5GRUL 3QEQD 4OLZH 4DEPB 2X87A 4LHUD 3PWPE 1E28A 4MS8C 2ZXQA 4L0YA 4WWID 4BUGA 5I0YA 4ZS7H 2F15A 5EO1B 2FD6H 1JVKA 3CPLA 4IIQB 1DBAH 5DFWH 4JDVB 3SDCA 5DUPH 4M4PA 3L4VA 3GSXB 4UTBL 1JZDC 3ZL4H 4O2FA 1XIWB 3Q8BA 1MCPL 4Q8BA 2C3HA 2DLTA 4H13C 5E4EB 5CD3A 2ICES 4LLWB 4AGLA 4RX4A 4MHHI 3H9HA 1A14H 4FQXD 3BKCH 2XWZA 3RURA 2EUZA 1QEXA 3ARTA 1KWGA 3DV4B 4WU7A 4K5PA 5INDA 1LO5A 1KFGA 4X98A 5BVPH 3ETBJ 3FU7A 4BGDA 2Z92B 3QZNA 3CFCH 2YPLA 4JBSA 4JKLA 3PWUB 4UAOB 1D5ZA 4NQDD 1TLMA 3PLYA 5FO9A 5FM5O 4K15A 4NN5C 3ZO0A 5A2JH 5JW4R 3T2OA 2X1XR 3L5XL 4N0FA 1JXKA 4OSUL 2KQMA 2QZQA 4I1NB 4BE6A 2EH8H 5IB2A 1JTOA 2Q8BH 5AB2A 2B20A 3SGEH 4FYSA 3K4AA 5GJTH 5KVGE 1D5IH 2EE0A 5FF6B 1QYGL 1USZA 3G6DL 5ETUA 4TUOA 4RDQF 3RYMA 3HNSL 1MJ7H 1RZJH 3JWDL 5ITBH 3CGTA 3KDPB 3C9NA 3NZ8B 2SODB 3HC3L 1ILUA 2ZWZA 3HBGA 4GI6A 2H0JA 4MBOA 2HPOA 1QFUL 1BBJA 4KROC 5DMKA 2NXZD 4Z76A 5CM1A 1JWSA 1MCRA 5TF1L 4ESKA 3PV7A 1IC1A 2HFTA 5DK3A 3KVDD 2L7JA 1DUYA 3FB7A 4JFDB 1VCBC 4UAHA 5BOPA 1UATA 4W6YB 5IG7B 3SB3A 2K7PA 3PPSA 5TQ2H 3QPKA 4MWFB 2NZIA 1T7WA 5C0FB 2F7RA 5AZEH 2K8MA 5HYJE 4F2MA 9CGTA 1FVCA 4U7KA 1XEUA 1WZAA 2EJ1A 3DHMA 4PJ5E 5B8CA 3Q05A 2ODIA 4RZCA 1Z9LA 3K6SB 4KHTH 3QORB 3OR7A 4M1CD 5T5FA 5CWSA 2DJ4A 5DA4A 3MXWH 1F13A 2OXGB 3HNTL 3MC0A 5HJBA 5I18L 3CVHB 3EG9B 3VFMA 1J5OH 4TNWK 1T4WA 3WKNA 4ZPVA 2BNUB 1FO0H 4K23H 4GXUM 4LLDA 5LQBL 5EPMA 2MFNA 3HVDA 3SOBH 3N06B 5CP7B 5GGSY 2CIKB 1RQ5A 4TLTA 5IW3A 2HT4C 1KJ3H 3QIBA 4PCSA 4NN7C 3ILQC 2HAZA 1OGTA 1BQLL 2XG4A 3HMWH 2Z31C 4FNTA 3TIDB 2DTML 1OM9A 4PRAB 4Z7OB 5G4OA 1CFBA 4U3CA 3VO0A 3DBXA 3CNKA 5CU9A 2Y06L 4K07A 4F7TB 3A4FA 4P99A 1WCBA 3L9YA 4AUUA 4HX1B 2MOQA 4HOMA 4FC3E 5E0FA 3B3IB 2JCWA 1NGWB 2ITCA 3HG3A 1CD8A 3MUZ1 5ANHA 5DJDA 3GLAA 3K6IA 4UNUA 1MWAL 3U6XS 3HZVA 3WLBB 3HN5A 3ET9F 4IKIA 3IDIA 1AR1C 4G6KH 4G8IB 2LVEA 2EDYA 4DUVA 3BISA 4DPBX 2GHZA 3CZFB 3MROB 4IBLT 5D1XA 2Y3NA 2GTWB 2PP9A 3PWVA 1L5GA 5FO8A 2WQXA 3SO5A 1TQBB 3KW7A 1KLFB 3KDMB 4PVLA 3US9A 3GO1L 2X1OA 3N55A 3UG3A 5B39A 4E41B 1MRCH 3LJ3A 2CBPA 2XIIA 5C07B 3LZFH 2YPVL 4EDWH 3O41B 4UIKL 3KLLA 1UB5A 2GTZA 3H0TB 1CXEA 1SM3H 3ABMB 1OLLA 4DK5A 4ZMLA 3U4BH 4H1LH 1HI6B 2BXZA 1G7JB 1JNJA 2LQRA 2YRZA 4NQEB 1GIGH 1UA7A 2AXGB 3JXAA 1YEKH 4HH9A 2RACA 2VNCA 4WTQA 1UD4A 4XWGH 5IVXE 1M42A 5IVNA 1BX2B 3EHBC 5EUKB 4UQDA 5KYYB 3UZEC 4BZ2A 5C92A 1DO5A 1KTDA 4NQVA 3X12B 3TZVA 3V6FA 4UILL 1CGYA 1GZQB 4KJWC 4D9LH 8FABA 4FCAA 2N0KA 1ZSDA 1G5AA 4LDCA 3HC2A 2WOBA 1FYTE 1NAMB 4MDIA 4L8SB 4AL8C 4RMUA 4MJIA 4BV1A 1DBMH 1WBXB 1UWGL 1KJMB 1A5FH 1Q9LA 3T6VA 1O7SA 3TBTB 2DBJA 3UTSA 3AGVA 1OO2A 2WVTA 1PZDA 4EIUA 4L4JA 3E8UH 1ZT4A 1MFDL 3WENA 2Z93B 3OHMB 3TT1H 4JEGB 3QNZB 4AOFA 3ZPDA 1EDHA 2EE2A 4BIKA 1IM9B 1B4JH 1U3ZA 1W0WA 4HZLB 3W11D 2X12A 4YSEA 1G9NC 4APXA 2FBOJ 4ODUA 1OY3B 4MZ2A 2GJ6B 4Y1AA 1VPOL 3HTLX 1MVFA 1PFCA 4NSKB 4P23D 1N7MH 1RAMA 1A1MA 5I75B 4B50A 5FKPB 4AYGA 1OLZA 4CGTA 5JQ6L 5L8LB 4CUCA 2UY6A 2AEOA 5D1ZA 4YHLL 2KC0A 1SVZA 1XXFC 4HXAH 4XBEH 2K4WA 3DX8A 2C9VA 1VRSA 2I25N 2ZUYA 1QLRB 3MYZA 2ZP8A 4QXGH 5JHDD 3OSKA 4ZOBA 2H6OA 4WSJA 1IBGL 3EYOB 4IDJH 4ZTEA 3P30H 3LB6C 5I30H 4FP8H 4JN1H 1OGAE 4MJ2A 3MRDB 3L3GB 4OF5A 2ATAA 3S3SA 1E5UI 2A9MH 4EE2A 1BIHA 3BVTA 3UBXI 4A7GA 3K2IA 3S3JA 4NIKB 1OCZB 2VLRD 1UT2A 4YK4B 1LD9B 3CXHJ 1GGCL 2XWTA 3RZWA 3BJLA 2D7TH 2N0MA 4HC1A 5EC1A 5I73B 1WTLA 3A47A 3EBAA 1LEKB 2X40A 2DI7A 4PLOB 2R0KH 3U4EA 5LWYL 3GBEA 2EAEA 3VMPA 5MEND 4KRPB 3SODB 2IOIA 1G4RA 1OXYA 5EO1A 4UT9L 4X6CF 3BKML 2WZ0A 1L9OA 4E68A 4JDVA 7PCYA 1RZ8B 2ZSWA 3U30B 2J6EL 1ETJA 2KH2B 4ZOEA 5IHZB 2OMUB 3GSXA 2E4FA 3DXAD 3OJVC 4NUMA 4P9MH 5ADPL 1XIWA 5C0CB 4OTXL 5JW5B 1CD1A 3KGRA 4JQIH 2VDML 4W9DC 1JRHH 1IKNA 4FG4A 3TEUA 3TYGH 4ANVA 5SV4A 3OKOA 3ZDZB 4IHBA 1YDPB 4PY7B 3JTTB 5AD0B 1PS3A 3DVFA 2J4WL 3DV4A 3RGHA 4FQJL 1KLUB 4KDTC 4X6BA 3LEXA 1RJZA 2GSGB 3KMDA 3TX4A 5I8CA 1PY4A 4YDZA 5AOMA 4IHOB 2MTAA 4RMVA 2CM6A 3ALWA 5MERB 1MPAH 1HZLA 3KZ8A 4Y7OC 1SLVA 1GZPB 5EULV 4G7VL 4OLUL 4O51B 3CDZA 4GPVA 4AEIH 1WFNA 2F53D 4NUGH 5FF6A 2ZOOA 2GC7C 3W0WA 4XPTH 1AO7E 1YMMB 4JB9H 3SYQA 3WTXA 4XOAA 5I1JL 1KCWA 4X5XA 5IMLB 1JPTL 1CF8L 4QLWA 3ZK0A 3GK8H 3EJTA 4M61B 2P7TB 5IJDC 1NPJA 4XI5C 5LG6A 4NFCA 3QDMB 5DRWB 3A67L 1T3FB 2Q8AL 3QYCA 3WD5L 4MS8D 5TQ0H 1KGIA 3L2LA 4XZUB 3RNQB 3QJHB 2QKIB 1IFRA 1UZGA 1OF0A 2CJUH 2BRRL 3E6HA 4YDJB 1F1GA 4BZYA 4AL8L 3MRLB 3NVQA 5IG7A 1M4KA 1BMWA 2BIPA 2H0EA 5TDOA 1BMZA 3O4LD 2FEDD 2M26A 3B4NA 5C0FA 2ED8A 2P80A 4HJTA 1MI5A 1EX0A 2ZCLH 2Z6FA 3X1NA 5EF3A 5J1AB 4GEJA 1S7RB 5LDSA 3I9AA 3L4UA 3Q48A 1R19A 5AAPA 5E8PA 3QNYB 4LSQH 4QOKE 2ISDA 3IKCB 5LHDA 3TP4A 5K1VA 1G9NL 1F6AA 1K8IB 3OB8A 4GXUN 2Z4TA 4H0IA 1PIGA 4UNVA 5PAZA 4JG0H 3ZR5A 4LIQH 4AEHL 3EYSL 3WIFA 1I3GL 3CVHA 2OZ4A 5L88L 4Z7NF 2VDLB 3FF7A 3BQUC 5B3JF 4KZDH 2IV9A 2K9UA 3GSOB 3E2HB 4P57A 2AS5M 1TETL 2D9CA 2J56A 1A65A 4GLRI 4LL4A 5CP7A 4XX5A 4CSZA 2VR4A 4OQTL 2DRUA 2LABA 2BVTA 4HJIA 4HCRL 3TIDA 2OL3H 5L8JB 4IEFB 5CZVH 5JPNC 3BW9A 5HGBB 4KROD 3GI8H 3GQFA 4QWWC 1BIIB 1ZDSA 2YSSB 2ZSVB 4YLBA 2W9EL 3VXUA 4NXKA 4FOMA 4FXGA 5HHQB 4MNGB 2A6JA 2N3JA 4A2GA 1NGWA 2D7NA 3MLTB 3V8CA 5C0EB 3DO7A 2FVNA 1ED3A 2ZUVA 2PWHA 3EOBA 4WJKB 5F9OH 4LCWE 3WLBA 5E9DD 4OZFH 5AVXB 5J56B 1T89A 2C9AA 2DD8L 1KELL 4AGOA 1HINL 1WT5A 4XAKD 3CZFA 3PWLA 3MROA 2P42B 4U1SA 4ZOCA 3R8BB 4DO5A 4X4YB 2H1LM 4TPRH 4OZIF 4PCKA 3O6FC 2IWFA 4KK6D 5ANME 5E56A 2HKFH 2CPUA 4HUMB 5D1ZI 5CJQH 2EC8A 1NCWH 3ARBA 2H6PA 4E9TA 4JVUA 4DPAX 3QIUC 3AQYA 1U8IB 3H0TA 2NY1B 4HFWB 4GSDL 1G7JA 1SOXA 4NQEA 2HT4D 3RPBA 2ED6A 3ZE1E 5AALA 2AXGA 2PPAA 3IDGB 3IDUA 4MA3B 3ILQD 5FO7B 1WIPA 4ZMTA 1CB4A 1WG3A 2Z31D 1BX2A 3IMTA 5EUKA 1JVLA 1OARH 5KYYA 2BSEA 5DR5L 2PCXA 3X12A 4BFBD 1ZHBB 1XGYH 1S9KC 3IE4A 3RE0A 3C5JA 2ZCZA 4I2XE 1BVNP 3M17B 1ZEAH 3I6LE 3WE6B 4X5PA 4HUVA 3TO2B 3AXLA 3KWWB 1LEIB 2XQYK 4N6QA 2VERA 4WI3A 1E3XA 3MAWA 3PYCA 1NAMA 3BZFA 3D25B 4L8SA 1S7TB 4IKNA 3CQFA 2L7QA 1JN6B 4CADB 1MHHB 4O2EB 1JPSH 1KJMA 3TBTA 2YHGA 3C5ZC 5DT1H 4K9EC 4DPCX 5ID1B 2O4EA 1AR1D 4YDLB 2FBJL 1LP9E 3SPCA 4QRPE 2ZXDA 5F44A 3IMVA 1NGXB 3CVDA 1WH0A 3TBCA 2Z93A 3FO0L 5LXVA 2DPKA 2OXHB 5G55A 3I74A 2VXUH 3PJLA 4LKXA 4RFEA 4Z77B 3GSWB 4FNLL 2F1EA 4M43L 1IM9A 2CLVA 5LAXA 1UJ3B 3ZHDA 2OK0H 3HAEH 1FGVL 1BEYH 1J48A 2YRPA 3BKYL 3GSQB 2ADGB 4FTVE 4QRUA 3HBPA 5H8DA 1BMGA 2DH2A 1PCXA 1A22B 1KCUH 3DX6A 4Y2DC 3BAKA 3V6ZA 3VFPA 1QO3B 2WKGA 4NSKA 3ROLA 4X2UA 3AGWA 2ERJC 2CRMA 4QCIB 3TBBA 2X4PB 3RWCB 3MOBL 4FFVC 4BZ1L 2MCPH 2WWMC 4JFVA 1CDGA 1MFNA 3ZT5A 5CSBA 3BH9A 2NY7H 5BS0A 3IU4L 1OTTC 5I6OA 4NN6B 3EHBD 4X0KB 5KJRH 2R29A 1QLRA 4Y9EA 4OF0A 5D7KD 3FO9A 3N2JA 4ATWA 1MCJA 2WQ8A 1CXFA 3RGVC 3EYOA 4GG6F 4N8VG 5KSBE 3EJPA 2N56A 1ZGLM 4EXKA 4U6TA 3MRDA 2G5BA 3L3GA 4KJWD 4R97C 3V5KB 2JELH 3MOAH 3BCDA 3CXDL 1NAKH 4F7MB 4Z8FH 1A4JB 3ZQXA 2ICWA 3LQAH 2DJUA 4WFFD 3VVVA 1I1RA 1VGEL 3S9DB 2VLJE 3BIBX 4HAKA 3N0AA 5IFAL 4GXFA 1LEKA 3SKJL 5A6IA 4HOXA 4B0MB 3BAJA 3FUFA 3I3EA 4PJHB 3UTTD 5EU4A 5GHWH 1DQLH 1RHHA 3KPSE 2B1HH 4K7FB 1SYVB 4B6ZA 1PLGH 4N9GB 1J8HE 5CN3A 1ZTXH 3T0EE 1U8PB 2DJSA 3FSVA 3GINA 4DSYA 1DANT 2PCFB 3D3VB 4G6ML 1FSKB 1SDDB 3IGAB 3MQIA 4ODVH 5JW5A 3VD9A 1Q9WB 5EBLB 5I66B 3QHZL 2Z35B 2HLFC 4NM4L 1A3RH 1PCSA 3JTTA 5J6GB 2MNJB 5B1AB 4K5NA 5EORH 3C09B 1NUGA 2EVJA 1KLUA 3SDDA 2CR3A 4BH8B 3MACH 3RIFK 5F7HA 1KGYE 3IFPB 4Z0BL 2BZ7A 5F93C 2NY4B 4AIXA 5MERA 5K33A 1WUNT 3LB6D 4V11A 3STBA 4QYOB 1IB5A 1IM3D 3MV9E 4O51A 5SWQA 2VQUA 3VI4F 3GDCA 3MRNB 4V33A 3DMMB 3FUHA 1SLWA 1WAAF 1YMMA 1ZD6A 2FO8A 4OM1L 1DQQB 1UACH 3L1GA 3NOIA 4FNRA 1I7TB 5IMLA 5CEZD 3MLYH 3U83A 3WN5B 5GZNC 4M61A 2P7TA 3VD4A 4PGEB 1PBYA 3DTXA 2B1AL 2P28B 3QDMA 1XEDA 4YDIL 4M6OH 1S7XB 3RZCC 1MJ8H 4K5LA 3ZTDC 2QKIA 1AY1H 1GS7A 2XNAA 4BFKA 2Y2WA 1PPIA 3VXMB 1JZJA 2IGFH 1GMIA 1U8QA 3SCMB 3BAEH 2IADA 5FYKU 2X4UA 4PJCF 3X1GA 4K9EL 3QEHB 4WZ9A 4ZNCD 1TTRA 4R9HA 1SHMA 3E6FB 2P8LB 4TS6A 3MBXL 5TFSL 5AOKA 1M6OB 1S7RA 5DU7A 2XX0A 2B3IA 5AZUA 3QNYA 4YFEA 5HYFA 3P4NB 4NZ8A 1HAUA 1K8IA 1TVDA 3GXFA 5C0RH 4NT6A 4X9GA 1E8WA 1YPZF 4CBZA 2JJSA 4Z7UF 4GRMA 4NC1C 1M7IB 5EOCJ 4G8FA 3ZUCA 3GSOA 2JKXA 2E7BA 2JLLA 3V4VL 2A2QT 1FO0B 1KUMA 2BINA 2DL2A 3ES6B 3QDJD 4GAJL 5IV2A 1DJZA 2X3AA 1WHPA 3JT0A 1BJ1H 5E2VH 3UABA 1F3DJ 2CO3A 4FAAB 1FRGL 3I9PA 5E8NA 3GM8A 2R2EB 1N8ZB 4GH7B 1S9VA 3HI5L 1ERNA 4XI5D 5HGBA 3FONB 1OSZB 3A4AA 4M6MH 5CBEB 1BIIA 1KTJA 2YSSA 2YXWA 2ZSVA 3P4LA 5T5NG 3NCJL 4PJXA 4EPSA 3HE7B 4ALAH 4EZKA 1EPFA 1ZK9A 1NCJA 3MRCA 4P9HC 4X5QA 1H3WM 1WE5A 5HHQA 4MNGA 3P0VL 1YY8A 5CCKH 3A6CL 3C60A 6TAAA 1IILE 1OK0A 1OT2A 2C1PB 1X4YA 4AQOA 4KNSA 2V8LA 1A6WH 2E86A 1R5IA 5JMOC 1TYRA 3MFGB 3WFCL 5FYLH 3PXJA 3RU8H 3N91A 3M7FB 1UD3A 1LDPL 3DV6B 4X4YA 4IMKA 5AYTA 5A40E 1KBGH 2EIKB 3HZ3A 4HWEL 4P2QD 1TMQA 4BQ6A 4OLYH 3CDFA 2VR9A 3ENEA 2WBKA 4KKPA 3NA9H 4QHKJ 4NB7A 1F3JA 1R3HB 3IRZA 3SPIA 2CUAA 1S3KH 4UQEA 5TE7L 4HFWA 1OPOA 4MJ5B 5D2LF 3O4OC 4KH2A 3GDBA 1AANA 1AGBB 1UD5A 1D2OA 1YNTF 3IDGA 3E7JA 3LVTA 4H1LB 4I18A 4MA3A 5FO7A 5I28A 4ZXBC 1BM3H 5K93A 4M5TA 2Y6TE 3GT6A 3VH8A 2X6VA 2WMPB 1FLTX 4HMCA 5F3HA 4F8TA 1ZHBA 5LBSL 5GJSH 4QWWD 43CAB 3NSXA 4NQCD 1NGYB 5HI3C 2EACA 4O02L 3BD3A 3TO2A 3KWWA 3MRRB 1LEIA 1HVXA 2FZ3B 5FYJH 5DD0H 3U25A 5LGKA 1ZT7B 3F5WB 2J8UB 4CAGA 9PCYA 1P5VB 3D25A 3NABH 4YS4A 1EXHA 1S7TA 5JIQA 1RPUA 3S3PA 1MHHA 3QUXD 4O2EA 3RDJA 4Z95L 3C6SA 4LHJB 5ID1A 3ATEA 4PIRF 4RFNC 4ZBJA 1N67A 4U4BA 1YQVH 4WTZG 3CVCA 1NGXA 2NTFB 2Q3XA 1KNOB 5JQHC 1JMZA 1Q0YL 1W16A 4K71C 1TT6A 3O9WB 5HDBF 1SBBA 2RBLA 4MMZC 4FG0A 4Y1TA 2NT0A 3GSWA 3US0A 4ES8A 1UJ3A 2MKWA 3O6FD 1TTBA 3NIFE 3DX7A 2A9NL 5E94B 3BKJH 3PCYA 3QQ9C 4JQVA 4PVMA 2E74C 2ADGA 4XX1E 1OPGL 4XE5B 5JXEA 1XCWA 4NIYE 4JHUA 3CSYA 3QIUD 3ULVE 2Q1EA 4QCIA 4LEEA 4C56E 5AB9A 1VFOA 5FV2A 3OF6A 3VXPA 1U2CA 4KXDA 2DAVA 2FJGB 3GZKA 1F4YH 1YEFL 1F4HA 1WZ1L 3LZQA 4U1KB 4EEEA 3VU2A 2EEAA 2X2HA 4IRZA 1AACA 2PO6D 4ORZC 1A66A 4AITA 3LZRA 3VWKB 1JGLL 2OV0A 3TURA 4PJ7F 4I0CC 4P5TC 5I9QB 4PVNA 1WHOA 3F7VB 1U4EA 4C83B 4KOCA 4L3EE 1UB6B 1RURL 2ZTBA 5F7MC 1LO2L 4J3BA 4PS3A 4HLZH 2CA4A 2BOCA 4YXHL 4NO2B 4JFHD 4P2RE 3P0GB 3QQ3B 1X5IA 2H3XC 2YFNA 4LBAA 1E4JA 1TPXB 1UWEL 2XIBA 3BESR 1Z5LA 3IPFA 3VRJA 4F80A 1AYRA 3GHBL 1SYVA 3FB8A 3FN0H 2EE3A 3ZTNH 1IAIM 2IAMB 1SDDA 2I24N 2CO6B 2KYIA 1Q9WA 5I66A 1MHEB 1GAFL 2AKRA 4PYGA 3D2UB 3THML 5J6GA 4F8LA 3MVSA 1VGKB 3MCKB 3UC0L 4ILDA 2IPTL 2KQNA 3EUUA 4OVUA 3MV7B 4Q4EA 3WUZA 2A1WL 4YLQT 5GGVL 3LN4B 1HXYA 3CFKB 3PREA 1EO8L 3QZMA 4RESB 3C12A 4I85A 4QYOA 3FSAA 2YJQA 3MRNA 2UWEE 3DMMA 1HT6A 1MY7A 4HHAB 1U91B 2WSKA 5FOBA 1S4IA 3UAJA 3ZDXB 2VITB 2QQKL 2MNUA 3MLSH 1L7IH 2D7OA 4QDGA 1WV7T 3WN5A 1I7UB 4OZGA 1SHWA 3HC0B 1KACB 3OAWA 4PGEA 5AW2B 5C3TA 2P47B 1KN4L 1WFJA 3CTTA 3AADB 3RVVC 4IOIB 4ADIA 4X5RA 1AFVL 1UWXK 4UQIM 1NCDH 3AY2A 3ORJA 3VXMA 2CMRH 4KKQA 4X5WA 1IGIH 3WUWA 3AQZA 4UZUA 4GS7B 3HRZB 3SE6A 2QPSA 1ETB1 3GRWA 3HHRB 3KXFB 1JGEA 1RFDL 3QEHA 3INOA 4HWBH 4U49A 3TV8A 3UAAA 1KPVA 1KGCE 2P8LA 2JCCE 2HLFD 1JSYA 4PRIE 1E5BA 2JV6A 3IKKA 1W80A 3VCLB 5IM7A 3FO2A 1PAMA 4N0RA 3QO1A 4FQ2L 1A9BA 4NQTA 4R5VA 2AGJL 3MLUH 3ZE0B 1RIHH 5JR1H 3QPXL 5FO2A 1EMTL 1O7DC 2VJ0A 2WQUA 5C7XH 2CKBH 4PJ8C 1UCTA 2ED7A 1CFSB 2J2ZA 7CGTA 1T4KB 4YZFF 3EKCA 5IW6A 2OR9H 1CGXA 3LPWA 4GRLA 1T20B 1X5FA 3P9WB 1H3TA 1IEHA 1FO0A 3ES6A 1QSVA 5JPMC 1WA0X 4B9KC 1CBVH 2VWEC 4BJLA 3CSFA 4FFZL 5GZND 2R2EA 1N8ZA 3APCA 3H9SB 1OHQA 3WFHB 3Q5YA 3QDHA 3V8OA 4UZGA 1SRDA 2CIIB 2VRKA 2H41A 3RZCD 1OSZA 2OL3B 3UTPD 5CBEA 4N3UA 5AZ2L 3AXHA 3HE7A 1F45A 1XT5A 4AYSA 3KYMB 2F5BL 2BSDA 5KBDA 2DL9A 3L1EA 4V2CB 1T03L 5AB0A 2H1XA 1F4XL 1U2YA 1QRNA 1V7MH 1X3DA 2HVBA 3QIWC 1L9RA 1RZQA 5L4IA 1T6BX 1SXBA 2X9YA 2YN5A 2OYLA 4AE0A 5JDJA 4I7ZC 4E5XB 4UWQB 1AR2A 4UV7H 4OZFB 3QRGL 2D2CC 4OFIA 5FA3A 5DRNB 2VL5B 3S3DB 2WYHA 2EZ0C 4AJYV 2PLTA 4FFYL 3PGDB 3ZKNC 3SE3C 3LPOA 5IREA 3CHPA 3BVVA 2QADB 1XTLA 1SMAA 3W9EA 1IGJA 3Q1EA 1UZ8B 4M00A 3IEAA 1NCBL 4PTUB 1R3HA 1XF5B 2OR8A 5CN2A 3WGVB 2JH2A 3KGSA 4MJ5A 4YL4A 1F56A 4JFPA 2X1QA 4LEBA 1DQKA 1DQTA 4H1LA 3BWUC 4X4MA 2Y9RT 3Q5TA 4GMTH 4G9FD 1U58A 1BD2D 3LOWA 3QXWA 2YLKA 4Y4FD 2WMPA 4MJ6B 5CIPB 1KSRA 1CG9A 2C9QA 4HXBL 4JFEB 5CHNB 2PABA 3N6YA 4IRJA 3WELA 1AKPA 43CAA 1EVUA 3D48R 5IWLC 2AI0L 2FZ3A 2LHAA 1AHKA 1NCNA 3GBML 1ZT7A 4F7EB 4PG2A 1I8KB 2HT3C 2CRYA 2YD4A 4MAYC 4G2AA 1KC5L 1AHWA 5GSVB 2G4GA 5T1KB 2FWSA 3MJ9L 5ITFB 5ESQB 2BX5A 5AVTB 1BZ9B 4WHCA 1VDGA 2IMNA 4TLUA 5J3HC 3KPTA 1MRFH 4HS6B 1UM4L 3AC0A 4KXZI 2GJZB 3DETC 4XP6H 5E8OB 5KUKA 4LSSL 1KNOA 1OAUH 3FQTB 3DPBB 1E4XL 4R7VA 3GJFK 1K2DB 3O9WA 4MLIA 1I3VA 4M1GL 1QPXA 1K5NB 2X4RA 4JFDE 1COBA 1OP4A 1CLYL 1KGWA 3QQXA 1TNMA 4YC2C 4GQ9H 4LGSB 1FFQA 5CJXA 3HAEB 2P48B 3BDYL 1JZ7A 4LLAA 4WFHE 4WK4B 5A2IH 4NQUA 1EZUA 2GFBB 3B1UA 3HG2A 1B0IA 4UM9D 1T2QH 3RDTA 5DJ2B 3QS2A 4KI5F 2H45A 4M5YL 4PGCA 2WB1A 1RXLA 3IYLW 4ABWA 2VZ1A 5HXMA 5D72H 1A3LL 3PL6C 2VKXA 3D0LA 4U1KA 2LTQC 2PXYC 3NZUA 4TUJB 5HI3D 4QTIH 2BNRA 3VXRD 1YAIA 3C6EA 1EDYA 2PWEA 3VWKA 5DUBA 3QJFA 1UZ6F 2R1XB 1GZHA 2HVKB 4FTDA 1SBSL 3F7VA 1QBBA 4NI6A 1NLDH 1T6VN 1UB6A 5IGXL 3BRDA 5EC2B 4HK3N 4Y8DC 3RKDC 5HTSA 1TQVA 4KRMB 2ZCKH 4XP4H 4GG8A 4J3XA 1IJ9A 4WFGE 3ECUA 4P2CG 2Y1ZA 2H1PH 3O11A 1O5DT 3QQ3A 3Q9QA 1BAFH 2DIBA 4IU3B 2KT6A 2WBXA 1YECL 4G8GA 1ECYA 2EIDA 4A2HA 5DCCA 2JJVA 1IAII 2IDQA 3ZBMA 5JOPE 4WW2F 4XOEA 3Q0HA 1J9RA 4RGNC 1CDYA 2VSCA 1U92B 3FQ2A 3QQ9D 1EEYB 2HKHL 2X53A 2IAMA 1YEEL 2EUWA 3WG7B 3ARPA 2CO6A 2E8YA 4LEXL 4OCWL 3UGEA 2A7BA 2F58L 4JQIA 3NH7H 1DQML 4GAYB 4HHGA 4L3FA 5IESL 1JFHA 1VGKA 3MCKA 3T3PB 2VUYA 3H9YA 4UIMB 2CHXA 2XKSA 3MV7A 4BK8A 3DX3A 4G7QB 4XCYB 4JM2B 4FYRA 1T6WA 2HB0A 5E2UH 3LN4A 1CE1H 1VERA 4E41E 4JPKH 2D0FA 2QEJA 3UBHA 2Z4QA 3IDYC 1HU8A 5C07E 1YYML 3ESPA 4HT1L 4WI7A 5GS0D 3MPCA 3B9AA 1U8KB 1HQRB 4I0PB 4RWYH 3M1OA 1OF2A 2D03H 4G9DB 4NQEE 3RFRA 1Q1JL 4P5TD 1UENA 3FOMB 3QB7C 1H8NA 2Z8SA 4HKZB 5F1OB 1KTCA 4QKXB 5BUGA 1OB1A 25C8H 3ESMA 3A3YB 3ASWA 3WKYA 1CL7I 5JYMA 1CIUA 3QC6X 5J11B 3N43B 4B9ZA 3WHE1 1S7WB 1BQHG 5D1QC 4AV5A 4GO9A 4IOIA 4XBPA 2Z0UA 3M86A 4MA1C 3G5WA 2XZCL 7PAZA 4OR1A 3FU9A 4NENA 2DLFL 2B16A 4ZNEA 3AREC 5J13B 5JORA 3BJ91 3S4SG 2ORBH 1F2QA 5I71C 4HLEA 3U9UB 1DDTA 1PY9A 3VFSB 1AC0A 5IEHA 3WO4B 1R3KB 3KXFA 1J1XL 4D94A 1TYJA 2NQCA 2YARA 1AMXA 5MI0B 3VCLA 1EZVX 4ES9A 4UZSA 1UGKA 2GY5A 1AS8A 4QHLB 4XVUC 5HDOA 1I8IA 2IOMA 3F65A 5I0ZA 2F7OA 3SDCC 1Q4NX 3QWOB 2PMZA 4L4VA 1E90A 4OFVA 2WBJA 4KUCF 5C0NC 2GJ6E 2NMSA 3R4RA 4LCYA 3GXPA 3BUTA 4BK5A 5DTFA 2XX1A 5T33L 1T4KA 3N04A 4X7TB 2K6WA 3VSVA 1D7DA 5MEPB 1A4KB 5MP6H 4OIBA 4MKMA 3TF4A 4H25B 5L9DH 3WYRA 2E6PA 2J1WA 1WAEA 3SBQA 3IFNL 1M1SA 4GBXB 3GSNL 3H9SA 2JB5H 3T6XA 4Q4IA 3S35H 3L1FA 3WFHA 4G59C 3HG5A 4FJYA 3HHSA 4N90D 3C2SA 3MRHB 3RVVD 2CIIA 2LAGB 3LZLA 2OL3A 1DDHB 2VLKD 5IHUH 1MXDA 3QXDB 4FQ1L 4U1MB 2FATH 2OZNA 35C8H 4HJGB 1RP9A 4AENB 4X6DB 5J9PB 1ES0B 4KTDH 1KYDA 2ESVD 5LGYA 4ZMYA 1FFTB 3ARDA 4OCXL 3J07A 1G7PA 3TVMB 4R3SB 2AHIA 3L95A 2WWKT 5SWZD 5BRZA 4YIQA 3D07A 4NZRL 4E5XA 2WZPA 2A6KB 1J87A 4PTTB 5GQBA 4BFIA 3GXUB 4LHUB 2VM3A 5DRNA 1NMCB 3QULA 3TU6A 3RY4A 4JGNA 3VB8A 1BAWA 1A3QA 3G9AB 4MB3A 3DPDA 2YXFA 3F6LA 1I9JH 1OAYH 2IXQB 4TNEA 3QNXB 2O1AA 4PJ8D 5C0CE 5D5ME 1JDAA 4Z0XB 1UZ8A 1RULL 4PTUA 3ZDZE 4NJAL 4MNQE 4MDJA 4DKFL 2YQGA 2ZCHH 1XCXA 4ZSOB 4FQXB 1KEGH 5D7SL 3WXVL 1XGUB 3FRPB 5B8CC 5DHXB 1A7PL 4BXSV 3GXMA 1CGUA 3FF8A 5CR1A 1E0OB 2DQUL 2BS8A 1T1ZA 1FNAA 3AS0A 4JE4B 4MJ6A 1A6ZB 4TULH 3HNVL 4JFEA 2RQ8A 4JO8A 5CHNA 5KYWB 3ARSA 2XT1B 2R0WH 4OFQA 3MNDA 3MBWA 1NGQL 2DQIL 1E2VA 4OH2A 1VFAB 1SZNA 3NCCB 4NJ9H 6FABL 2AJYL 2APXA 5DC9B 4NRZA 3IU3B 1I8KA 3G6JE 3HRPA 2F19L 3QIBC 4F7EA 1WWBX 4GXVH 3D50A 3QIWD 5GSVA 5T1KA 4LPUA 4HALA 4HA1A 1TCRB 2FX7H 5ITFA 3BGFB 5ESQA 5I1DA 1BZ9A 4JX0A 1UWYA 4FQLH 1EHAA 1F58H 3QDME 4CMMB 2HLEB 2JB6A 3H6JA 2GJZA 4OCRL 1ZKAA 4ZD3H 5E8OA 1NMBH 4X6FB 1IAKA 2NXZB 5CBAB 3FQTA 5FHBL 1RZ7L 1YQ2A 1K2DA 2EZ0D 2ADIA 3MOQA 3ISRA 3LKPB 4PJAB 3STLB 3ZKND 4X4KA 2W07B 3DUHA 1TQWA 2XXMB 4N2CA 1TXKA 5EO9B 3B1TA 1D5RA 1HE8A 4XAWL 4LLMB 2ATPB 5A3IC 3HAEA 4N2FA 3DK2A 3HS9A 4PI2A 3PHOB 1RIUL 5JHLH 2PP8A 2WHVA 4HIJB 4H8WL 3KD4A 3UTQA 1E9QB 5E5RB 3WFBH 1H0DA 1IGFL 5D1XC 4JRYD 1CYWA 4B41A 3ABKB 4X8JB 1L9SA 2V5RA 5C0IB 3SN6N 1DQIA 1MW0A 1PIFA 4QJ3B 5DJ6B 2IH9A 2K6YA 3B2VH 4PWJA 4YDKH 4B97A 3SBWC 1LJMA 1FAKT 4XCFL 5H4YA 4MQXC 4XH2B 4AGPA 1DQDL 3F01A 2EYTB 4B3VA 3BRFA 1QZ1A 2CK0L 3O3BA 1OT4A 4M7LH 3TESA 3QA3A 5F96H 1CLOH 1KJVA 3NZHH 3IDXL 2HT3D 4MAYD 2R1XA 3NJHA 3RFZB 2FSDA 5JW3H 3GSVA 4A63A 2BNQD 2WXOA 1G9HA 1MEXL 4MGXA 5ERWA 5FK9A 1PG7X 2DOCA 3UYPB 5J3HD 4LRNH 5D2NA 5DK2A 4WEUD 2AQRA 3DETD 4I4WB 1CZ8L 4KGLA 1W72H 3HB3D 4HU2A 4U05A 4D0CB 1HHKB 3JTSB 3K6NA 3STZB 4Q97A 2AV7B 4F9PA 3LNEA 3BGMB 5EZOL 3MGOB 4ZTPH 3CVIL 2EECA 2J1YA 2VDPL 1AKJA 2OSLB 3MLXH 2WN2A 1OZTG 2CNYA 1II4E 3D39A 5L6YH 2OJEB 3LCYA 4R7DB 1H8SA 1EJ6A 2YAQA 4Z18A 1IC7H 2I5YL 1JZ5A 1SLUA 3H54A 3R1GL 1U3HA 3HG1D 3IJEB 3F04A 5DS2A 4JFTA 3OX8A 1SVCP 1S6NA 4DKAA 3O3UN 4Y19D 2QPDB 1HS6A 4UIMA 4GP4B 4TM9A 4WO4A 4XCYA 4JM2A 1OP5H 2FGWL 5F1SA 3FRUB 2JKTM 2CE6A 3MZTA 5I19H 4FZ8H 4N2HA 1KBBA 5GISL 4O5LH 3SO3C 5TDPB 1JCKA 1KEMH 2ENPA 3PV6A 2XRAH 3MJ8A 1THAA 3NACH 3PL6D 4ELMB 4RQQB 2ZWNA 4DHLA 2FR4B 2PF6A 3KYNB 3A23A 4DP1X 4L18A 3Q1SL 3ZT6A 2ZYSA 3PJSB 2MMXA 4FLOA 4I0PA 5D1ZC 3UERA 4JFUA 3FHQA 3NSYA 4QF1B 4OFDA 4MX7B 2WVVA 4HKZA 3WY2A 3ZIYA 1R3JA 4L3AA 3V0AC 3RKDD 5KW9H 2Y07H 3FUDA 5E4IA 1QHOA 2X3CA 3QCTH 4KK8C 5SX4H 2FQGA 4AQ8C 2YMXL 4F2FA 3DRTB 2EE6A 3HUJB 4JFQA 2A3TA 5SX5K 3L3KA 3D85D 3TTYA 2G75B 2WKOA 4PJGA 4ZMWA 3HC4H 3L7EB 3FMGH 2CQVA 5EF1A 3U9UA 1F6FB 2FYYA 3VDCA 3VFSA 5EZIH 4NKDA 1HK6A 2JQMA 4RGND 1KYFA 3ATAA 1R3KA 4U2YA 1JNHB 5IVXF 4A6YH 1BG1A 1YY9C 4OZ4B 3UFIA 1E5CA 2B5IB 4JFFD 2VMFA 1DLFH 1RMFL 5J6SA 4LBEA 4JRXD 4K7PL 5C71A 4BM7A 1ID2A 3RI5K 1JD7A 3QUYA 4O9HH 1OAQH 3GI9H 3OKEB 4QHLA 3IJ7A 3K8LA 4MD5B 1I9RL 5AUMB 2UZIH 2FIKB 4F91B 4Y88A 1BVLA 3SE4A 1MAMH 1ZVSB 3VFGH 1J8RA 1XIWC 4TMPA 4F20A 1IKNC 1OAKH 1INDH 2D0HA 2ARWA 4E9LA 1RUPL 1Q0EA 2CKBB 4KI5C 2V2TB 1AOZA 4P23B 5B3NA 5MEPA 1OCOB 5GGTL 1JTPA 4Y89A 2OYMA 4H25A 4ZDHB 4UAOC 3KVPA 2HWZL 2QQLL 4GBXA 1DVZA 5I6MA 4KUZL 3S96B 2O6DA 4H2AA 4I3GA 3IGLA 4Z7WB 3K8KA 4L5FH 5JHDB 4LNRB 5D1QD 2E5EA 5C0AD 5DMGC 2NCMA 2V9RA 1KENH 1DDHA 2Y4SA 3QXDA 1J8KA 4XC1L 3O6MH 4JDEB 1CLVA 2B2XH 4L3CB 1Z0MA 1N0LB 1I3RB 3ARED 3SDYH 4AENA 2R69H 2OMZB 5IY5B 1ES0A 1UH4A 2VLRB 4PB0H 2QVMA 4MB1A 4XPGL 4N24A 1AQDB 1EHNA 1TFPA 2CWRA 4TSAH 3FYIB 4PQXA 5TK2A 1MVYA 4NO0A 2JKJA 4PJHE 5MENB 2F54D 3CMOH 4XVUD 3KYOB 1C7TA 3EXJA 32C2A 2X4NA 3SDCD 3OHXB 3GPSA 7FABH 1WIUA 3LSOB 3IGUA 4YBLB 2XU9A 2A9DA 3JVFC 1LQBC 3EF4A 2AABL 4AYEC 2IXQA 3D3VE 3QNXA 4GSXA 4QHNB 4LVHC 3DXAB 5C0ND 3TWCL 4XMLL 4AZ8B 1V7NL 1E8ZA 2I9LB 4RX4D 2ZPKL 2YUVA 1EO5A 2BHFA 2KDGA 1BJ1J 4JW3A 4QXUH 4ZSOA 4FQXA 1TNNA 2YPLD 4HUNB 2XZZA 4IBQA 3TBWB 4FFTA 2GQHA 2RJMA 1P1VA 4PJFB 1A6ZA 4A7VA 2WXRA 1J0HA 5D6CA 2EDOA 2C1OB 3WL9A 1A2YB 1AG6A 2IPUK 1UA6H 1VFAA 3LH2H 1WEJL 1B0GB 3SE9L 3ZTJG 3IU3A 1NKOA 2Z64C 4XO5A 2Z3FA 1TCRA 3AS2A 3BMWA 1D6VL 1LK3L 1JZ2A 1I9IL 4N0YL 5F7EH 4CMMA 1DJHA 3IPEA 4OV5A 4O2CB 3RA7H 4HPYL 4J12A 1HQ4B 4X6FA 3F85A 4JO4H 4P5MB 4LFHD 5CBAA 1M53A 4TQEL 3UL4A 4PJAA 4FABH 4FXGC 1IU1A 1BBDH 1YEJH 1TTAA 3O2WL 1FF5A 5EUOF 3E9UA 5EO9A 3SYCA 2VXQL 3OZ9L 4F7KA 1UM5H 3V9CA 3VTTA 1DJIA 1CYXA 2ATPA 2IOOA 3O4LB 1K3ZA 1T89C 1HHIB 5SWSE 3PHOA 1LL1A 2NY2B 1WT5C 1XXDC 3CBJB 4HIJA 4U7SA 3ZZ1A 1OB0A 1E9QA 1OM3L 4GW5B 2BY3A 4X8JA 2V7NB 2ZOKB 3TBYA 5C7ZA 5ECGA 4EAEA 5C9JB 3UPRB 4G6JL 3QDAA 3RQ3A 1NC2D 1BVOA 4L1HA 3ARBC 4NN5B 3VWJA 5EA0L 4FQCL 5E2TH 2XZQH 2MHAB 2Y5QA 2EYTA 4Z3EA 4W9LC 5I15L 3L9EA 1HJCA 3MDJA 3O3EA 3MXVL 4R0LA 4TLKA 5E6YA 4WF7A 4IBWA 2OI9C 2ZAHA 2R1WB 4UF7C 4D9QE 3QIBD 4X6EB 1UKQA 3F62A 4ODXA 3ABGA 4JJ5B 1FL6A 4XMPL 3JSSA 3QEGL 4ONHA 2PTTB 2UX6A 4IMLA 4FLRA 4K4KA 4PGBB 1BZ7B 4L4TE 2G4EA 3K5SA 3T1FB 3FCBA 1QI3A 4FKEA 4YHIB 2WJ7A 5JIIA 4KROB 3KBPA 3WIIL 4X5LA 4YNYB 4BCYA 3BP5B 4Q74A 3STZA 1DBJH 3BGMA 3TJEH 3MGOA 5F3FA 3ZHFA 5D4HA 1FG2B 4L8SC 3L5IA 3PS6A 4JY4B 4IU2B 4PJIA 4R7DA 2PPEA 4N3TA 4F58L 3ARQA 1PF3A 3BLKA 2AJXL 2WCSA 5E9DB 2YBRA 4RMTA 4DAGH 5KBMA 4S1SH 4KBPA 3AG1B 2AQ3A 4EI5A 1RUAH 4PD4K 1G7QA 5D1XD 3V6BR 4AWJC 2X4QB 4OGAC 1JF6A 3TL5A 1DSFH 4ONGH 1T7VA 4KITB 1B9KA 3JVGA 4UT7H 3K2UL 4M3JA 3DHUA 4XN5A 2X0VA 3OG6B 1MCOL 4JO3H 3TIEA 2R2BB 1FNLA 1QPKA 5C0BA 4JKKA 4J8QA 1P6AB 4YXLH 4RQQA 2FR4A 1WD9A 3MCLL 4IBSA 3KYNA 3PJSA 1L6PA 2WXJA 5EEYA 2K4AA 3QWQB 2DWEB 4MCZB 3VI3A 1S2EA 5CLTA 3VD1A 4MX7A 4NN7B 1U6AH 1CFTB 2OZ4L 2Z31B 1MNUL 3CVHL 3QK0A 3VFWB 4UQ9A 1D7FA 4L2LA 4R5TA 5TD4A 5AOIA 1YEHL 1AIZA 1XH1A 3DRTA 3HUJA 1J12A 2AJZB 1AD9A 1TR7A 3GZQA 4OCSL 2G75A 5TK4A 1I31A 3AU1B 4NFBA 3L7EA 2DM3A 2J8UE 2WNGA 4O4YH 4MJID 4NYLA 3FTWA 1Z9SB 2OULB 3ECWA 3ZE1F 3UTSD 1QLFA 4OGXH 4UT6L 3D8MA 2DM4A 4G7YL 3TTSA 1UXSB 4OZ4A 3ZRFC 4NNYB 2V3EA 1KCKA 5DO2D 1AR1B 1NJ9B 1RUKH 2W60A 4HWBA 4OUOA 5E08H 1SXAA 2R83A 3REWB 4MD5A 4BEIA 4MMYB 5AUMA 2FIKA 4ZFZB 1QLEH 3WOVA 5LLIC 4S0SD 2VSDA 3Q44A 4G72B 2VDQH 3JWNC 3RX5A 4Y1AD 3UXFA 5HI5C 2YD9A 2QR0B 2B15A 3A22A 4AJVA 4XVTH 4YHMH 1BFSA 3ZW3A 2CKBA 3QCVL 5G4NA 2CBMA 2D3JA 5D1ZD 1A6PA 3L4XA 4TL5A 1FGNH 3N3EA 5C2UB 4ZDHA 3SDDC 1X5HA 4YSRA 4YHZL 1TJIL 4OFPA 4JZOB 1MFEL 4W9EC 2XSKA 1J5DA 1PL3A 3EHBB 5KVDE 3S96A 1OAXH 4Z7WA 3QUMA 2DWTA 5JHDA 4KK8D 1TFHA 2J5WA 4EBQL 2C4FU 1UWFA 1N6VA 1RKRA 3RY6A 5AG9A 2R0LL 4JDEA 3BGAA 4X4XA 3WMQA 1FVEB 1L9TA 2PYFB 3RP1A 4ISVA 3BUYB 4N2IA 4F9LA 3RWFB 1OHZA 3IB4A 2VLRA 1M05A 1YY9D 4JPIA 1UURA 1BVZA 5L4FA 3P40A 4XXCA 2L8AA 4M62H 2E9IA 2QKIC 4Z7QB 4ZMOA 3S36X 5KSBF 1UT9A 3KPRA 5MENA 3KYOA 3UTTB 3S34H 1NAML 1ZTMA 4B96A 4WENB 3MA9H 3H42H 3LSOA 4JHBA 3OLDA 5E6RB 4XP9L 2WPGA 1UD8A 4LSUH 1XIWD 2R59A 3AABA 2Z1KA 4QHNA 5KVFE 1UGNA 2OMXB 2B0SL 4LPXA 4YFLI 1CF1A 4HGMA 1WFTA 3F12B 4QYAA 5HVGB 4KI5D 3ZIMA 1AH1A 5IMOB 5ACLA 2DV6A 5FFOA 4QXWA 2ITDB 3QSKB 3FH8A 5FUOH 3RWEB 3MRBB 4A1RA 2R56H 5JA8B 3TBWA 3NRPA 3KLHC 1WDAA 2VXTL 4ZUVB 2QGBA 5GS0H 2ROXA 3S3CB 3VXTA 2JJSC 4K94H 1J1OH 3UMNA 1LWRA 2BFVL 5DMGD 1XFPA 1P4IH 3R0MA 2MEJB 4J7RA 1G94A 3E2HC 1FL5B 1ADQA 2AQTA 3FN9A 1IM3B 1NWPA 3W0WD 4QRTB 2VDKH 3QC5X 5F7WC 3WNOA 1UC6A 1B0GA 1KXQE 1PZ5A 2R29L 2WXQA 2A99A 4NQSA 4F57L 1PZSA 4XN7A 2VQ4A 4MQ7A 2OM5A 5FB8B 3N85L 3Q13A 1PTZA 5DF0A 4Y2NA 3RY5A 3UTZA 4DGYH 4PH8A 5LCVL 2VXSL 2YGVA 4K55A 5IW1A 4P5MA 5C8JB 1WA1X 1Z66A 3SYOA 3B37A 3G6AB 5CGBA 2E46A 3KCPA 3C60C 2WXNA 5C3IA 2P44B 4R4FH 1U8LA 4ZAKA 4G42B 3V0VA 2IQAB 3W39B 4EQ3A 1LO3H 3N5AA 2P80D 3VB9A 4AJ0A 1MI5D 3O4LA 4J3OC 5B7FA 3CFNA 3EXLA 2YRBA 1HHIA 1A02N 1SLXA 5ALCL 5KVEH 1G9MH 2D4DA 1BHGA 3CDGB 1R34A 4N87A 3FUNA 4NP4H 4Z7VB 1QR1B 5JUEL 4YE4L 4GW5A 4RH4A 1P7HL 3SD5A 2V7NA 3UAEA 5ISZE 2E76C 2J44A 2ZOKA 1CFMA 4IMKC 3TT3H 3ZE0E 4FX5A 2DMBA 3QRBA 3NJMA 5DRXB 1MFBH 1YEIH 2QHRL 5C9JA 5JDSB 3UPRA 3EO0B 3REVB 1TLKA 3EW3B 2VXVL 2YD2A 3U7YL 2Y1AA 3LS5H 3QG6A 4OD1H 5IQ7L 1F18A 4HUXA 1JK9A 2TSBA 3WTWA 3LQZA 3PP4H 2V6HA 4JN2A 5DMJB 3WDHA 2NY1C 1EAQA 5BMFL 1GYWA 2A4EA 3QFDB 2R1WA 2XG5B 5L7XL 5IP4A 4I18C 2ATKB 1W6LA 4X6EA 4LPWA 3RNKA 3QDJB 1EGJH 3LHPH 3AG3B 2XTSA 2PTTA 1FIGL 3F7PC 2Q3AA 3CSTA 3DC0A 4ONOA 1BZ7A 1KY6A 3E80A 2Y36L 3HMXH 2QQNH 5IROA 2GUYA 4YNYA 4WW1A 3CIAA 3BP5A 3VXUD 2AVGA 5J6HA 1DUZB 4K8RD 3LZNA 1Z3GH 1W72B 1FVDA 2D31B 1A7RL 2JI3A 4JR9H 5EOCL 3C5XA 1MNNA 2ZIDA 1PKQA 4JY4A 1G84A 4IU2A 1NDMB 3QFJA 1Q0XL 4JY5L 4YSDA 1DFXA 1XH2A 3FCTA 2ODHA 3I9IA 4YDLC 3UC2A 2XACC 1DQJB 4M8RA 3CC5B 2P3YA 1E4WH 4X83A 2R0ZH 1TO5A 3ETBF 4PRHA 2F1AA 4E36A 3DKHA 5EOTA 2VSMB 5KBNC 3S37H 4BYHA 2PW2A 4IGBA 3ULUE 1UJ3C 4IIZA 1Z9NA 3L3HB 1WISA 2NCEA 4JQVC 3D69B 3V4PH 4P2QB 3ARBD 5HHMD 3WTSA 4HKJB 5D96C 1ZXKA 4ZFGH 5JXEC 4Z5RB 4C54A 1W0YT 1OT1A 3CV5A 5HBBA 3EGDB 1WZKA 1CDBA 3B6SB 2EDXA 1U95B 5FDWA 1I53A 1QRKA 3BLBA 4KKLC 4WUUE 4HV8B 1NANI 1J5IA 2DWEA 5IQLA 1N26A 3FCSA 3HW7A 1IEAB 3VFWA 4I13B 2VDLL 5JPNB 2ZKWA 2C4XA 1LM8V 4HJ0C 3VW3L 4K3EL 3Q43A 4TQ8A 4P05A 4H20H 1U8MA 5DVMA 2WSDA 4NQCB 2Q86B 4BSJA 3AU1A 4R26H 1KWKA 3N50A 4TSCL 4JQXA 1IBFA 3VRIB 5HGHB 5BQ7B 3L6FA 2EDLA 4HUUB 4M02A 1OSPH 2DBLH 4ZMVA 3PUUA 2P5WA 3QUXB 4NNYA 5EBMB 4EOWH 2GJJA 2H3KA 3INUH 4EKXA 1NJ9A 1JFQH 1BF5A 3II2A 1F97A 5I1KL 2E75C 1MKFA 3Q6GL 5AWNH 1R9FA 2AEIT 3LKNA 4AW4A 3DURB 2DQDL 2NY3C 1IM9D 2DICA 4ZFZA 3BP7B 1LMIA 1NINA 4LSPH 3FFDA 2HTKC 3RJDA 2YA1A 1FSKC 3EADA 1DJXA 3SJVA 1JI2A 2QR0A 3ZZSA 3BIKA 2W65B 4RWHA 5E8DH 5I1CL 1E4KA 2FQDA 3QIUB 2YKKA 1GGIH 3A6BH 2R2HB 5JNYA 2DKMA 3NDZE 3N40F 5HY9A 1MH5B 2NY0C 2QQQA 3CDYA 3HKFA 3ZKXC 5BS0D 1S9WA 1LNUB 4PJEE 1MFAH 1CFNB 2XBDA 2DQHL 4J4PA 2ZG1A 2EIBA 1AZBA 4K3DH 4F8QA 3GBNL 3NIFF 4KNQA 2BVOB 2X5PA 2E7MA 4NZTH 5IMKB 1U2HA 1E8YA 5AAMA 1NCOA 5DLMH 1RSYA 4JFWA 3ARXA 5I1EH 1RZGA 2AEQL 1YJDC 2G9KA 5IZ7A 3DMMC 4XN8A 3WNJA 4JANA 1UA3A 2PO6B 4GFXA 4JDTH 3ULVF 2MKLC 5EU6A 1IGYA 3RWFA 3UAJC 4POYA 1J10A 4N8VA 4U1NB 1H3PH 1XF2A 1Z2KA 4L0ZA 3WN5C 2VDNH 3GLDA 4OAWA 5DD3H 3NIGB 4YPJA 4XOBA 4RGOH 3OAZH 4RCAA 1RU9L 3FB6A 3FSWA 3CFMA 2XPYA 3UTTA 2PPCA 3PPEA 1NDGB 2FK9A 3I6GB 2ZX9A 2ZF9A 5HYIA 2DQJL 4BCZA 2AJUL 1S9YA 4PB9H 3H55A 2OMXA 1ZTXE 2YRLA 3QNFA 3F12A 3V7AE 4FQIL 4JPQA 1Q94A 1F0LA 4B9YA 2ERJB 4IBZA 3MRBA 2XFXB 4G82A 3SDDD 2Y7OA 3C08L 5D7LA 4S11A 2LFGA 4BQ9A 1A0QH 1MHPL 4ZUVA 3GMPB 5HYJD 1TMCB 5TTRA 5CEXA 5IVOA 2FYVA 1A7QH 3KWVA 1LYQA 5D8JL 4MJJA 4PJ5D 1C08B 4GRLC 4HJUA 1A7OH 1A4BA 1T04A 2K0RA 5TDNB 4AKQA 1IM3A 1ZLSL 4R97B 1IGTB 4QY8A 3I02A 5D7IA 4K73A 4BHUA 5CCJA 4JAMB 3DX0A 2RCSL 1ACXA 5FKAB 2LE9A 1N64L 2IPKB 1IE4A 3NRFA 1DE4B 3NAAH 4LPCA 2XY2A 3W5NA 1D3CA 2WQRA 1IZKA 5FB8A 4IRZL 4OB5H 3OAZK 1CD0A 1VFUA 1UKSA 1H6FA 4ORGB 3L3JB 3HE7C 5IQ9A 1CD9B 1MOEA 5C8JA 4ZOAA 4LVOB 4C4BA 2W59A 4KFZC 2ADFL 1JGVL 1DBKH 1JHLL 4K5OA 2UWEF 2V7HB 4I3SL 3FQYA 4DN3L 4I48A 4P49A 4NNXA 3BIAX 4G42A 4JFZH 3NCMA 2IQAA 4KGJA 4TQPA 2MH4A 1W15A 1GRWA 1EFXA 3O8XA 1UH2A 1N19A 1URLA 4KDWA 4OCYH 4OLZL 2LOEA 4PRDB 1QR1A 2Y7QB 1UXWB 4ZUSB 4KZCA 5JHLA 3ZSSA 2NSQA 2C5DC 4ZS7L 2FD6L 3B34A 5EBWA 1SUJA 3WFEH 3KLHD 1DBAL 3EO0A 1VFBA 5F6HI 2WTRA 5DEGA 5TJWK 3REVA 4KKAC 5DUPL 2J20A 3GC3A 1CDHA 4N4YB 5ESVB 4HBQA 4ODBD 4RMSA 3ZL4L 4DGIL 3TLRA 4JM4H 5ACZB 3PY9A 4YHKH 3TH4T 3K5RA 1PG7W 5HPOA 5F7DB 4B95C 4UOW0 2JCCF 4HFUH 3Q3GB 4HULB 2XN2A 2Y5TB 1A14L 1JF1A 1M7DB 2C9UA 3MR9B 5BVPL 3QDJA 5LDUA 3CFCL 2DYRB 2QMJA 3LEYH 1O6SA 5LQBH 4GIAA 1GJUA 5EZJB 1V54B 5HI4D 4IRJC 2YUWA 3MODH 3PHSA 1XZ0B 3RZCB 1PJWA 2Q8BL 2JWYA 5GJTL 4DH2A 4IRSC 1D5IL 4H88H 2P5EE 4LRIC 1L3WA 2HJFB 4X6DE 4ZODA 2D31A 2IG2H 3C60D 1AHWC 2ZG2A 3FU3A 4S2SA 1J5CA 1H6UA 1MJ7L 1K72A 1NIFA 1RZJL 2O30A 5FYKD 1NDMA 5ITBL 1VESA 4J3OD 1MJJB 3EDKA 3UBFA 4AMKH 1GYAA 2FJUB 5HHVH 3CC5A 4U7MA 1PZ2A 3QEQE 4YOKA 2ZX8A 3P3RA 5FW8A 3N41F 3TV3H 5LN4A 5DWPA 2MSPA 2Q5BA 2VDRH 3L3HA 5CS7A 3KL0A 2W0KA 4KTGA 4P2QA 2AV1A 4KO5A 5TQ2L 5CJXC 4HKJA 4PG9B 2V3FA 4WFED 5AOLA 4ZYKA 3K91A 5H37G 2E9WA 1F4WH 2H7WA 3EGDA 1ZA6B 5AZEL 2QTVA 2NY1D 4HLJA 2C3WA 1U95A 1NFIB 5ADOH 1AZRA 3BPCB 4LB8A 3V5DB 4A38A 2G2PA 5B21A 2EIEA 5EG6C 3RDTC 2N7BA 1G7LA 2YIHA 2YPVH 1ASQA 4G1EB 5DJ0A 3LN5B 3UX9B 4NGHH 4KHTL 4NQDE 1C5BH 4G9FB 1BD2B 4Y4FB 4Y4HD 3MXWL 5HDLA 3HJ0A 2ZYIA 2BSSB 4IS6B 1FO0L 3R7QA 4NQCA 2NNAB 1MRDH 1ZS2A 3VWKC 4F15C 3WBDA 3SOBL 3VGAC 1GZHC 2Q87A 5KS9B 2VO8A 1J0JA 3SDXE 1KJ3L 2CO4A 4FQHA 4JUSA 2F68X 2ZZUT 1IGCH 2H26A 3HMWL 5F1NA 3QUXA 1OGAD 3K2KA 3KWXA 3SPVA 2VISB 4X6CB 4A6YA 3M7OA 2F8XC 1OAZH 1M71A 2ZX5A 3WEXB 3ZDWA 4TVPD 3CPUA 3NMEA 3N44B 2CNZA 3DURA 3ZKSD 3BP7A 1YYLH 4Y9BA 4F7PB 1ZVYA 2Z91B 1CDCA 4BKLB 4U6HA 3FJTA 5HGAA 2IAMC 5BVJB 4JS7A 4KKCC 1P5UB 3IBEA 5JXED 1T5XB 2J1ZA 2W65A 2VDQB 3VDBA 1CXLA 3OKNB 1HWGB 4G6KL 3QIUA 3V0IA 2ENQA 2I7OA 2OCFD 2R2HA 1KIPB 5DS8A 5T5FH 4KKLD 5MEOB 1MH5A 3UJTH 5DC2A 2FWLB 3O4OB 3UCRA 3OF6D 1ZV2A 3BUBA 1CFNA 4EO5A 4UM9B 3MV8E 4XBMA 5I5MA 1P6FA 4G6AD 5K9JH 3O6LH 4LU5H 4BHUI 2BJMH 2BVOA 1MRCL 5IMKA 4Q6KA 5I8EA 4HJ0D 3GD1C 3LZFL 4W9FC 5C08A 2WLNA 4PRPB 4HD9A 3S2AA 1CLZH 2D3NA 3CFTA 1SM3L 4RMRA 2PO6A 4P2AA 3U4BL 3VXRB 2VIRA 2AC0A 4KAQH 1S7VA 2PP7A 4DPRA 3KPNA 5H4ZA 1GIGL 1HL5A 4PBXA 1YEKL 3AG2B 2P9RA 2ARJA 4XWGL 2JKIS 2R69A 1GOHA 4UDTA 2C3GA 4N2AA 4RFNB 3U1QA 1AO7D 3QZBA 5KOVC 5I17B 5I6XC 1YSOA 2VAAB 5FECA 4PYHA 3KPPB 1GGCH 4K71B 1ZPUA 4D9LL 1XR8B 1KB3A 2NY3D 3T0XA 4GKNA 3KM1A 4MMZB 1TQSA 5IEKB 2A6DB 1JWUB 3I6GA 2Y1YA 1T0PB 2HTKD 2GIYA 5L2JA 2BMKB 2WZAA 1EK3A 3LHAA 2C4FT 1CN4A 1DBML 1A5FL 5LN8A 3ERXA 5CGYD 4ETQB 3E8UL 3VUAA 3GMQB 1GL4B 4N2LA 1JZEA 4AQEA 1KIQA 2NY0D 4MA7H 5E6SB 2W0FB 4N85A 3OMNB 4OTXH 3TT1L 3CHRA 2IGTA 2XTJC 4Z7NB 3T6ZA 3JV4B 5IF0B 1T66C 2WBJC 1QMUA 4KJPC 3UO1H 1UOVA 3NPZB 1KT2B 2W1NA 2O5YH 5E1IA 3UP1A 3KLAB 4YFLF 3C8KB 4ELME 2OMBA 3BHBA 1ONQB 4GKZB 2E6JA 1N7ML 3DMMD 5TDNA 3QG7H 3TASA 5E1AA 1IGTA 4YHPB 1H6EA 3GMRB 1BSIA 3F58H 3UAJD 5DJZB 4GNKB 5FKAA 4P5TB 4HXAL 2IPKA 4BZ2H 2VDKB 4XBEL 2OMNA 1DE4A 4GLRH 1GY2A 1S7UB 4RDBA 4OLUH 5FW7A 3G9VA 1A1NB 1EHKB 4QXGL 2G9HA 3HUJE 3AUWB 2MQCA 3GIVB 4GKSB 4IDJL 4ATTA 3P30L 3NRQA 3VXMD 4JN1L 5I30L 2AJSH 2C9PA 1CF8H 4U6YA 3ZRCC 3PU7A 2CDGB 2V7HA 3X13B 1CXHA 3OKKB 5KYUB 1BFVH 4E9QA 3QUHA 4IBUA 3ARDC 5GRXG 3QEUA 4KU1A 2GI7A 2D7TL 2CBOA 4L29A 3EH4B 5F70A 1RPKA 1E5YA 1W8EA 4GJTB 2R0KL 1UXWA 2CLRB 2OSYA 2V17H 4ZUSA 5KN5B 1F1DA 4HHWA 2EINB 3PDOB 4LCWD 2LAAA 1SHXA 2V8MA 5K9OB 2GJRA 2B3RA 5EU5A 2VH5H 2COVD 3NJNA 5ESVA 4N68A 4P9ML 3ARGC 3HI1A 2QLYA 5FGCB 5DK0A 5ACZA 4OI7A 1X6LA 4JQIL 1JRHL 2YOCA 4XB7A 3TYGL 3UMTA 4GRLD 5B38G 4FGMA 3DK0A 3Q01A 5F7KC 1OP9A 4L05A 1G7IB 2NPLX 2XVLA 4A7SA 2H0PA 4AEHH 4Q9QH 3AWEA 4LCIH 3T65B 3SGKA 4LHQB 4CMHB 2X05A 4J2XA 4PMEA 3J8F7 3ECVA 2QKSA 2P8MB 4Z7WE 3MU3A 4MXVE 1MPAL 3K4DA 1IKFH 1SEQH 1XZ0A 3PWJB 4PWFA 1OOAA 2VLKB 4OFYA 5EU7C 2GAZB 2FL5B 1EVTC 3MLVL 4AEIL 1P2CA 4NUGL 1IARB 5DQJB 1QRND 2HJFA 4XPTL 4WUKH 4HJJH 4JB9L 3DGGA 1CQYA 4H7VA 1A47A 3VD0A 5TPWL 2ESVB 4PD4J 3I6LD 4BKSC 1MJJA 3GK8L 5C9KA 4ANXA 5SWZB 4CJ0A 1NCUA 3P0YH 3IFOA 5TQ0L 3F7LA 5F3BA 2NNRA 3CFEB 4RAUB 4V1DB 3FTXA 1MN4A 1KTBA 1U8CB 3EJYC 1A64A 5HHPA 2BERA 2IAND 3D33A 4KKAD 4QRPD 1GJWA 1MW1A 3HZKB 3DXAE 1URIA 2WXGA 4MVBC 4PJ8B 4XC3H 5F7BA 5DJ8A 1D5MB 2XWRA 4L8DB 1D5XB 2ZCLL 2ZUWA 1MWOA 1NFIA 1L0YA 4L8CB 1FNHA 1JRHI 3BPCA 4GUOA 4E0RB 3VG0H 3R18A 4UCFA 1T83A 3ROOB 2KMWA 4LSQL 4XBGB 5JPMB 1NUFA 1G1OA 3FT1A 3DUSA 4G1EA 3T04D 2Q10A 1IT9H 1SN2A 2WXPA 4I77H 5FLUA 4ZFFA 1BF2A 4G9FA 1BD2A 3E0GA 4PJFE 5CUSH 2SEBB 4JG0L 1G1CA 1TTCA 4Y4FA 4LIQL 4IRJD 4BQ8A 3LQMA 5D5MF 1R3IH 4WKXA 5DEFB 3ZDZF 2BSSA 4IS6A 5BJTA 2GEQA 1OWRM 4KZDL 5DJYB 2F53E 1RK0B 3EDDA 4IRSD 4AW7A 3ETSA 3IXTA 3I75B 4QRFA 2AXWA 3X11A 1TCMA 2FX9H 1NGZB 1KFAH 3QIWB 3LQAC 4GAGH 5D2NC 3FU6A 2F5AH 2FUQA 2OL3L 1ZLEA 4LGRB 2VISA 4X6CA 3HVNA 2YXMA 1AXSB 1FN4B 3FUMA 3GI8L 1QNIA 2EXWC 4F9PC 4TNVF 1ZAGA 4B9CA 4TVUA 1SJEB 3BEWB 1OANA 5DYOB 2Z91A 3Q2LA 1HNYA 1XD0A 3FQRB 3G6JF 2WKLA 3WAJA 3L08A 1HE7A 4FG6C 1P5UA 3BRGC 1ZV9A 4XPBH 3O4LE 1T5XA 3OG4B 5F9OL 3UADA 4JVWA 4XPAH 1U3HC 5FCUH 4NS0A 1JOIA 4LCUB 5TH2B 3RWDB 4HZ1A 3W2DH 4FA7B 5IJKC 2YAEA 3KPSD 2AXFA 3T0BA 4YSAA 1OSEA 5IIEB 4FLHA 1J8HD 1Q9OA 4JRYB 3T0ED 5MEOA 1AQHA 1TIUA 2B59B 5E5MA 4WO4C 3RDTD 1L6ZA 4JM2C 4KDVA 3U0WH 1JPFB 5A6LA 1SN5A 4M9PA 4PP2B 5HYSB 1NH6A 1CS6A 4TPRL 3VI4B 1J0KA 3LN9A 2BIIA 5CJQL 3JBG7 1NCWL 2XJKA 3ZQ9A 5F0PB 5FHAH 2BNRD 2VGLM 3NQKA 5D70L 1HNFA 3NSJA 1JWMB 2V9QA 4I0PC 4PV8B 4PRPA 3VRLE 4JZNA 4W6XB 3VWKD 1H9DA 2OJZH 4MB5A 2AVFA 3MRKB 1HCZA 1FUNA 2EADA 2UX7A 3MRPB 4L9LB 5AYUH 5IFHL 4RNRB 4R2GB 2C3VA 3WNKA 1GGBH 1T1WA 3KHOA 3VXNB 4XNXH 1MJUH 2BNQB 2JTYA 3D5OF 1OD7A 1OARL 2VDNB 5I17A 4XMKH 2VAAA 3FFOA 4K8RH 1XGYL 3KPPA 3APMA 3HB3B 4PJCB 3UJJH 2GT9B 3LV3B 4G8GD 1ZEAL 4HU8A 4QHPA 5I1AB 1ZVHA 1I82A 1L9PA 2A6DA 3QAZC 1JWUA 4XOCA 2YKLH 1THCA 2IAMD 4KKCD 1N5AB 1S7QB 2FJFB 3MLWH 1JPSL 2D3LA 3BUQA 3AY4A 5E9DE 5DT1L 4YBQC 1EBAA 2I69A 4ETQA 1K8DB 2Y25A 5M95B 4WI6A 3QUYC 2NSXA 4W9JC 3AM8A 3HG1B 1LWHA 1FH5H 4JK0D 3FQ4A 1GR7A 2UY7B 4R90H 3H2PA 4Z7UB 4G6MH 3L17A 2VXUL 4Y19B 2P5PA 1S46A 4HBCH 2O61A 5ID0A 3JV4A 3S97C 5IF0A 3H7BB 2OK0L 1E27B 5C0GB 4G6FB 4Y9FA 1BEYL 1EDQA 1KT2A 3GSNB 3CH8A 3D08A 3DRQA 4DCQB 3KLAA 4LL1A 1PLAA 3C8KA 4UB0H 3OLIA 2IWGA 3FTSA 3G5XB 3PL6B 4FXTA 1KCUL 3B7UX 4GKZA 4U1JB 4RRPG 3T5WA 1C5CH 2LTQB 5CJOH 1QA9A 5BNXD 1TOXA 2E59A 1PFOA 4A2EA 5A1AA 1LQSR 3GMRA 4M1DH 5AVWB 5DJZA 5CR8A 2MCPL 4H0LC 4QHMA 4P5TA 2L7UA 4GBXC 2WUBH 4FKKA 3BPNB 2NY7L 4KPHH 4NDMA 3U46B 3VVWA 1S7UA 5KJRL 4QXTB 4I1RA 3ISWA 1HDMB 5H94B 4H8UA 4J28A 1XMEB 3IJYB 5IJVA 2AEPH 3D85B 4LDEB 5F9JB 5A2AA 2PW1A 1YN6B 4NHUA 2JELL 2CDGA 3MOAL 2VLMD 1BQHA 1NAKL 2Y5EA 3X13A 3V55A 4ALAC 4Z8FL 4XNZB 4MD0B 4OVVA 4WDIA 2Y1VA 3W81A 3MFFB 1HEZA 4RGNB 5E8EB 3PNWB 5HHXH 1CWVA 4JFFB 3LXBA 4JRXB 3K72A 1FJ1B 4OZIA 3KBHE 1R5WA 5KN5A 1NEZB 1SOKA 2ENYA 5ABZA 1KCVH 3PDOA 4L4VD 5GGRA 3VXQB 1WBZB 5GHWL 1DQLL 2XTJD 5TFSH 1X7QB 1T66D 2B1HL 1J05B 2WBJD 4OJFH 4OLXH 5K9OA 4KJPD 1PLGL 4OUUB 3GJEB 1ZTXL 3FYEB 3U36B 4H5SA 3VXSD 1KB5H 4JG9A 3E1ZA 3T2PA 5E6IA 1OIOA 5DFVC 2BWIA 1A3RL 2X38A 3BZDA 1FZJB 2Q9OA 2JJWA 1L7TH 3LS4H 3T65A 2OA9A 4DO4A 5EORL 4OGYH 1XGRA 2ZJSH 3U7WH 3ARFC 3MACL 3CSGA 5F1IB 2DZEA 5D7KE 4XR8C 5HJGA 1JK8B 1YUHB 2GK0A 5D1QB 5C0AB 1GS6X 3VSTA 3PWJA 1ND0B 4H2CA 2VLKA 2GAZA 1NBZB 4FS0A 3V0FA 1JHTB 1UUSA 3HMXA 1AGCB 4ZTOH 2K70A 5C6WH 5DQJA 3AREB 3TCTA 1WSST 2PWDA 3MZGB 4WFFE 5KVGH 1UACL 1BZDA 3ARDD 2R4SH 5I24A 2FO1A 2ESVA 4KZEH 3MLYL 4RLDA 5BRZD 2IH1B 3TEXA 2WZPD 4PJDF 4EVNA 1PZAA 3TPUB 1E28B 2NXZC 4M6OL 5ICYB 5KEZA 4N26A 1MJ8L 4KRNA 2APBA 4AEEA 1ZV5A 4RGMC 2GCYB 3UDWA 2F54B 4RAUA 3CPLB 4V1DA 5HHOA 2IGFL 4LFHG 4FEIA 3SDCB 3BAEL 4KKBC 4AIEA 4WAFA 5KSVA 4F5CA 4XMXA 1NEUA 1ICTA 4P3DB 5EIIA 4B9FA 1CVRA 4JHWH 2A73B 3ARGD 4BWUA 1O9ZA 3X1FA 2GPZA 2VR5A 3B8YA 3S48A 3V4PA 3F05A 4GQZA 4L8DA 4XX1G 3ZE2B 4NPKA 3NBNA 4PJ9D 1Z5HA 2FIRT 1P7KA 2HRHA 2GABA 4X98B 1SFHA 4PJHF 3DX2A 3CFJA 2YPLB 3ROOA 1AGDB 5JPMA 4N0UA 2WTOA 3L3OA 2FRGP 4LVNB 4GG6A 5FO9B 1CE6B 3T3ME 3SZ6A 3VWJC 3WTVA 1JUFA 2SEBA 3ULVD 3U48A 4NM8H 2PYEA 3VFUB 2JI1A 2EDEA 2RTTA 5IB2B 1RY7B 4PJ7B 3QRLA 1TZ8A 4R0LC 4LSRH 2EVFA 2BRQA 2YPKA 2BZDA 5DJYA 1RK0A 2FQEA 3ZGHA 1E3FA 3I84A 4QRRA 4QJ5B 2YAHA 5FWRA 3I75A 4W81A 1NOLA 4F7CA 2CHNA 4CKVX 4DK3A 2IV8A 3FTUA 5CEZE 1PVHA 2VRAA 4JHAH 4O58L 2NLJB 1Y6MR 3UBXB 1I8MA 4GQPH 1FN4A 3L54A 5DMKB 4I8DA 4M03A 4Z76B 1JWSB 1YN7B 4M6ML 1OOWA 1QATA 1SF3A 1N68A 4OF6A 1TDQA 2FCBA 4TNWF 4ALAL 3BEWA 3FB7B 3QCUH 2X6CA 3EJYD 2TSAA 2IBZY 5CCKL 4MVBD 3LRSB 3TYFB 2ZWLT 3PAVA 2Y22A 4PY8J 4Z7VE 2C3XA 4NKQB 4XCNB 1A6WL 5TH2A 3OPZH 1ZLUK 1R47A 4EI5C 4F2MB 3LKRB 1U4FA 4YDVB 4FLQA 5FOJA 5FYLL 2B59A 3PGCA 3JVGC 5B8CB 3RU8L 3WFZA 1ZHLA 1OQXA 1OPGH 5IOPA 3GMOA 3MJ6A 1JPFA 4AG4H 1AVAA 4WGKA 4PP2A 1KBGL 3CN2A 4QTHB 1NC2B 3F7RA 4WI8A 4PUBH 2J1XA 3OGCB 3VI4A 4YSQA 4HUWA 5I6KA 1LO4H 4OLYL 3SGDI 2H3NB 3VFMB 2DI9A 1WAAA 1G0XA 4XN1A 3L4YA 3NA9L 4ZPVB 5EN2B 3AXIA 4LLDB 2V2XB 3ZGIA 5EEVA 1S3KL 3QUKB 15C8H 2ICEA 4FQQA 2BCKA 3M88A 3QIBB 4L9LA 3VMNA 1OGTB 4H0GA 4CKQA 2XG4B 4PGDB 3P9LA 1PLCA 1BM3L 3VXNA 3TNMA 5DRZB 1N70A 2EH7H 2BNQA 3IDMB 4DGUA 1BEXA 2XC8A 3QZOA 4YSTA 5JOFA 5JHMA 2P24A 4LAJH 4E9WA 3K3QA 5DVNA 5GJSL 4PJCA 1Z32X 2GT9A 3K74B 1AKJD 1SOSA 3WLWC 3SE8H 1T0NA 1RJCA 5FYJL 5DD0L 3D39D 4HH8A 5J1SC 1R3LB 1XX9C 2I26N 4FG6D 3NABL 5DJDB 4HJSA 3FQWB 1N5AA 1R17A 1S7QA 1U8NB 1V5JA 2FJFA 1BZ8A 3PJNA 1M7UA 1R6VA 3P77B 4CSSA 1U3HD 1YQVL 2VJXA 2ZUXA 4HDIB 3HG1A 5GZOA 2P1YA 3NIDB 5D1XB 3PWVB 2HVJB 5FO8B 1YPZA 4WO4D 4JM2D 2BY1A 4KMLB 1KGCD 1GAFH 5D71L 3UG4A 3W11C 2EUXA 3QPQD 3D30A 3O2DH 5C0GA 3MN8A 5B39B 1GGTA 2EDRA 3BKJL 4BSWA 1RZKH 1JD9A 2XN9A 2BS9A 3G5XA 3IF1B 2HX8A 2GTZB 4U1JA 4ZO7A 4I0PD 3PGFH 1N18A 4J1UB 4OZHE 4XHJC 1HKLH 4F27A 3TA3A 4IKLA 3WO3B 1LE5A 1X44A 1AXTH 1B0WA 1HL4A 3B7TA 1RJYB 5H94A 1F4YL 4NQVB 4KTEH 1KBKA 4A2DA 3RY6C 2XIDA 3IJYA 3O2VH 1UM6L 3V6FB 1KCLA 4NQCE 2NTSP 1U3YA 3B56A 2G0LA 1DBBH 1YN6A 4X9HA 1MCSA 5CJ8A 2BOBA 1FE8H 3BZ4B 4MJIB 2BXYA 2R4RH 3UTSB 2VUOA 2ZXCA 4N2EA 1WCQA 5E8EA 3GZOA 1UD6A 1ZXQA 4Y16B 5FR3A 1SYSB 2OMYA 4D0BB 4YBQD 4XXCC 5DYFA 3QP3A 1ZT4B 4TVPH 4JRXA 4YMPA 5T5NF 3QUYD 5IQMA 1FJ1A 1H3XA 3V5HB 3DNKA 1GW0A 4GO8A 1AZZC 5JXAH 1GGUA 4BD4A 4CSPA 4YBLC 1W0WB 1J05A 4APXB 3V6OA 3FN0L 3GJEA 1EBPA 3ZTNL 3K71A 3SO3B 2B39A 4Y1AB 5J0BA 2NNCA 1YO4A 5D2LA 2AGJH 1EJFA 1IBHA 2KHAA 1YNTA 1MF2H 3U6XA 4W9ZA 4YBHA 3HG4A 3NEXA 2DWXA 5D1ZB 1J18A 4HUCA 2XVKA 3FQNB 3ME0A 5DHVH 1PQZB 3PG2A 2NY6C 4GW4B 4JFYB 1MLBA 4DP8X 2VT0A 4Y2LA 1JK8A 1P0SE 5C0AA 1QHQA 1FZOA 4XN9A 4DESA 4ZW3A 1IVTA 3H4HA 1NBZA 1OW0C 1JHTA 3IJSB 1AGCA 2WQWA 4ZMQA 3L7FB 4ODHH 3EGSA 3PABB 1CXKA 2DIJA 2XWTB 5BOZG 3MLSL 1M2VA 1L7IL 4WO0A 3NIGE 3P4OA 4PLNC 4JGMA 1ORSA 5EC1B 1E65A 3F00A 4WU5B 2CXGA 3TPUA 3U4EB 4JFHE 4NO0D 4XNMA 3DX9B 3DSNA 5ICYA 2JLPA 2YS4A 4U1LB 2GCYA 4BA8A 5E24E 1NCDL 3TCXA 3WIHH 2F54A 4QNPE 4S1QH 3NCYS 4WI4A 5IB4A 5FYLD 2CMRL 2OTWB 5LNDA 1IGIL 1FDLH 3FCGA 2IQ9H 2ZSWB 4Z3FA 2AK4B 4ZAKC 4EN2A 1MWAA 2NT1A 5I5JA 4P3DA 3V4UL 4ZFOB 2FEDC 2A73A 1CD1B 3BPOC 3CFUA 3L4WA 4HWBL 2NY2C 4JZJA 3OKOB 2ZYHA 1YZZA 4YWGH 3G5YB 5DFVD 4XVJH 1AJ7H 1LMKA 2LT9A 5GIRB 4MXWH 1V27A 2I32A 1AGDA 3QXTA 3MLUL 4X6BB 3LEXB 1MCQA 1RJZB 1RIHL 1U8OB 2DYPB 4PS4H 2OYKA 4EUPH 5I8CB 5J7CC 5JR1L 4MLSA 3VJ6B 1CE6A 2AQQA 2QSVA 1PD1A 3ARFD 3FFCA 3MGTB 4WFHD 4DF9A 5C7XL 1ASPA 1N59A 2CKBL 2YPVA 1NEPA 3O3DB 2XHNA 1O9WA 3VFUA 1YJDH 2FEEL 4PJ7A 3BAWA 1PLBA 4UU9B 3CDZB 4L1SA 3GXTA 4P2OA 3WY1A 1JGUL 5IBTH 3W0WB 4LOVA 1WICA 3I6SA 4PSPA 5CEYA 3MSPA 5TF0A 2X28A 5FYJD 4NXSA 2TRYA 1CBVL 2XXGA 4X5XB 3DO4A 4AVKA 2KERA 2W38A 3BVWA 1MQKH 2NLJA 3HI6H 4TUKH 3JV5A 3TWYA 4MJ4A 5IROC 3UBXA 1NIDA 3V4LA 1FNFA 3GKZA 1YN7A 4DETA 2XY1A 3E6HB 3NPSC 2LLLA 5DVLA 3GRWH 4UINH 3D87B 4KKBD 3VFTA 3IMWA 2RH0A 3RX7A 1V7ML 1NFAA 1N4XH 5I8OH 2DMGA 5TDOB 1IAIH 3GIZH 4LVHB 2XPGB 3LRSA 2V4LA 3MRJB 3TYFA 4E9YA 3RBGA 1MI5B 1YHPA 3CC1A 4XCNA <