3CE2A

Crystal structure of putative peptidase from chlamydophila abortus
Total Genus 244
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
244
sequence length
600
structure length
595
Chain Sequence
QVRPRSEISPQDCWDITPLYLNRKAWKADLDSFGLKSPTWPALQATQYQLDNSESLLSLLTTLFSIERKLNKLYVYAHLTHDQDITNQEGIADLKSITHLHTLFAEETSWVQPALTSLSESLIAQHLSAPCLAPYRFYLEKIFRLSIHTGTPGEEKILASAFTPLEVASKAFSSLSDSEIPFGQATDSEGNSHPLSHALASLYMQSTDRELRKTSYLAQCERYHSYRHTFANLLNGKIQAHVFYAKNKRYNSCLQAALYHNNIPTTVYTNLIDIVKKNSSLITKYFSIKQRCLNLKDFHFYDVYAPLSQEKKYTFQEAVDLIYTSLSPLGTEYIDTLKQGLTTQGWVDKYENLNKRSGAYSSGCYDSHPYVLLNYTGTLYDVSVIAHEGGHSMHSYFSRKHQPFHDAQYPIFLAEIASTLNEMLLMDSMLKESDSKEEKITILTRCLDTIFSTLFRQVLFASFEYDIHHAAEHGVPLTEEYLSSTYKNLQNEFYGEIITFDVLSNIEWARIPHFYYNFYVYQYATGIIAALCFLEKILNNEDNALNSYLNFLKSGGSDFPLEILKKSGLDMGTVEPIQKAFCFIEKKIQELSSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative peptidase
publication title Crystal structure of putative peptidase from Chlamydophila abortus.
rcsb
source organism Chlamydophila abortus
molecule tags Structural genomics, unknown function
total genus 244
structure length 595
sequence length 600
ec nomenclature
pdb deposition date 2008-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01432 Peptidase_M3 Peptidase family M3
A PF08439 Peptidase_M3_N Oligopeptidase F
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.830 Mainly Alpha Orthogonal Bundle Helix Hairpins putative peptidase helix hairpin domain like 3ce2A02
1.10.1370.20 Mainly Alpha Orthogonal Bundle Neurolysin; domain 3 Neurolysin; domain 3 3ce2A03
1.20.140.70 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Butyryl-CoA Dehydrogenase, subunit A; domain 3 3ce2A01
3CE2A 2QR4A
chains in the Genus database with same CATH superfamily
3D36C 1IZ3A 3GB7C 1SA0A 4DV0B 4JI2O 4BIOA 2XQRB 2F4VB 3TTBA 1IBMO 2N05A 1VQPV 1OZ0A 2DYSC 5D5PA 1VMGA 1WNSA 5L3GA 1ZSPA 4AQYB 3ZHRA 4KSFA 4L3XA 4RQFA 2ZIOA 1XG2B 3THOA 2E75B 2XAFA 2CTPA 1H2NA 1R1BA 1N36O 4O4IB 4J11A 4L87A 3HKCA 2GUZA 5EC2C 3DTUB 3AG1B 4D6TH 5B5EZ 3K57A 4UVCA 1OAHA 4DV2B 2RN9A 2R70A 1YHQV 1GKZA 4L38A 1NH2D 4FF2A 5IJ9A 2A79B 1VQ6V 3W7XA 1KUQA 4HNAA 2R9RB 4DR3O 2YS8A 1XFXA 2WLIB 4GZRB 5B3SB 4YHHO 3H1LH 2ZCEA 4IYHA 5IT9N 3VQYA 4LF7B 3OGCC 1R6TA 3N27A 2EULA 2JGDB 3ETDA 1AR5A 1M56B 2LFRA 3E83A 4B7EA 4F6RA 4ZHQA 1Y0VA 3MKHA 1D5AA 1N32B 1XBLA 2DQ0A 1GMGA 1XMQO 2HJDA 3MDSA 2Z0AA 1P7BA 1V54B 5LP6C 3HWCA 3OWAA 2P7TC 3J80N 4RQEA 1SK6A 4TV9A 1PKXA 4DXWA 2YXLA 3BA9A 1AVMA 3JCZA 4LFCB 5IYZB 1HNWO 3BY6A 1Y8PA 2FKXA 4JGSA 1V9PA 1MZEA 4FIPC 4DK0A 3K5OA 3KKYA 2ZQMA 4PA3A 3APQA 2XTAA 4UCSA 4FF1A 1R3LC 4LCUC 3LUTB 1JVMA 4J80A 1KKDA 4ZKIA 1BZKA 1YITV 4UCTA 1XL6A 2UU9O 2KSDA 3P30A 3AK1A 3QF7A 3SYAA 1TUBA 1RPRA 1SQGA 3SYQA 4LFAO 4ZBMA 3C3LA 4LNUA 2CJ8A 2HJFC 4WCEV 1X59A 1QNMA 1MZFA 4TUYB 2Q8IA 4M9AA 3CEIA 1JCHA 3JASB 2P4KA 1Y4MA 3UT5A 4OGQB 1XI1A 2QTSA 1AILA 2Y0PA 5D5QA 4QJFB 1YXBA 3HKBA 3RFRA 1RP3A 4FXYP 3JYCA 2JK5C 5FPOA 5CA0B 2QKCA 2ADPA 1WP7A 4QE7A 3CCJV 2UUCO 1YF2A 2PY5A 2H94A 4WBNB 4P2ZA 5BMVA 1SZXA 3EXAA 3L72H 5C93A 1B3QA 2BU7A 3VOUA 1S3JA 2YUAA 3DSQA 4IHJA 2WPDG 5EBMC 3NF4A 4JI7B 2AHZA 1VF6A 1FXHA 4JV5O 1XFZA 3RKHA 5B1BC 3OUSA 5EIBC 1JR9A 1GKXA 1YIJV 1Y8NA 1FJGB 1FXKC 3L1TA 4NTWA 4EEQA 3W7SA 3C3TA 3SR2C 3HB3B 1U96A 1H38A 2A1TA 1MOFA 5CBGA 3VKHA 4AI8A 4K8XA 4DV5B 1N34B 2Q67A 4R6ZA 4GKJO 4R8CA 1FS9A 4IYIA 5F2VO 4MP7A 2ZM6B 4RUFA 1R2JA 2HVJC 3S3WA 3AFEA 5FL7G 3LDEA 3LNMB 2FTKA 3F29A 3JALB 2NNUA 4ASUG 3FYIB 3ZMZA 3QNEA 4MP2A 1NS1A 4XDJA 5B1OA 3D36A 2EZPA 1IS2A 3PJSK 1L1FA 2BSKA 1Y76B 2Z1QA 1OCOC 2D29A 3LDCA 3E86A 4LQSB 5EIBD 3G71V 2Z3YA 2PF4E 2ZNJA 4CS2A 5CB4A 5JJNB 5LXTB 4N21A 1SIRA 3Q0AA 3WG7C 4DV6B 4V25A 3LG1A 3II9A 4KTOA 2B1IA 3N2GA 3OMAB 5JCOA 3CSXA 3GVMA 2XOKG 4B3SO 1AJPA 2EINC 5KMGB 3ZRWA 2DVLA 4FF4A 1P49A 1I1IP 4Q20A 1IVHA 1DGSA 4FFKA 2N04A 3EVKA 4O2BA 3TK1A 1GM9A 5KUKA 4MVOA 3MAQA 4NTXA 4YY3O 2CJ5A 5EK0A 4GT1A 4OPAA 4JTAB 3OD4A 3RN4A 2RDZA 1H8EG 2D2CB 3ZHSA 2PYLA 3OUFA 3TXSA 4DR7B 5BR8O 3PFDA 1BSMA 4L3ZA 1X90A 5IJ0A 1FYJA 2ZIMA 4JI1B 5JWPA 4ZOLB 4DV7B 5BXZA 3K5NA 2CJ4A 4FVMA 4DK1A 2WA4A 4KSAA 1FFXB 3D3QA 4P30A 3WFVA 4X64B 2L35A 3ABLB 2L6LA 3FD9A 4CC6A 3CMEV 1Z5WA 2X6AA 1NR1A 4X65B 1XFYA 4JI4B 1KMIZ 1J5EB 5JJEB 1ZL8A 4MPEA 1SQQH 1BQZA 1YI2V 1LR1A 3B4SA 2A06H 4DV0O 1X8ZA 1H8HG 2F4VO 4LF9O 2WAMA 4JEKA 1YJ9V 4Z1VA 1F4NA 2AGAA 3CCRV 2FB5A 4AQYO 4HKRA 3LSQA 4CH6A 2ZO5A 2ZE5A 4FJCC 5CA3A 3P4TA 1L0LH 1NTZH 3M7MX 1QR9A 4F6EA 5A9GA 3HKCB 1HNZB 2HP8A 1SESA 3JAKB 4FF3A 2MW2B 4FZ1A 4B7KA 1YJWV 1VQ7V 2ZXWC 2XT9A 1XMOB 3OW2U 2V7QG 1RM1B 1QDBA 2LJ2A 2OR0A 3C3SA 2WWWA 2ARHA 3K06A 2E76B 1UFIA 4U7NA 5JH7A 4CS3A 4CZZA 1V55C 1EZJA 2RFQA 3ABKB 3SJQC 1KQSU 5JJJB 4JAVA 2KG7A 1IBKB 4H13B 4DV1B 4DV4O 3CRQA 4I55A 2OCCC 1K33A 2IM9A 3CCUV 1NVPB 1FAFA 3Q24A 2BOBC 1HDJA 4GYCB 1NTKH 2OTLV 1I5YA 4NTYA 1WB7A 2R02A 2WLLB 4MVUA 3TETA 4QPKA 1N32O 1GTOA 3ZIAG 4PDLA 3EONA 3ZRSA 4DR1B 2EX3A 1CXZB 2JS3A 2YIAA 5B66Z 3BNGA 1R3IC 1JJOA 1O9HA 2LGQA 2WLNA 1AR1B 4TV9B 1A32A 4HBNA 4U3JA 4QNHB 4ICGA 1K3EA 4BIUA 1EGCA 2QM7A 4WFEA 3G6EV 4DUZO 2RCVA 3F7VC 2YICA 3OR7C 1KBHA 1Q6HA 1K9MW 4IIJB 1N33O 1VQ9V 3NR7A 3CP1A 4I4TB 1BE3H 5J2TB 3L73H 2X6BA 1H2KA 3UBRA 1G4YB 2VQEB 4Z2WA 1IXMA 4JI8B 3BNFA 1Y791 2V1DA 3OM3B 1BMFG 4FPPA 4E02A 1TUBB 3RYCA 3AG4C 4DV3B 4X62O 4U83A 4NYKA 4GUNA 2Q73A 4K35A 3SPJA 3H1KH 2EBHX 3D6BA 5TISZ 4JYYA 1K9XA 4FLWA 3T1YB 1WAZA 3E8BA 1YJNV 1Q7YW 2LO1A 1LVCA 1VIBA 2QM4A 4PJ0Z 1M57B 2ADQB 4LF8B 4UCRA 1N0JA 1NZ6A 4JI5B 2R05A 2EIKC 3QO5A 2ZE6A 2RF7A 1COWG 4KHPO 1RP3B 3SGIA 2YXYA 3ZHTA 1TA8A 1N0NA 4F4LA 3GWKC 4NVPA 3B2EE 3RYIA 4L8JA 5IYBO 2VIGA 3AG7A 2GTAA 3ABMC 3BPZA 1R6KA 4UCOA 4NB5A 4I0XA 3EOMA 5K3JA 4IHJB 3RYFA 1P7GA 1TVKA 4H44B 1GU6A 2JS5A 1ORQC 3D8CA 1X91A 1JPXA 4A5UB 2QWOB 4Z1MG 4JI7O 3OWMA 5JVDA 1H2MA 3C2PA 2WSSG 2YIBA 3UCSC 3LSSA 4J7KA 3AG2B 3K79A 5HFMA 1FKAO 2ETNA 1GO3F 1FJGO 3E35A 4DR4B 1AP5A 4KUMA 1VP7A 2QJ1A 1I94B 1AROP 4FLUA 3DGEA 3VQWA 4FM0A 4R50A 3SKSA 3J81N 1JA8A 1UDYA 3T1HO 5L3FA 4DV5O 1NH2B 2H1NA 1QR8A 3CC2V 1MABG 3CJHB 1QU7A 1RSOA 4DUYB 2ZM6O 3K03A 5LA6B 2X0LA 5K3IA 1Z2GA 4BWAA 4H85A 3QVNA 2XNDG 1KB9F 3FO3A 4O4LA 2DYRB 2P5OA 1MSDA 5KAFZ 1VQNV 2E0AA 3JARA 1RX0A 3K0DA 2ZT9B 3OT7A 2CAZC 4AHCA 2OTJV 2DYSB 3HOAA 2ITDC 2AZEA 2ZD9A 3ZBHA 2VF1A 3JAMN 4KA8A 2CE4A 2F95B 5KHKA 3MMOA 3FB7C 4RUEA 2M6YA 4Q6GA 5EYPA 1EGDA 2CDYA 3STLC 1IBLO 4DR6B 2UXCB 3TZ0A 2CTRA 4LF4O 3ASOC 3CRRA 2Q8FA 2Q7HA 5CB4B 3CCSV 1THZA 3ASNB 4NXLA 3K5LA 3EHBB 2HHHB 1SC5B 2Y0IA 1Y67A 2A9HA 3CCMV 4DV6O 1Q81W 2A0LA 3N2GB 1ZWIC 5J2UB 3L70H 1WLEA 3CX5F 5CA1B 2GBBA 3B8MA 4TSFG 1WJZA 2MK3A 4DRXA 2OIGA 3CCEV 1EGEA 1MMMA 4FLZA 3UQ8A 1AI5A 5LYJA 4ZI7B 5JCOC 1B04A 3I56V 5HFLA 4B3RO 3X2QC 1HR0B 1N4CA 4XDLA 1H2SB 4GX0A 4FLXA 2H3OA 1EM1A 4KCFA 4CBCA 4MVSA 1K93A 3LSUA 5JQGA 3JD0A 4DR7O 2XS1A 1QLEB 4MVZA 4NR1A 4YJ3B 4UXNA 2ZKOA 1CEZA 5LP6B 4JTDB 2UUAB 3TZ4A 2O57A 4PA6A 1JQ0A 4PA4A 1S26A 4X9QA 2WLHA 3CE2A 4OPHA 4ZIBA 3CS5A 2UXDO 3AG1C 4X64O 2JVDA 1QQCA 1SZTA 4Q1OA 3APOA 2IJKA 3FX7A 2QE7G 3ZHQA 1FXVA 4CH5A 4DYLA 2PYJA 3H1IH 1O9GA 2E5LO 1RJ1A 5K3HA 1R3KC 1J5EO 4X20A 4JI3O 3UO2A 3N2KA 1H2LA 4YJ2A 3OEEG 2EIJC 4LFBB 1HNXB 4BW5A 2FP2A 1PL0A 2ZDXA 1EN6A 4B3MB 3MPIA 2ILMA 3CCQV 4E00A 3L71H 2PTMA 4IL6Z 4B3TO 2HLDG 5EBLC 2EBAA 1M56C 2YC0A 1KP3A 3STZC 2AW9A 2E3CA 4TV8B 4AILC 4LWSB 1V54C 3VQXA 1ENVA 3BCCH 1VQLV 4JYAB 2XAGA 2YGWA 1K5SA 4LF6B 3AHMA 3R7KA 1PV0A 1SQBH 1XMOO 5KHJA 1DTOA 4KS9A 3IGAC 3T4DA 5JH7B 1QBZA 1NT2B 4I7ZB 2XAJA 5K3GA 1OCCC 1XREA 3H1HH 1IBKO 1BUCA 4I55B 2C2AA 2OIEA 5B1BB 2YEVA 2PZSA 1MA1A 5L3CA 3RYHA 5LMUB 1M4UA 1FXKB 2LFSA 3CMAV 5C8YA 3JCUZ 3Q23A 4I50A 3FKSG 3UM7A 2IU3A 5LOVA 1VF7A 1MSWD 2IH1C 1SQPH 4OX9O 4W4LA 4J9YB 2OYQA 2DW4A 1M93A 2WLJA 2EBOA 4UV9A 5A2QN 5CMUA 1VARA 1BQ0A 4RO2A 1IXBA 3X0XA 4X1KB 2QDOA 3K58A 2Q0OC 2IX6A 2JIFA 5B1AC 3ZN0A 5L3BA 4JASA 1AI7A 3L75H 5KLVH 4H33A 3DC6A 2DQ3A 4QPJA 2VQEO 1GM7A 5B5VA 4IT5A 5LMNB 5LHGA 1WN7A 2OT4A 3RYCB 1X4TA 1GN4A 4CS4A 1KECA 1OCOB 4NKGB 2R03A 3F5TA 4GKKO 4EB6B 1LUVA 2P6JA 4G27B 4RWUA 3T2MA 3K04A 4L3YA 1BS3A 3JAWA 4R7CA 1SKVA 5KHGA 2YDEA 3WG7B 4J7JA 5IWAO 2HJNA 1JOYA 4Q5BA 3Q4HB 2EINB 4O4HA 1NJIW 1K8TA 1LUWA 1YCIA 3OR6C 3RYIB 3DC5A 3FAVA 1BHBA 4P9PA 2M7WA 1E79G 1NTMH 4MVMA 4BAYA 5E1AC 4I0XB 3RYFB 3WB1A 1TVKB 1XNRB 4AKGA 4PDRA 2KQXA 3ABUA 3TXQA 5IY5B 5EZYB 4X66B 1Y6XA 3AK3A 3B09A 1IBMB 1W0JG 2C12A 1PD3A 1JQIA 2DWDC 3KCXA 2QM8A 2WLKA 4ZXVA 3E22B 5LHIA 4O5MA 1G8MA 4OXSA 1GN6A 4PI2A 4UVAA 1XILA 5CBFA 4MT8A 1IURA 4DR4O 1GM8A 1NR7A 4LQQB 3HQ2A 4XDKA 4O4IA 3HR0A 4JYBA 4HYOA 1S4BP 4W4KA 2VQFO 2DWEC 1RPOA 1RSOB 2Q0AA 3D9DA 1W0KG 2FMLA 3CCLV 3FB6C 4O4JA 4I9QA 1Q43A 3HKDA 1I7FA 4N5FA 2Q8GA 4O4LB 4AKIA 4DR3B 2YYGA 3JARB 4YHHB 5LGTA 2ZR3A 2N74A 4G28B 3N0RA 1I08A 3RT3C 1US6A 3G6BA 2PNRA 5H2FZ 1NBMG 3J7AU 2YYJA 4QICA 4YIPA 4J9ZB 1K73W 4MTGA 1SA0B 3OMNB 2EJ7A 4PV1B 5IYCO 2BU8A 1PNMA 4X28C 1ZLZA 4DO2A 3BABA 3PN1A 4LR3A 3IAYA 3I5DA 3SYCA 3VQVA 2HHHO 2YYIA 2BU6A 1SF9A 2YIBD 1FFTB 3Q22A 3K59A 3KCYA 3OTFA 1GRJA 2ZXWB 3ZN1A 2Q8HA 2Z5UA 4DOYA 1HNWB 1PNLA 4BR6A 2Q68A 5IYZA 1EZVH 1P84F 3WU2Z 2GUZB 4DRXB 2Q9LA 1ZTEA 2IU0A 3QO8A 4RM7A 2QWQB 2ATKC 3H01A 3ZMTA 1NI8A 4TQDA 2YYLA 2UU9B 5B6BA 4TWKA 2OCCB 3OGIB 4DV2O 5IJ9B 3B77A 4DW0A 4HNAB 4DZYA 3ZCCA 1F23A 2AHYA 4KL1A 5JQGB 2H8PC 2VR0A 2BU5A 1Q5OA 2ZKJA 1TAEA 3ZRVA 3F7YC 3OTOB 1UKWA 4P13A 2FP1A 4Q17A 4LF7O 4U3FH 1FS7A 4F6RB 4ZHQB 3JASA 3R66A 1XHXA 2JGUA 3FFQA 2YXHA 1EFRG 5K1XA 3D9EA 1NQTA 2P22C 3EFFK 1RFYA 1RM1C 1XFWA 5CA0A 2UUCB 2GTSA 1S76D 1F4MA 2Y4TA 1IVSA 2Y69C 2UUBB 2Q69A 4LFCO 3N2KB 4KXRA 1TUEB 3AG4B 2P67A 1U97A 2A7WA 2DDHA 4MPNA 3AG3C 4TQFA 3HPLC 1DF4A 2F43G 4JV5B 4H7QA 5LGNA 4F0XA 2CK3G 4FLTA 3CC7V 4LF5B 2DN9A 2EILC 1GK9A 2NR5A 4JIZA 1UPGA 2LQTA 1XNQB 5GONA 4GX5A 4J41A 3GQTA 2PGGA 2Q4PA 2WLMA 3CXCU 4XVXA 3LGQA 5E3XA 2X6CA 1PL4A 2PUSA 2GHYA 3TCUA 1L8DA 3SF6A 4LBEC 1CPYA 2EC5A 4LNUB 5H5NA 3AHNA 3SCEA 2ZDIA 3W7TA 4O2AA 2EIKB 4K0KB 2R9AA 3LDDA 2IBZH 1OCZC 1OCRC 2BTZA 4ABMA 5ITZA 1T5EA 2WA3A 1JX9A 3SDLA 4GKJB 3ZMUA 2PO4A 3OMIB 1QCEA 3FB5C 2QTOA 3ABMB 3UT5B 4UB6Z 1QVFU 3OAAG 2BOCC 4BW9A 3HKBB 4CC5A 4PDVA 2BTQA 3SJCC 3P32A 2VWJA 3BEHA 1D2DA 4FFBA 2UXBB 2YEVB 3TJTA 1YZBA 2AZ0A 5BMVB 4MSWC 2YSUB 2EIMC 3T4ZA 2NN4A 5LMUO 1AB3A 2E80A 2JDIG 3IC9A 3AFFA 1RJ4A 2HKOA 3CRMA 3DXRA 2JBRA 2GV9A 1F7YA 4L1FA 3BHPA 3FYEB 5GW7A 5KHIA 3A0BZ 2F1MA 5KUMA 5CBHA 1Q90D 2RJZA 1YVWA 1Q82W 4OO2A 3GM6A 1Q6UA 3ZHVA 4B3SB 4TOIA 4UVBA 3ZRXA 1BT8A 4W9UA 2QR4A 1Q6IA 3WB2A 2W6JG 2BU2A 1MG1A 1NKDA 3BFRA 2JIZG 1XOUA 4JI6B 1CP9A 4PELA 1N34O 2KB1A 2O36A 2Q7EA 1M5IA 2JBSA 2Q6AA 2PI4A 3A0HZ 3K08A 4YY3B 2C0UA 1VF5B 3A0RA 1WB8A 2HFEC 2W0FC 1QLNA 3VKGA 5E79Z 1EBOA 1MNGA 3ASOB 5BR8B 5B5WA 2BSKB 3MDEA 3S7WA 2AO2A 2DOSA 4QGPA 3JAWB 4X28A 4AI6A 4J1VA 4ZOLA 1OJHA 2PI5A 4O4HB 2VWKA 4K3AA 2ZDYA 4TT3G 4PHZA 3FAVB 4D7TA 3U10A 4EKWA 1XDCA 1SQXH 3M9VA 2F23A 1ZAUA 3GWOA 1WS9A 4DR5B 5LL6Y 1L0NH 3B96A 2VRZA 3X2QB 1S5HC 1XNRO 2UXWA 1GN3A 4FZ4A 3ZRWB 2YYMA 3D1IA 1K8AW 1KKCA 4X66O 3A2FA 3BNJA 3JD3A 4I9WA 5CN0A 4LF9B 2FONA 3QO7A 3I55V 4J7ZA 1K7DA 5B1NA 3ZHUA 3C90A 4O2BB 1FS8A 3JD2A 1K92A 3JATA 4PD4F 5KX5A 4X1YA 2QSAA 2H1JA 2XUMA 2ZE8A 5J9PC 3K0GA 1AR4A 4UUJC 3RVYA 3O65A 5M4PA 1S77D 3HKEA 3D9GA 2CH7A 2FL4A 4JTCB 2QGNA 2QWNB 4JZGA 2D3OW 3ASNC 4V26A 3JAKA 4AKHA 2BCCH 1M9NA 5IJ0B 4G97A 3JSNA 2RMKB 3D2RA 4O4JB 5K1PA 3HKDB 4JI1O 1YDXA 3M99B 3RVZA 2CTQA 4DV7O 1XQ8A 1BCCH 2BE3A 1KU9A 1WA8A 4MTOA 2UXXA 4WJYA 1W59A 4G5EA 4JAUA 2EIJB 4WFBV 1IX9A 4QIWF 2P06A 4DV4B 1AJNA 4EFBA 1JFFA 3CHXA 2IH3C 3L9DA 3CRLA 3AHOA 1QHTA 5BRMA 4X65O 4JI4O 1ZL8B 3GNCA 3G4SV 1S5LZ 5KHHA 2WLLA 2NLJC 5B3SC 1OHHG 4KFMA 4MVQA 1QLEC 2V4DA 3FB8C 3X29A 4UV8A 4D7SA 2JRIA 4LC1A 2OT5A 3JSLA 1Y74A 3CPWU 1KA2A 1VQMV 3RGBA 4DUZB 1GAXA 4CH4A 3CB2A 3JD1A 4WFFA 1N33B 1Q8IA 1K5QA 4IIJA 5KA6A 4MW8A 1HNZO 4I4TA 2HG5C 2IJJA 3IC7A 5J2TA 4J10A 3OFNG 2WBIA 1SRYA 1OCCB 2HR3A 2B5UA 3KMLA 2ZNIA 1ROPA 1PP9H 1B6QA 5IE9A 2Q5ZA 1KA4A 1SS3A 5AG2A 1VEWA 2OJQA 4X62B 4DR2B 5LHHA 4ZYJA 2KG7B 4YXWG 3SPHA 4P9OA 3OTOO 3SJBC 4GLXA 4DV1O 1FS0G 5GTIZ 3A8TA 3ETQA 4CH3A 4JI0B 3H1JH 4FK5C 2R0MA 1FPOA 2F66C 4KHPB 1SQFA 4DR1O 2DJVA 4HKSA 4U3JB 2ZINA 4PDMA 3LNNA 1DK1A 5B1AB 4J42A 5KA5A 2UUBO 1P4RA 3G67A 3P3PA 1ZX3A 1I0HA 4EFEA 1EN4A 1TGOA 4JAAA 4PA9A 2IX5A 1LNQA 3IJ4A 4QE9A 4E01A 1AP6A 4JI8O 4PUTA 1HP8A 1E1RG 4X88A 5KAIZ 4LF5O 4IRNA 5GONB 1SIQA 4WFAV 5FNVA 1XNQO 2CTWA 3TZ2A 2LW7A 2RDCA 2ZAFA 3OEHG 4P79A 3G80A 4DV3O 1Z5VA 5H6RA 1R3JC 2BTOA 4O2AB 2O3EA 4X89A 1BHAA 3DWCA 1FD9A 2EJRA 4K0KO 5ITZB 3ZMVA 1M1KW 3B40A 4X1IA 3T1YO 3T1HB 2K1EA 2VS0A 1E1QG 1DLBA 3BNHA 3VADA 4G2KA 1GN2A 2ITCC 3QG5A 3K5MA 3U11A 4WF9V 3CJHA 3OE7G 4LF8O 1Y8OA 5LA6A 2ZDIC 3BRCA 4UFZA 3CRAA 4JI5O 2RQ6A 5LGUA 2CGOA 4MPCA 2BTQB 1GKFA 4HAMA 4NXNB 4FFBB 5DN6G 2UXBO 1VQ8V 5FLXN 4NXMB 1XFVA 3ICXA 1K90A 3ZEDA 3FCJA 5EC1C 4GX1A 1BL8A 5M4KA 1D5NA 4Q5CA 1IBLB 4FM1A 4LF4B 3DXRB 3CRKA 5DM6V 5FPRA 4JI2B 4LP8A 5JVDB 3E8HA 1JMKC 2IJIA 3MHHC 1G6UA 1PK0A 1K4CC 1KP2A 3SYPA 3H9VA 1SC5A 2LW1A 4KA7A 2CJ6A 5H9CA 2X7RB 3QTCA 5BY1A 4WFHA 1AJQA 1UJWB 2E81A 2UXNA 5J2UA 1KYOF 1NU1H 1N36B 1I94O 3JD4A 1PNKA 1SERA 5CA1A 1KC8W 4FLYA 4MTFA 4JI6O 3ZJZA 5GTHZ 4MVRA 4MS2A 4ZI7A 4B3RB 1XFUA 4DUYO 2CX9A 4BIZA 1BGYH 1S0VA 5IY5C 3SWOA 3F5WC 5IYDO 3SYOA 2JEXA 1KD1W 5M4MA 3MHSC 1HWYA 2WLIA 1EN5A 1AI4A 1YEWA 5BZBA 4YJ3A 3L74H 1SQVH 5L44A 4UCVA 1AI6A 1PI1A 5LP6A 2QEXV 5EYPB 4IGGA 3MD0A 2JGDA 3RW0A 4Q0TA 4DR6O 4H81A 2UXCO 1XMQB 1N8RW 3UO3A 2UXDB 5L3EA 3ZS8C 1S72V 2FYUH 3TZ5A 4HR3A 5LBQA 2YI8A 3TORA 3K9SA 3W7WA 3E8FA 1K4DC 2REHA 2QWRB 2W0XA 2E5LB 2YIDA 4DR5O 1XUQA 4FMTA 4FLVA 4JI3B 2YI9A 4E4EA 4X8AA 3MDDA 4UB8Z 2QKSA 3W7UA 2XHBA 2JEUA 3ABLC 1V55B 1VQ5V 1Q86W 2JJ1G 5LYJB 3JATB 5KX5B 4B3TB 4X1YB 5DECA 1R73A 2K9PA 3O9OA 1HR0O 2Q8VA 3HKEB 4H37A 2CH7B 5EBWC 3SPCA 4LFAB 2B9ZA 3ZMSA 3NXSA 4JIOA 4TV8A 4LWSA 4YIOA 1W2BU 3E89A 5L43A 5M4NA 1Y66A 2P4VA 4UCUA 3ABTA 4TUYA 2R72A 1I5XA 3K9AA 1PM9A 2UUAO 1VQOV 2XS8A 3U0ZA 1WA8B 1XL4A 2CUGA 2Y69B 4HZ3A 2IJHA 2QWPB 2R9IA 2XAHA 1JJ2U 2Q7GA 2JJ2G 2HEPA 1JFFB 3AG3B 5L3DA 2F93B 2DMXA 2CJ7A 5IDJA 2ZR2A 3M8AA 2EILB 3B8NA 2G38A 4X20B 4I5SA 3R65A 4GX2A 4WBNA 4KP4A 2J7AA 3ABKC 4YJ2B 1WP8A 1FXKA 3CYOA 4E2LA 2P90A 2OCHA 4LFBO 1HNXO 2HVKC 2DE0X 4B08A 1YTFB 4OX9B 3BA8A 1Y74B 4JF3A 4B3MO 2ZE7A 1OCZB 1OCRB 4Q4UA 2CGNA 3AK2A 1XHZA 4MW3A 3MPJA 1K97A 1ZUQA 5GJVE 1IDSA 3ETEA 4RAIA 3SJAC 2ODMA 3CRCA 2AZ2A 3VBBA 1W07A 1VQKV 1URFA 3ML0A 4X1KA 4LH6A 5DEDA 4JYAO 4IV6A 2GBOA 3AEIA 1G1XB 4LF6O 5H6QA 1DF5A 4LH7A 1WPXA 4JYCA 3RBZA 4H0LB 3X0YA 4DR2O 2EIMB 4GKKB 2E74B 3WB0A 2PG0A 3JALA 4FM2A 1WPBA 3CD6V 4EB6A 5GJWE 2LGWA 3ZX6A 3UU9A 1JM6A 4WFGA 1SETA 1Y76A 3RYHB 3IFXA 1B06A 3SPGA 1VQ4V 3OIBA 1HW7A 1NVPD 3E8GA 5C8YB 5IWAB 4JI0O 2Y48A 4I50B 1J95A 5J71A 2XAQA 5LOVB 2B1GA 2OWOA 3Q4HA 3BVOA 3T1CA 4N23A 4U7OA 4C7UA 2AXTZ 1YTFD 1M57C 3D9FA 5LXTA 4PI0A 2Y4UA 1GJVA 2GSMB 4XBFA 4GCZA 3SXQA 3P3NA 2GDSA 3ETGA 3E2EA 1OV9A 5KMGA 5EZYA 1PPJH 4PA7A 1R3BA 1QVGU 3TGUH 2KKWA 2LFWA 4FZ0A 1GH6A 2EBFX 5LMNO 4MTXA 5FNVB 2F6LA 3E22A 2JBTA 5BRKA 1Q3EA 2W6IG 2OEXA 3C46A 1F51A 1VF6C 2QA4V 2IW5A 4X1IB 2EZOA 3MXLA 3AG2C 2QKAA 4DW1A 2VQFB 1R6NA 4JPRA 3SPIA 3UKMA 3BAAA 3CXHF 5J6AA 2A3QA 3KZIZ 2YYKA 3RWRD 1YSCA 1U8VA 1S5JA 2R0NA 1FFXA 3CWBH 1T9GA 1XEQA 1H2GA 3CC4V 2RNBA 3D3IA 4NXNO 1M90W 4JZ2A 2XASA 2OEVA 4K8ZA 4NXMO 1K34A 2LP7A 3KG2A 3K3WA 3CCVV 3S3XA 2DYRC
chains in the Genus database with same CATH topology
5GJWE 1XFYA 1PK0A 4AKHA 4G97A 1SC5A 1Y791 4KA7A 1XFWA 4AKIA 5L43A 4HKSA 2QR4A 3C3LA 4KSFA 3HOAA 2AZEA 2FP2A 2VF1A 4KA8A 2EBHX 1K9XA 4HKRA 3N0RA 4QICA 1LVCA 1XFUA 4F0XA 3AHOA 3Q0AA 3VKGA 4FF3A 1RP3A 4PUTA 5E3XA 4FF2A 2AO2A 4AI6A 4FF4A 2EC5A 3X29A 2LFWA 3AHNA 2YGWA 3Q22A 2EBFX 1XFXA 3AHMA 4P79A 2F6LA 5L44A 1KA2A 2GBBA 1K8TA 4KS9A 3DWCA 2PO4A 3C46A 1XFZA 1Y0VA 3Q24A 4AKGA 5GJVE 3C2PA 1K93A 4FZ4A 3KMLA 1SK6A 3VKHA 1KA4A 3Q23A 1XFVA 4KSAA 1K90A 2H1JA 2FP1A 3SKSA 3HQ2A 1S26A 3CE2A 4FF1A 2H1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CE2 A;  2QR4 A; 
#chains in the Genus database with same CATH topology
 3D36 C;  1IZ3 A;  3GB7 C;  1SA0 A;  4DV0 B;  4JI2 O;  4BIO A;  2XQR B;  2F4V B;  3TTB A;  1IBM O;  2N05 A;  1VQP V;  1OZ0 A;  2DYS C;  5D5P A;  1VMG A;  1WNS A;  5L3G A;  1ZSP A;  4AQY B;  3ZHR A;  4KSF A;  4L3X A;  4RQF A;  2ZIO A;  1XG2 B;  3THO A;  2E75 B;  2XAF A;  2CTP A;  1H2N A;  1R1B A;  1N36 O;  4O4I B;  4J11 A;  4L87 A;  3HKC A;  2GUZ A;  5EC2 C;  3DTU B;  3AG1 B;  4D6T H;  5B5E Z;  3K57 A;  4UVC A;  1OAH A;  4DV2 B;  2RN9 A;  2R70 A;  1YHQ V;  1GKZ A;  4L38 A;  1NH2 D;  4FF2 A;  5IJ9 A;  2A79 B;  1VQ6 V;  3W7X A;  1KUQ A;  4HNA A;  2R9R B;  4DR3 O;  2YS8 A;  1XFX A;  2WLI B;  4GZR B;  5B3S B;  4YHH O;  3H1L H;  2ZCE A;  4IYH A;  5IT9 N;  3VQY A;  4LF7 B;  3OGC C;  1R6T A;  3N27 A;  2EUL A;  2JGD B;  3ETD A;  1AR5 A;  1M56 B;  2LFR A;  3E83 A;  4B7E A;  4F6R A;  4ZHQ A;  1Y0V A;  3MKH A;  1D5A A;  1N32 B;  1XBL A;  2DQ0 A;  1GMG A;  1XMQ O;  2HJD A;  3MDS A;  2Z0A A;  1P7B A;  1V54 B;  5LP6 C;  3HWC A;  3OWA A;  2P7T C;  3J80 N;  4RQE A;  1SK6 A;  4TV9 A;  1PKX A;  4DXW A;  2YXL A;  3BA9 A;  1AVM A;  3JCZ A;  4LFC B;  5IYZ B;  1HNW O;  3BY6 A;  1Y8P A;  2FKX A;  4JGS A;  1V9P A;  1MZE A;  4FIP C;  4DK0 A;  3K5O A;  3KKY A;  2ZQM A;  4PA3 A;  3APQ A;  2XTA A;  4UCS A;  4FF1 A;  1R3L C;  4LCU C;  3LUT B;  1JVM A;  4J80 A;  1KKD A;  4ZKI A;  1BZK A;  1YIT V;  4UCT A;  1XL6 A;  2UU9 O;  2KSD A;  3P30 A;  3AK1 A;  3QF7 A;  3SYA A;  1TUB A;  1RPR A;  1SQG A;  3SYQ A;  4LFA O;  4ZBM A;  3C3L A;  4LNU A;  2CJ8 A;  2HJF C;  4WCE V;  1X59 A;  1QNM A;  1MZF A;  4TUY B;  2Q8I A;  4M9A A;  3CEI A;  1JCH A;  3JAS B;  2P4K A;  1Y4M A;  3UT5 A;  4OGQ B;  1XI1 A;  2QTS A;  1AIL A;  2Y0P A;  5D5Q A;  4QJF B;  1YXB A;  3HKB A;  3RFR A;  1RP3 A;  4FXY P;  3JYC A;  2JK5 C;  5FPO A;  5CA0 B;  2QKC A;  2ADP A;  1WP7 A;  4QE7 A;  3CCJ V;  2UUC O;  1YF2 A;  2PY5 A;  2H94 A;  4WBN B;  4P2Z A;  5BMV A;  1SZX A;  3EXA A;  3L72 H;  5C93 A;  1B3Q A;  2BU7 A;  3VOU A;  1S3J A;  2YUA A;  3DSQ A;  4IHJ A;  2WPD G;  5EBM C;  3NF4 A;  4JI7 B;  2AHZ A;  1VF6 A;  1FXH A;  4JV5 O;  1XFZ A;  3RKH A;  5B1B C;  3OUS A;  5EIB C;  1JR9 A;  1GKX A;  1YIJ V;  1Y8N A;  1FJG B;  1FXK C;  3L1T A;  4NTW A;  4EEQ A;  3W7S A;  3C3T A;  3SR2 C;  3HB3 B;  1U96 A;  1H38 A;  2A1T A;  1MOF A;  5CBG A;  3VKH A;  4AI8 A;  4K8X A;  4DV5 B;  1N34 B;  2Q67 A;  4R6Z A;  4GKJ O;  4R8C A;  1FS9 A;  4IYI A;  5F2V O;  4MP7 A;  2ZM6 B;  4RUF A;  1R2J A;  2HVJ C;  3S3W A;  3AFE A;  5FL7 G;  3LDE A;  3LNM B;  2FTK A;  3F29 A;  3JAL B;  2NNU A;  4ASU G;  3FYI B;  3ZMZ A;  3QNE A;  4MP2 A;  1NS1 A;  4XDJ A;  5B1O A;  3D36 A;  2EZP A;  1IS2 A;  3PJS K;  1L1F A;  2BSK A;  1Y76 B;  2Z1Q A;  1OCO C;  2D29 A;  3LDC A;  3E86 A;  4LQS B;  5EIB D;  3G71 V;  2Z3Y A;  2PF4 E;  2ZNJ A;  4CS2 A;  5CB4 A;  5JJN B;  5LXT B;  4N21 A;  1SIR A;  3Q0A A;  3WG7 C;  4DV6 B;  4V25 A;  3LG1 A;  3II9 A;  4KTO A;  2B1I A;  3N2G A;  3OMA B;  5JCO A;  3CSX A;  3GVM A;  2XOK G;  4B3S O;  1AJP A;  2EIN C;  5KMG B;  3ZRW A;  2DVL A;  4FF4 A;  1P49 A;  1I1I P;  4Q20 A;  1IVH A;  1DGS A;  4FFK A;  2N04 A;  3EVK A;  4O2B A;  3TK1 A;  1GM9 A;  5KUK A;  4MVO A;  3MAQ A;  4NTX A;  4YY3 O;  2CJ5 A;  5EK0 A;  4GT1 A;  4OPA A;  4JTA B;  3OD4 A;  3RN4 A;  2RDZ A;  1H8E G;  2D2C B;  3ZHS A;  2PYL A;  3OUF A;  3TXS A;  4DR7 B;  5BR8 O;  3PFD A;  1BSM A;  4L3Z A;  1X90 A;  5IJ0 A;  1FYJ A;  2ZIM A;  4JI1 B;  5JWP A;  4ZOL B;  4DV7 B;  5BXZ A;  3K5N A;  2CJ4 A;  4FVM A;  4DK1 A;  2WA4 A;  4KSA A;  1FFX B;  3D3Q A;  4P30 A;  3WFV A;  4X64 B;  2L35 A;  3ABL B;  2L6L A;  3FD9 A;  4CC6 A;  3CME V;  1Z5W A;  2X6A A;  1NR1 A;  4X65 B;  1XFY A;  4JI4 B;  1KMI Z;  1J5E B;  5JJE B;  1ZL8 A;  4MPE A;  1SQQ H;  1BQZ A;  1YI2 V;  1LR1 A;  3B4S A;  2A06 H;  4DV0 O;  1X8Z A;  1H8H G;  2F4V O;  4LF9 O;  2WAM A;  4JEK A;  1YJ9 V;  4Z1V A;  1F4N A;  2AGA A;  3CCR V;  2FB5 A;  4AQY O;  4HKR A;  3LSQ A;  4CH6 A;  2ZO5 A;  2ZE5 A;  4FJC C;  5CA3 A;  3P4T A;  1L0L H;  1NTZ H;  3M7M X;  1QR9 A;  4F6E A;  5A9G A;  3HKC B;  1HNZ B;  2HP8 A;  1SES A;  3JAK B;  4FF3 A;  2MW2 B;  4FZ1 A;  4B7K A;  1YJW V;  1VQ7 V;  2ZXW C;  2XT9 A;  1XMO B;  3OW2 U;  2V7Q G;  1RM1 B;  1QDB A;  2LJ2 A;  2OR0 A;  3C3S A;  2WWW A;  2ARH A;  3K06 A;  2E76 B;  1UFI A;  4U7N A;  5JH7 A;  4CS3 A;  4CZZ A;  1V55 C;  1EZJ A;  2RFQ A;  3ABK B;  3SJQ C;  1KQS U;  5JJJ B;  4JAV A;  2KG7 A;  1IBK B;  4H13 B;  4DV1 B;  4DV4 O;  3CRQ A;  4I55 A;  2OCC C;  1K33 A;  2IM9 A;  3CCU V;  1NVP B;  1FAF A;  3Q24 A;  2BOB C;  1HDJ A;  4GYC B;  1NTK H;  2OTL V;  1I5Y A;  4NTY A;  1WB7 A;  2R02 A;  2WLL B;  4MVU A;  3TET A;  4QPK A;  1N32 O;  1GTO A;  3ZIA G;  4PDL A;  3EON A;  3ZRS A;  4DR1 B;  2EX3 A;  1CXZ B;  2JS3 A;  2YIA A;  5B66 Z;  3BNG A;  1R3I C;  1JJO A;  1O9H A;  2LGQ A;  2WLN A;  1AR1 B;  4TV9 B;  1A32 A;  4HBN A;  4U3J A;  4QNH B;  4ICG A;  1K3E A;  4BIU A;  1EGC A;  2QM7 A;  4WFE A;  3G6E V;  4DUZ O;  2RCV A;  3F7V C;  2YIC A;  3OR7 C;  1KBH A;  1Q6H A;  1K9M W;  4IIJ B;  1N33 O;  1VQ9 V;  3NR7 A;  3CP1 A;  4I4T B;  1BE3 H;  5J2T B;  3L73 H;  2X6B A;  1H2K A;  3UBR A;  1G4Y B;  2VQE B;  4Z2W A;  1IXM A;  4JI8 B;  3BNF A;  1Y79 1;  2V1D A;  3OM3 B;  1BMF G;  4FPP A;  4E02 A;  1TUB B;  3RYC A;  3AG4 C;  4DV3 B;  4X62 O;  4U83 A;  4NYK A;  4GUN A;  2Q73 A;  4K35 A;  3SPJ A;  3H1K H;  2EBH X;  3D6B A;  5TIS Z;  4JYY A;  1K9X A;  4FLW A;  3T1Y B;  1WAZ A;  3E8B A;  1YJN V;  1Q7Y W;  2LO1 A;  1LVC A;  1VIB A;  2QM4 A;  4PJ0 Z;  1M57 B;  2ADQ B;  4LF8 B;  4UCR A;  1N0J A;  1NZ6 A;  4JI5 B;  2R05 A;  2EIK C;  3QO5 A;  2ZE6 A;  2RF7 A;  1COW G;  4KHP O;  1RP3 B;  3SGI A;  2YXY A;  3ZHT A;  1TA8 A;  1N0N A;  4F4L A;  3GWK C;  4NVP A;  3B2E E;  3RYI A;  4L8J A;  5IYB O;  2VIG A;  3AG7 A;  2GTA A;  3ABM C;  3BPZ A;  1R6K A;  4UCO A;  4NB5 A;  4I0X A;  3EOM A;  5K3J A;  4IHJ B;  3RYF A;  1P7G A;  1TVK A;  4H44 B;  1GU6 A;  2JS5 A;  1ORQ C;  3D8C A;  1X91 A;  1JPX A;  4A5U B;  2QWO B;  4Z1M G;  4JI7 O;  3OWM A;  5JVD A;  1H2M A;  3C2P A;  2WSS G;  2YIB A;  3UCS C;  3LSS A;  4J7K A;  3AG2 B;  3K79 A;  5HFM A;  1FKA O;  2ETN A;  1GO3 F;  1FJG O;  3E35 A;  4DR4 B;  1AP5 A;  4KUM A;  1VP7 A;  2QJ1 A;  1I94 B;  1ARO P;  4FLU A;  3DGE A;  3VQW A;  4FM0 A;  4R50 A;  3SKS A;  3J81 N;  1JA8 A;  1UDY A;  3T1H O;  5L3F A;  4DV5 O;  1NH2 B;  2H1N A;  1QR8 A;  3CC2 V;  1MAB G;  3CJH B;  1QU7 A;  1RSO A;  4DUY B;  2ZM6 O;  3K03 A;  5LA6 B;  2X0L A;  5K3I A;  1Z2G A;  4BWA A;  4H85 A;  3QVN A;  2XND G;  1KB9 F;  3FO3 A;  4O4L A;  2DYR B;  2P5O A;  1MSD A;  5KAF Z;  1VQN V;  2E0A A;  3JAR A;  1RX0 A;  3K0D A;  2ZT9 B;  3OT7 A;  2CAZ C;  4AHC A;  2OTJ V;  2DYS B;  3HOA A;  2ITD C;  2AZE A;  2ZD9 A;  3ZBH A;  2VF1 A;  3JAM N;  4KA8 A;  2CE4 A;  2F95 B;  5KHK A;  3MMO A;  3FB7 C;  4RUE A;  2M6Y A;  4Q6G A;  5EYP A;  1EGD A;  2CDY A;  3STL C;  1IBL O;  4DR6 B;  2UXC B;  3TZ0 A;  2CTR A;  4LF4 O;  3ASO C;  3CRR A;  2Q8F A;  2Q7H A;  5CB4 B;  3CCS V;  1THZ A;  3ASN B;  4NXL A;  3K5L A;  3EHB B;  2HHH B;  1SC5 B;  2Y0I A;  1Y67 A;  2A9H A;  3CCM V;  4DV6 O;  1Q81 W;  2A0L A;  3N2G B;  1ZWI C;  5J2U B;  3L70 H;  1WLE A;  3CX5 F;  5CA1 B;  2GBB A;  3B8M A;  4TSF G;  1WJZ A;  2MK3 A;  4DRX A;  2OIG A;  3CCE V;  1EGE A;  1MMM A;  4FLZ A;  3UQ8 A;  1AI5 A;  5LYJ A;  4ZI7 B;  5JCO C;  1B04 A;  3I56 V;  5HFL A;  4B3R O;  3X2Q C;  1HR0 B;  1N4C A;  4XDL A;  1H2S B;  4GX0 A;  4FLX A;  2H3O A;  1EM1 A;  4KCF A;  4CBC A;  4MVS A;  1K93 A;  3LSU A;  5JQG A;  3JD0 A;  4DR7 O;  2XS1 A;  1QLE B;  4MVZ A;  4NR1 A;  4YJ3 B;  4UXN A;  2ZKO A;  1CEZ A;  5LP6 B;  4JTD B;  2UUA B;  3TZ4 A;  2O57 A;  4PA6 A;  1JQ0 A;  4PA4 A;  1S26 A;  4X9Q A;  2WLH A;  3CE2 A;  4OPH A;  4ZIB A;  3CS5 A;  2UXD O;  3AG1 C;  4X64 O;  2JVD A;  1QQC A;  1SZT A;  4Q1O A;  3APO A;  2IJK A;  3FX7 A;  2QE7 G;  3ZHQ A;  1FXV A;  4CH5 A;  4DYL A;  2PYJ A;  3H1I H;  1O9G A;  2E5L O;  1RJ1 A;  5K3H A;  1R3K C;  1J5E O;  4X20 A;  4JI3 O;  3UO2 A;  3N2K A;  1H2L A;  4YJ2 A;  3OEE G;  2EIJ C;  4LFB B;  1HNX B;  4BW5 A;  2FP2 A;  1PL0 A;  2ZDX A;  1EN6 A;  4B3M B;  3MPI A;  2ILM A;  3CCQ V;  4E00 A;  3L71 H;  2PTM A;  4IL6 Z;  4B3T O;  2HLD G;  5EBL C;  2EBA A;  1M56 C;  2YC0 A;  1KP3 A;  3STZ C;  2AW9 A;  2E3C A;  4TV8 B;  4AIL C;  4LWS B;  1V54 C;  3VQX A;  1ENV A;  3BCC H;  1VQL V;  4JYA B;  2XAG A;  2YGW A;  1K5S A;  4LF6 B;  3AHM A;  3R7K A;  1PV0 A;  1SQB H;  1XMO O;  5KHJ A;  1DTO A;  4KS9 A;  3IGA C;  3T4D A;  5JH7 B;  1QBZ A;  1NT2 B;  4I7Z B;  2XAJ A;  5K3G A;  1OCC C;  1XRE A;  3H1H H;  1IBK O;  1BUC A;  4I55 B;  2C2A A;  2OIE A;  5B1B B;  2YEV A;  2PZS A;  1MA1 A;  5L3C A;  3RYH A;  5LMU B;  1M4U A;  1FXK B;  2LFS A;  3CMA V;  5C8Y A;  3JCU Z;  3Q23 A;  4I50 A;  3FKS G;  3UM7 A;  2IU3 A;  5LOV A;  1VF7 A;  1MSW D;  2IH1 C;  1SQP H;  4OX9 O;  4W4L A;  4J9Y B;  2OYQ A;  2DW4 A;  1M93 A;  2WLJ A;  2EBO A;  4UV9 A;  5A2Q N;  5CMU A;  1VAR A;  1BQ0 A;  4RO2 A;  1IXB A;  3X0X A;  4X1K B;  2QDO A;  3K58 A;  2Q0O C;  2IX6 A;  2JIF A;  5B1A C;  3ZN0 A;  5L3B A;  4JAS A;  1AI7 A;  3L75 H;  5KLV H;  4H33 A;  3DC6 A;  2DQ3 A;  4QPJ A;  2VQE O;  1GM7 A;  5B5V A;  4IT5 A;  5LMN B;  5LHG A;  1WN7 A;  2OT4 A;  3RYC B;  1X4T A;  1GN4 A;  4CS4 A;  1KEC A;  1OCO B;  4NKG B;  2R03 A;  3F5T A;  4GKK O;  4EB6 B;  1LUV A;  2P6J A;  4G27 B;  4RWU A;  3T2M A;  3K04 A;  4L3Y A;  1BS3 A;  3JAW A;  4R7C A;  1SKV A;  5KHG A;  2YDE A;  3WG7 B;  4J7J A;  5IWA O;  2HJN A;  1JOY A;  4Q5B A;  3Q4H B;  2EIN B;  4O4H A;  1NJI W;  1K8T A;  1LUW A;  1YCI A;  3OR6 C;  3RYI B;  3DC5 A;  3FAV A;  1BHB A;  4P9P A;  2M7W A;  1E79 G;  1NTM H;  4MVM A;  4BAY A;  5E1A C;  4I0X B;  3RYF B;  3WB1 A;  1TVK B;  1XNR B;  4AKG A;  4PDR A;  2KQX A;  3ABU A;  3TXQ A;  5IY5 B;  5EZY B;  4X66 B;  1Y6X A;  3AK3 A;  3B09 A;  1IBM B;  1W0J G;  2C12 A;  1PD3 A;  1JQI A;  2DWD C;  3KCX A;  2QM8 A;  2WLK A;  4ZXV A;  3E22 B;  5LHI A;  4O5M A;  1G8M A;  4OXS A;  1GN6 A;  4PI2 A;  4UVA A;  1XIL A;  5CBF A;  4MT8 A;  1IUR A;  4DR4 O;  1GM8 A;  1NR7 A;  4LQQ B;  3HQ2 A;  4XDK A;  4O4I A;  3HR0 A;  4JYB A;  4HYO A;  1S4B P;  4W4K A;  2VQF O;  2DWE C;  1RPO A;  1RSO B;  2Q0A A;  3D9D A;  1W0K G;  2FML A;  3CCL V;  3FB6 C;  4O4J A;  4I9Q A;  1Q43 A;  3HKD A;  1I7F A;  4N5F A;  2Q8G A;  4O4L B;  4AKI A;  4DR3 B;  2YYG A;  3JAR B;  4YHH B;  5LGT A;  2ZR3 A;  2N74 A;  4G28 B;  3N0R A;  1I08 A;  3RT3 C;  1US6 A;  3G6B A;  2PNR A;  5H2F Z;  1NBM G;  3J7A U;  2YYJ A;  4QIC A;  4YIP A;  4J9Z B;  1K73 W;  4MTG A;  1SA0 B;  3OMN B;  2EJ7 A;  4PV1 B;  5IYC O;  2BU8 A;  1PNM A;  4X28 C;  1ZLZ A;  4DO2 A;  3BAB A;  3PN1 A;  4LR3 A;  3IAY A;  3I5D A;  3SYC A;  3VQV A;  2HHH O;  2YYI A;  2BU6 A;  1SF9 A;  2YIB D;  1FFT B;  3Q22 A;  3K59 A;  3KCY A;  3OTF A;  1GRJ A;  2ZXW B;  3ZN1 A;  2Q8H A;  2Z5U A;  4DOY A;  1HNW B;  1PNL A;  4BR6 A;  2Q68 A;  5IYZ A;  1EZV H;  1P84 F;  3WU2 Z;  2GUZ B;  4DRX B;  2Q9L A;  1ZTE A;  2IU0 A;  3QO8 A;  4RM7 A;  2QWQ B;  2ATK C;  3H01 A;  3ZMT A;  1NI8 A;  4TQD A;  2YYL A;  2UU9 B;  5B6B A;  4TWK A;  2OCC B;  3OGI B;  4DV2 O;  5IJ9 B;  3B77 A;  4DW0 A;  4HNA B;  4DZY A;  3ZCC A;  1F23 A;  2AHY A;  4KL1 A;  5JQG B;  2H8P C;  2VR0 A;  2BU5 A;  1Q5O A;  2ZKJ A;  1TAE A;  3ZRV A;  3F7Y C;  3OTO B;  1UKW A;  4P13 A;  2FP1 A;  4Q17 A;  4LF7 O;  4U3F H;  1FS7 A;  4F6R B;  4ZHQ B;  3JAS A;  3R66 A;  1XHX A;  2JGU A;  3FFQ A;  2YXH A;  1EFR G;  5K1X A;  3D9E A;  1NQT A;  2P22 C;  3EFF K;  1RFY A;  1RM1 C;  1XFW A;  5CA0 A;  2UUC B;  2GTS A;  1S76 D;  1F4M A;  2Y4T A;  1IVS A;  2Y69 C;  2UUB B;  2Q69 A;  4LFC O;  3N2K B;  4KXR A;  1TUE B;  3AG4 B;  2P67 A;  1U97 A;  2A7W A;  2DDH A;  4MPN A;  3AG3 C;  4TQF A;  3HPL C;  1DF4 A;  2F43 G;  4JV5 B;  4H7Q A;  5LGN A;  4F0X A;  2CK3 G;  4FLT A;  3CC7 V;  4LF5 B;  2DN9 A;  2EIL C;  1GK9 A;  2NR5 A;  4JIZ A;  1UPG A;  2LQT A;  1XNQ B;  5GON A;  4GX5 A;  4J41 A;  3GQT A;  2PGG A;  2Q4P A;  2WLM A;  3CXC U;  4XVX A;  3LGQ A;  5E3X A;  2X6C A;  1PL4 A;  2PUS A;  2GHY A;  3TCU A;  1L8D A;  3SF6 A;  4LBE C;  1CPY A;  2EC5 A;  4LNU B;  5H5N A;  3AHN A;  3SCE A;  2ZDI A;  3W7T A;  4O2A A;  2EIK B;  4K0K B;  2R9A A;  3LDD A;  2IBZ H;  1OCZ C;  1OCR C;  2BTZ A;  4ABM A;  5ITZ A;  1T5E A;  2WA3 A;  1JX9 A;  3SDL A;  4GKJ B;  3ZMU A;  2PO4 A;  3OMI B;  1QCE A;  3FB5 C;  2QTO A;  3ABM B;  3UT5 B;  4UB6 Z;  1QVF U;  3OAA G;  2BOC C;  4BW9 A;  3HKB B;  4CC5 A;  4PDV A;  2BTQ A;  3SJC C;  3P32 A;  2VWJ A;  3BEH A;  1D2D A;  4FFB A;  2UXB B;  2YEV B;  3TJT A;  1YZB A;  2AZ0 A;  5BMV B;  4MSW C;  2YSU B;  2EIM C;  3T4Z A;  2NN4 A;  5LMU O;  1AB3 A;  2E80 A;  2JDI G;  3IC9 A;  3AFF A;  1RJ4 A;  2HKO A;  3CRM A;  3DXR A;  2JBR A;  2GV9 A;  1F7Y A;  4L1F A;  3BHP A;  3FYE B;  5GW7 A;  5KHI A;  3A0B Z;  2F1M A;  5KUM A;  5CBH A;  1Q90 D;  2RJZ A;  1YVW A;  1Q82 W;  4OO2 A;  3GM6 A;  1Q6U A;  3ZHV A;  4B3S B;  4TOI A;  4UVB A;  3ZRX A;  1BT8 A;  4W9U A;  2QR4 A;  1Q6I A;  3WB2 A;  2W6J G;  2BU2 A;  1MG1 A;  1NKD A;  3BFR A;  2JIZ G;  1XOU A;  4JI6 B;  1CP9 A;  4PEL A;  1N34 O;  2KB1 A;  2O36 A;  2Q7E A;  1M5I A;  2JBS A;  2Q6A A;  2PI4 A;  3A0H Z;  3K08 A;  4YY3 B;  2C0U A;  1VF5 B;  3A0R A;  1WB8 A;  2HFE C;  2W0F C;  1QLN A;  3VKG A;  5E79 Z;  1EBO A;  1MNG A;  3ASO B;  5BR8 B;  5B5W A;  2BSK B;  3MDE A;  3S7W A;  2AO2 A;  2DOS A;  4QGP A;  3JAW B;  4X28 A;  4AI6 A;  4J1V A;  4ZOL A;  1OJH A;  2PI5 A;  4O4H B;  2VWK A;  4K3A A;  2ZDY A;  4TT3 G;  4PHZ A;  3FAV B;  4D7T A;  3U10 A;  4EKW A;  1XDC A;  1SQX H;  3M9V A;  2F23 A;  1ZAU A;  3GWO A;  1WS9 A;  4DR5 B;  5LL6 Y;  1L0N H;  3B96 A;  2VRZ A;  3X2Q B;  1S5H C;  1XNR O;  2UXW A;  1GN3 A;  4FZ4 A;  3ZRW B;  2YYM A;  3D1I A;  1K8A W;  1KKC A;  4X66 O;  3A2F A;  3BNJ A;  3JD3 A;  4I9W A;  5CN0 A;  4LF9 B;  2FON A;  3QO7 A;  3I55 V;  4J7Z A;  1K7D A;  5B1N A;  3ZHU A;  3C90 A;  4O2B B;  1FS8 A;  3JD2 A;  1K92 A;  3JAT A;  4PD4 F;  5KX5 A;  4X1Y A;  2QSA A;  2H1J A;  2XUM A;  2ZE8 A;  5J9P C;  3K0G A;  1AR4 A;  4UUJ C;  3RVY A;  3O65 A;  5M4P A;  1S77 D;  3HKE A;  3D9G A;  2CH7 A;  2FL4 A;  4JTC B;  2QGN A;  2QWN B;  4JZG A;  2D3O W;  3ASN C;  4V26 A;  3JAK A;  4AKH A;  2BCC H;  1M9N A;  5IJ0 B;  4G97 A;  3JSN A;  2RMK B;  3D2R A;  4O4J B;  5K1P A;  3HKD B;  4JI1 O;  1YDX A;  3M99 B;  3RVZ A;  2CTQ A;  4DV7 O;  1XQ8 A;  1BCC H;  2BE3 A;  1KU9 A;  1WA8 A;  4MTO A;  2UXX A;  4WJY A;  1W59 A;  4G5E A;  4JAU A;  2EIJ B;  4WFB V;  1IX9 A;  4QIW F;  2P06 A;  4DV4 B;  1AJN A;  4EFB A;  1JFF A;  3CHX A;  2IH3 C;  3L9D A;  3CRL A;  3AHO A;  1QHT A;  5BRM A;  4X65 O;  4JI4 O;  1ZL8 B;  3GNC A;  3G4S V;  1S5L Z;  5KHH A;  2WLL A;  2NLJ C;  5B3S C;  1OHH G;  4KFM A;  4MVQ A;  1QLE C;  2V4D A;  3FB8 C;  3X29 A;  4UV8 A;  4D7S A;  2JRI A;  4LC1 A;  2OT5 A;  3JSL A;  1Y74 A;  3CPW U;  1KA2 A;  1VQM V;  3RGB A;  4DUZ B;  1GAX A;  4CH4 A;  3CB2 A;  3JD1 A;  4WFF A;  1N33 B;  1Q8I A;  1K5Q A;  4IIJ A;  5KA6 A;  4MW8 A;  1HNZ O;  4I4T A;  2HG5 C;  2IJJ A;  3IC7 A;  5J2T A;  4J10 A;  3OFN G;  2WBI A;  1SRY A;  1OCC B;  2HR3 A;  2B5U A;  3KML A;  2ZNI A;  1ROP A;  1PP9 H;  1B6Q A;  5IE9 A;  2Q5Z A;  1KA4 A;  1SS3 A;  5AG2 A;  1VEW A;  2OJQ A;  4X62 B;  4DR2 B;  5LHH A;  4ZYJ A;  2KG7 B;  4YXW G;  3SPH A;  4P9O A;  3OTO O;  3SJB C;  4GLX A;  4DV1 O;  1FS0 G;  5GTI Z;  3A8T A;  3ETQ A;  4CH3 A;  4JI0 B;  3H1J H;  4FK5 C;  2R0M A;  1FPO A;  2F66 C;  4KHP B;  1SQF A;  4DR1 O;  2DJV A;  4HKS A;  4U3J B;  2ZIN A;  4PDM A;  3LNN A;  1DK1 A;  5B1A B;  4J42 A;  5KA5 A;  2UUB O;  1P4R A;  3G67 A;  3P3P A;  1ZX3 A;  1I0H A;  4EFE A;  1EN4 A;  1TGO A;  4JAA A;  4PA9 A;  2IX5 A;  1LNQ A;  3IJ4 A;  4QE9 A;  4E01 A;  1AP6 A;  4JI8 O;  4PUT A;  1HP8 A;  1E1R G;  4X88 A;  5KAI Z;  4LF5 O;  4IRN A;  5GON B;  1SIQ A;  4WFA V;  5FNV A;  1XNQ O;  2CTW A;  3TZ2 A;  2LW7 A;  2RDC A;  2ZAF A;  3OEH G;  4P79 A;  3G80 A;  4DV3 O;  1Z5V A;  5H6R A;  1R3J C;  2BTO A;  4O2A B;  2O3E A;  4X89 A;  1BHA A;  3DWC A;  1FD9 A;  2EJR A;  4K0K O;  5ITZ B;  3ZMV A;  1M1K W;  3B40 A;  4X1I A;  3T1Y O;  3T1H B;  2K1E A;  2VS0 A;  1E1Q G;  1DLB A;  3BNH A;  3VAD A;  4G2K A;  1GN2 A;  2ITC C;  3QG5 A;  3K5M A;  3U11 A;  4WF9 V;  3CJH A;  3OE7 G;  4LF8 O;  1Y8O A;  5LA6 A;  2ZDI C;  3BRC A;  4UFZ A;  3CRA A;  4JI5 O;  2RQ6 A;  5LGU A;  2CGO A;  4MPC A;  2BTQ B;  1GKF A;  4HAM A;  4NXN B;  4FFB B;  5DN6 G;  2UXB O;  1VQ8 V;  5FLX N;  4NXM B;  1XFV A;  3ICX A;  1K90 A;  3ZED A;  3FCJ A;  5EC1 C;  4GX1 A;  1BL8 A;  5M4K A;  1D5N A;  4Q5C A;  1IBL B;  4FM1 A;  4LF4 B;  3DXR B;  3CRK A;  5DM6 V;  5FPR A;  4JI2 B;  4LP8 A;  5JVD B;  3E8H A;  1JMK C;  2IJI A;  3MHH C;  1G6U A;  1PK0 A;  1K4C C;  1KP2 A;  3SYP A;  3H9V A;  1SC5 A;  2LW1 A;  4KA7 A;  2CJ6 A;  5H9C A;  2X7R B;  3QTC A;  5BY1 A;  4WFH A;  1AJQ A;  1UJW B;  2E81 A;  2UXN A;  5J2U A;  1KYO F;  1NU1 H;  1N36 B;  1I94 O;  3JD4 A;  1PNK A;  1SER A;  5CA1 A;  1KC8 W;  4FLY A;  4MTF A;  4JI6 O;  3ZJZ A;  5GTH Z;  4MVR A;  4MS2 A;  4ZI7 A;  4B3R B;  1XFU A;  4DUY O;  2CX9 A;  4BIZ A;  1BGY H;  1S0V A;  5IY5 C;  3SWO A;  3F5W C;  5IYD O;  3SYO A;  2JEX A;  1KD1 W;  5M4M A;  3MHS C;  1HWY A;  2WLI A;  1EN5 A;  1AI4 A;  1YEW A;  5BZB A;  4YJ3 A;  3L74 H;  1SQV H;  5L44 A;  4UCV A;  1AI6 A;  1PI1 A;  5LP6 A;  2QEX V;  5EYP B;  4IGG A;  3MD0 A;  2JGD A;  3RW0 A;  4Q0T A;  4DR6 O;  4H81 A;  2UXC O;  1XMQ B;  1N8R W;  3UO3 A;  2UXD B;  5L3E A;  3ZS8 C;  1S72 V;  2FYU H;  3TZ5 A;  4HR3 A;  5LBQ A;  2YI8 A;  3TOR A;  3K9S A;  3W7W A;  3E8F A;  1K4D C;  2REH A;  2QWR B;  2W0X A;  2E5L B;  2YID A;  4DR5 O;  1XUQ A;  4FMT A;  4FLV A;  4JI3 B;  2YI9 A;  4E4E A;  4X8A A;  3MDD A;  4UB8 Z;  2QKS A;  3W7U A;  2XHB A;  2JEU A;  3ABL C;  1V55 B;  1VQ5 V;  1Q86 W;  2JJ1 G;  5LYJ B;  3JAT B;  5KX5 B;  4B3T B;  4X1Y B;  5DEC A;  1R73 A;  2K9P A;  3O9O A;  1HR0 O;  2Q8V A;  3HKE B;  4H37 A;  2CH7 B;  5EBW C;  3SPC A;  4LFA B;  2B9Z A;  3ZMS A;  3NXS A;  4JIO A;  4TV8 A;  4LWS A;  4YIO A;  1W2B U;  3E89 A;  5L43 A;  5M4N A;  1Y66 A;  2P4V A;  4UCU A;  3ABT A;  4TUY A;  2R72 A;  1I5X A;  3K9A A;  1PM9 A;  2UUA O;  1VQO V;  2XS8 A;  3U0Z A;  1WA8 B;  1XL4 A;  2CUG A;  2Y69 B;  4HZ3 A;  2IJH A;  2QWP B;  2R9I A;  2XAH A;  1JJ2 U;  2Q7G A;  2JJ2 G;  2HEP A;  1JFF B;  3AG3 B;  5L3D A;  2F93 B;  2DMX A;  2CJ7 A;  5IDJ A;  2ZR2 A;  3M8A A;  2EIL B;  3B8N A;  2G38 A;  4X20 B;  4I5S A;  3R65 A;  4GX2 A;  4WBN A;  4KP4 A;  2J7A A;  3ABK C;  4YJ2 B;  1WP8 A;  1FXK A;  3CYO A;  4E2L A;  2P90 A;  2OCH A;  4LFB O;  1HNX O;  2HVK C;  2DE0 X;  4B08 A;  1YTF B;  4OX9 B;  3BA8 A;  1Y74 B;  4JF3 A;  4B3M O;  2ZE7 A;  1OCZ B;  1OCR B;  4Q4U A;  2CGN A;  3AK2 A;  1XHZ A;  4MW3 A;  3MPJ A;  1K97 A;  1ZUQ A;  5GJV E;  1IDS A;  3ETE A;  4RAI A;  3SJA C;  2ODM A;  3CRC A;  2AZ2 A;  3VBB A;  1W07 A;  1VQK V;  1URF A;  3ML0 A;  4X1K A;  4LH6 A;  5DED A;  4JYA O;  4IV6 A;  2GBO A;  3AEI A;  1G1X B;  4LF6 O;  5H6Q A;  1DF5 A;  4LH7 A;  1WPX A;  4JYC A;  3RBZ A;  4H0L B;  3X0Y A;  4DR2 O;  2EIM B;  4GKK B;  2E74 B;  3WB0 A;  2PG0 A;  3JAL A;  4FM2 A;  1WPB A;  3CD6 V;  4EB6 A;  5GJW E;  2LGW A;  3ZX6 A;  3UU9 A;  1JM6 A;  4WFG A;  1SET A;  1Y76 A;  3RYH B;  3IFX A;  1B06 A;  3SPG A;  1VQ4 V;  3OIB A;  1HW7 A;  1NVP D;  3E8G A;  5C8Y B;  5IWA B;  4JI0 O;  2Y48 A;  4I50 B;  1J95 A;  5J71 A;  2XAQ A;  5LOV B;  2B1G A;  2OWO A;  3Q4H A;  3BVO A;  3T1C A;  4N23 A;  4U7O A;  4C7U A;  2AXT Z;  1YTF D;  1M57 C;  3D9F A;  5LXT A;  4PI0 A;  2Y4U A;  1GJV A;  2GSM B;  4XBF A;  4GCZ A;  3SXQ A;  3P3N A;  2GDS A;  3ETG A;  3E2E A;  1OV9 A;  5KMG A;  5EZY A;  1PPJ H;  4PA7 A;  1R3B A;  1QVG U;  3TGU H;  2KKW A;  2LFW A;  4FZ0 A;  1GH6 A;  2EBF X;  5LMN O;  4MTX A;  5FNV B;  2F6L A;  3E22 A;  2JBT A;  5BRK A;  1Q3E A;  2W6I G;  2OEX A;  3C46 A;  1F51 A;  1VF6 C;  2QA4 V;  2IW5 A;  4X1I B;  2EZO A;  3MXL A;  3AG2 C;  2QKA A;  4DW1 A;  2VQF B;  1R6N A;  4JPR A;  3SPI A;  3UKM A;  3BAA A;  3CXH F;  5J6A A;  2A3Q A;  3KZI Z;  2YYK A;  3RWR D;  1YSC A;  1U8V A;  1S5J A;  2R0N A;  1FFX A;  3CWB H;  1T9G A;  1XEQ A;  1H2G A;  3CC4 V;  2RNB A;  3D3I A;  4NXN O;  1M90 W;  4JZ2 A;  2XAS A;  2OEV A;  4K8Z A;  4NXM O;  1K34 A;  2LP7 A;  3KG2 A;  3K3W A;  3CCV V;  3S3X A;  2DYR C; 
#chains in the Genus database with same CATH homology
 5GJW E;  1XFY A;  1PK0 A;  4AKH A;  4G97 A;  1SC5 A;  1Y79 1;  4KA7 A;  1XFW A;  4AKI A;  5L43 A;  4HKS A;  2QR4 A;  3C3L A;  4KSF A;  3HOA A;  2AZE A;  2FP2 A;  2VF1 A;  4KA8 A;  2EBH X;  1K9X A;  4HKR A;  3N0R A;  4QIC A;  1LVC A;  1XFU A;  4F0X A;  3AHO A;  3Q0A A;  3VKG A;  4FF3 A;  1RP3 A;  4PUT A;  5E3X A;  4FF2 A;  2AO2 A;  4AI6 A;  4FF4 A;  2EC5 A;  3X29 A;  2LFW A;  3AHN A;  2YGW A;  3Q22 A;  2EBF X;  1XFX A;  3AHM A;  4P79 A;  2F6L A;  5L44 A;  1KA2 A;  2GBB A;  1K8T A;  4KS9 A;  3DWC A;  2PO4 A;  3C46 A;  1XFZ A;  1Y0V A;  3Q24 A;  4AKG A;  5GJV E;  3C2P A;  1K93 A;  4FZ4 A;  3KML A;  1SK6 A;  3VKH A;  1KA4 A;  3Q23 A;  1XFV A;  4KSA A;  1K90 A;  2H1J A;  2FP1 A;  3SKS A;  3HQ2 A;  1S26 A;  3CE2 A;  4FF1 A;  2H1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...