3CE2A

Crystal structure of putative peptidase from chlamydophila abortus
Total Genus 244
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
244
sequence length
600
structure length
595
Chain Sequence
QVRPRSEISPQDCWDITPLYLNRKAWKADLDSFGLKSPTWPALQATQYQLDNSESLLSLLTTLFSIERKLNKLYVYAHLTHDQDITNQEGIADLKSITHLHTLFAEETSWVQPALTSLSESLIAQHLSAPCLAPYRFYLEKIFRLSIHTGTPGEEKILASAFTPLEVASKAFSSLSDSEIPFGQATDSEGNSHPLSHALASLYMQSTDRELRKTSYLAQCERYHSYRHTFANLLNGKIQAHVFYAKNKRYNSCLQAALYHNNIPTTVYTNLIDIVKKNSSLITKYFSIKQRCLNLKDFHFYDVYAPLSQEKKYTFQEAVDLIYTSLSPLGTEYIDTLKQGLTTQGWVDKYENLNKRSGAYSSGCYDSHPYVLLNYTGTLYDVSVIAHEGGHSMHSYFSRKHQPFHDAQYPIFLAEIASTLNEMLLMDSMLKESDSKEEKITILTRCLDTIFSTLFRQVLFASFEYDIHHAAEHGVPLTEEYLSSTYKNLQNEFYGEIITFDVLSNIEWARIPHFYYNFYVYQYATGIIAALCFLEKILNNEDNALNSYLNFLKSGGSDFPLEILKKSGLDMGTVEPIQKAFCFIEKKIQELSSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative peptidase
publication title Crystal structure of putative peptidase from Chlamydophila abortus.
rcsb
source organism Chlamydophila abortus
molecule tags Structural genomics, unknown function
total genus 244
structure length 595
sequence length 600
ec nomenclature
pdb deposition date 2008-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01432 Peptidase_M3 Peptidase family M3
A PF08439 Peptidase_M3_N Oligopeptidase F
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.830 Mainly Alpha Orthogonal Bundle Helix Hairpins putative peptidase helix hairpin domain like 3ce2A02
1.10.1370.20 Mainly Alpha Orthogonal Bundle Neurolysin; domain 3 Neurolysin; domain 3 3ce2A03
1.20.140.70 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Butyryl-CoA Dehydrogenase, subunit A; domain 3 3ce2A01
3CE2A 2QR4A
chains in the Genus database with same CATH superfamily
1E79G 3SYQA 1AJNA 2Q8GA 2F4VB 4JI4B 4YIPA 1HNXO 4G27B 2RN9A 2VWKA 4PA7A 2LJ2A 2JBSA 5IJ9A 2EC5A 3RVYA 1H8HG 3NF4A 2UXXA 4Q20A 3E35A 2EBFX 3VQXA 3ZMUA 1GMGA 2YYKA 4U3JA 1H2LA 2P7TC 4WBNB 2IJKA 2JEXA 3OUSA 5IY5C 1MOFA 3VKGA 4P9PA 2KG7A 5LHIA 2FB5A 2QTSA 2EIMB 3RVZA 1OAHA 3QVNA 1QVFU 3SGIA 4JIOA 1F7YA 1FYJA 1YJWV 2E74B 3O65A 5J2TB 1K7DA 2R9RB 2AZEA 4I50B 1XFZA 3UU9A 2XAQA 3ZN1A 4KSFA 1EN4A 2QKSA 2WLJA 1Y4MA 2WBIA 3K08A 4DOYA 5D5PA 4DR6O 3M9VA 2EBHX 1JCHA 1FXVA 1UDYA 3ABLB 3RN4A 2Z5UA 1GO3F 4TSFG 4LF5B 1XFWA 2JGDA 4JAVA 2ZDIC 4MSWC 4X28C 3ZS8C 1MABG 4FFKA 5IYDO 2ZIOA 1WPXA 1VF5B 4MT8A 4LFCO 1YXBA 2YYLA 3AG3C 3MD0A 2YC0A 4FM0A 3NR7A 1DGSA 2VQFB 3KCYA 2P06A 3CRCA 3ETEA 4JYCA 4BW9A 3OTOB 4LF8B 5EZYB 3CRRA 3R7KA 3W7TA 2EIKC 3U11A 5BMVB 3G6BA 4DR5B 5L3CA 1H2SB 1OZ0A 3OWMA 3CHXA 2ZKOA 2OCCC 3JASA 2E80A 3EXAA 2F66C 3P3PA 2DYRC 3MHSC 2CX9A 2VWJA 4YY3O 5C8YB 2H3OA 2HHHB 1GKZA 1S72V 4KTOA 1G8MA 1MZEA 4WFGA 1XHXA 4LF4B 5JVDB 3C3SA 2ZR2A 2V7QG 4JTDB 4HZ3A 4UV8A 3ZCCA 4DR7O 2LP7A 4IIJA 4MTXA 4O4JA 1OCZC 4AQYB 4B3MB 2NNUA 1N33B 2UU9B 2GHYA 2XASA 2UXDO 1BQZA 2KKWA 1XMOB 4UCVA 4ZI7A 3B40A 3BFRA 4B3SO 3N2GB 1Q82W 1RM1C 4GKKB 4B7EA 3ZMVA 4DUYO 2ZIMA 1QLEB 2YSUB 4KXRA 3P32A 3OEHG 1O9GA 2AHYA 4DV7O 1TUBA 1E1RG 3HKCB 1HNZO 1K4CC 4DUZO 1SQFA 1ZL8A 4I0XA 1IBMB 1DTOA 5JJJB 2IH3C 4GCZA 4H44B 1HP8A 2DYSB 2BE3A 2P4VA 1SQVH 2UXBB 5JWPA 2V4DA 3JYCA 3CCRV 4X1YA 5JH7A 5B1AC 1VQ6V 3MPJA 2XAGA 3SPJA 1YJ9V 1XFXA 2ZDYA 3FYEB 2Z1QA 3A2FA 4YHHB 2PYJA 2YIBD 4DV1O 4JI2B 3MMOA 3TJTA 2JK5C 4LF7O 1AROP 3W7WA 5L3BA 4K8ZA 3K04A 1ZAUA 4GT1A 3C3TA 4D6TH 2OT4A 1R6NA 4L87A 1O9HA 3G6EV 3SF6A 2E81A 2QR4A 4RM7A 1HW7A 3ZHRA 3F5TA 5H6QA 4FLXA 4OX9B 5M4KA 3UM7A 1YDXA 1PNLA 3MPIA 3BAAA 1QBZA 2YXYA 3UQ8A 4IGGA 2N74A 1VP7A 4H81A 3ABMC 4QIWF 4YXWG 3OE7G 4JPRA 5IYZB 5JQGA 4TV9B 3SJQC 3JAKA 1P49A 4ZOLA 1MA1A 2XT9A 2WPDG 1EZVH 3ETQA 4E2LA 4MPNA 3HPLC 2NN4A 3AG1C 1OCCC 3N2KB 4X20B 2FL4A 1D5NA 1K92A 4MVQA 3ZIAG 1FJGO 3CRMA 4LP8A 4PA9A 3SDLA 2QWNB 4TT3G 1VQ4V 3H9VA 4B3RO 4U3FH 5B1BC 4QE7A 1MG1A 3CCQV 4CS2A 1YTFB 1XFVA 2BOCC 5LA6A 4QNHB 1FS8A 5ITZB 3EHBB 4PA6A 5KHIA 3R65A 1GN3A 1V55C 1KMIZ 2IX6A 3II9A 4YJ2A 4L3YA 2OTLV 1AJPA 1BZKA 3HKDA 4KUMA 2YXHA 4WFBV 4IL6Z 4I4TB 5LL6Y 1BMFG 3E8FA 3LG1A 3AG4B 3RYFB 4OXSA 1VQPV 1HR0B 3VQWA 1SESA 4MTOA 4X89A 3T4DA 3TXQA 5KHKA 1FFXA 2DN9A 4MVSA 4WJYA 2REHA 4PV1B 4KCFA 3AK1A 1I08A 3B09A 4X1IA 2Y69B 2RF7A 3CD6V 1WB8A 3S3WA 1N32B 1GM8A 4JV5B 4QPJA 4X62O 1NVPD 3TORA 1RP3B 5JJEB 1FXKB 4H33A 4JAUA 4UCRA 1SZTA 1DK1A 2XHBA 4Q5BA 3MKHA 1H2KA 4JI6B 2AGAA 1AR4A 4BIZA 3KMLA 5KMGA 2HKOA 5LXTA 1GK9A 1LVCA 4V26A 4H37A 5KHJA 5CA3A 5KX5A 2QWQB 1XFYA 4JI5O 3H1HH 4PD4F 5EK0A 1RX0A 3SYPA 1H2GA 2UXNA 4DR1O 3OT7A 3C3LA 2EBAA 1YHQV 1GM9A 3S7WA 3X0YA 1SZXA 2R9IA 2WLMA 4KHPO 4ZIBA 4EFBA 1HWYA 3RYCA 4UCSA 3FFQA 2EIMC 2BU7A 4UV9A 2YGWA 3UBRA 3JALA 4I7ZB 4UVBA 4LQSB 2HG5C 4X66B 3K0DA 1Q81W 4IRNA 2CK3G 1XUQA 3WB2A 1N34O 1FXHA 2YYMA 4AI8A 3CX5F 4YJ3B 1VQ5V 1OHHG 1F23A 4X88A 4LF6O 2V1DA 2EIJB 2PUSA 3OUFA 2WLKA 2IX5A 3E8BA 1CEZA 3ABLC 3FAVB 1JJ2U 3KCXA 4MVMA 1FS7A 4O4IB 4G97A 5KUMA 3BNFA 2QM7A 4JI7B 3WB0A 4X64O 3SPCA 1GKFA 1HNWO 1SK6A 4DV0B 2CJ4A 1ZUQA 2DWDC 3IJ4A 3DXRA 3ETGA 4NXMO 4Q1OA 3RBZA 1WA8B 4ZBMA 2ZDIA 5FLXN 3UO2A 4K0KB 1ENVA 4CH3A 2HFEC 2DE0X 1I1IP 1IVSA 1WP7A 3G4SV 3K06A 3ZRWB 3J81N 2E76B 2R05A 3BVOA 2C2AA 3HKEB 1Y76B 1D2DA 2GTAA 3CCVV 2QTOA 3SYCA 2Q0AA 3KG2A 5K1XA 5LMNO 3AG2B 5J2UB 5LOVB 2RCVA 4O2AA 1SC5A 2UUBB 3ZRVA 2HLDG 3AFEA 2H8PC 3JATB 1YZBA 4H7QA 4J11A 3RFRA 4GLXA 3MDEA 3JAMN 1UFIA 5E79Z 1WAZA 3CS5A 5CA1A 3RGBA 3FCJA 2WLIB 3E8GA 2CJ7A 3D3IA 2UUCO 1QLEC 1WB7A 1W2BU 2JGUA 3RYHA 5JJNB 1M90W 3ZBHA 3FD9A 3T2MA 2OIGA 1KP3A 3TZ0A 3KZIZ 2YDEA 1UJWB 2YUAA 1BGYH 2GUZB 4JZ2A 2DYSC 2B5UA 1VQKV 1YIJV 4UB8Z 3L75H 3K0GA 3L73H 3RYIA 2EULA 4LF9O 2ZR3A 3GWKC 3ASNB 5L3EA 5JCOC 4NTXA 2JIFA 3BA8A 4HR3A 4LC1A 5IJ9B 2ZXWB 4G2KA 4EEQA 2JVDA 2OEVA 4U3JB 4LWSA 3ABKB 1W59A 4W9UA 3CRQA 1BT8A 3M7MX 5GONA 4F4LA 3MHHC 5IYBO 3J80N 2EJRA 4R8CA 4DV2O 2YICA 3QO5A 1VF6C 1V9PA 2JS3A 2DVLA 1M56B 1MMMA 1AI6A 2UXCB 2YIBA 1P7GA 4AI6A 2CJ8A 3OM3B 3D1IA 4DR2O 1PKXA 2JJ2G 1LUWA 2W0XA 3PJSK 3CC7V 4GKJB 3D9FA 4MP2A 1GRJA 3QNEA 4I9WA 1IBKO 3H1JH 5DEDA 4V25A 3B2EE 4HBNA 2OIEA 3Q0AA 4RUFA 4DR3B 4JI8B 5B66Z 3G71V 3IGAC 1KU9A 5IYCO 2YEVB 4KFMA 4DV5O 2EILB 4QJFB 1GKXA 4LNUB 4WF9V 4FLTA 3K79A 3WU2Z 4JASA 3SPHA 4LFAO 1XNQO 3EVKA 1M4UA 1N0NA 4N5FA 4BIOA 1MNGA 2XUMA 3F7YC 1ZSPA 3DSQA 1P84F 1NS1A 4JYAB 3EONA 4PDLA 4ZHQA 2RJZA 2FTKA 2CGNA 4FZ4A 1EGDA 5CBFA 4DW0A 2EINB 3L9DA 1KC8W 5IJ0A 1ROPA 3T4ZA 1Y66A 3DTUB 3KKYA 5CB4B 1CP9A 1XEQA 3JASB 1VQOV 4KL1A 2VS0A 3T1YO 4E01A 2ATKC 5B5EZ 2YYJA 4AKIA 2CTQA 4YIOA 4J7KA 1XNRO 3AG4C 1AJQA 1Q90D 1S5HC 2UUAB 5J71A 4ZXVA 1PL4A 5BXZA 1Z2GA 1BHBA 2YS8A 1SQBH 3OIBA 4IIJB 3MDSA 2M7WA 4D7TA 5LGUA 5CA0A 2D29A 2Y69C 2FP1A 2R03A 4EB6A 5H5NA 1YF2A 5J6AA 2QWOB 2H94A 5CBHA 1JQIA 4KA7A 4HYOA 4JEKA 1PV0A 2X6BA 4L8JA 1EFRG 3C90A 3N0RA 4X65O 1I94B 5FPRA 3WG7B 1TUBB 1FXKC 2Y0IA 2Q7HA 3L72H 1ZL8B 4O4LB 4N21A 4HNAA 1TAEA 2Y4UA 4LH6A 5LMUO 4DRXA 2VQEO 3ZMTA 2QKAA 4Z2WA 5GJWE 5DM6V 4ABMA 4X1YB 1NI8A 3GWOA 2LW7A 3OEEG 5HFMA 2C12A 1QR8A 4FFBA 2ZM6B 4DV6B 4CH4A 5EBLC 5EIBC 2AW9A 5EIBD 1AP6A 5LGTA 3A0HZ 1LUVA 2HJDA 4R7CA 1H8EG 1R73A 4DV3O 3VADA 4FM1A 2R0MA 2P4KA 1PM9A 2BSKA 2CUGA 1NR1A 3GM6A 3OD4A 4PA3A 1AILA 4KSAA 3VQVA 4DXWA 3T1HB 3M8AA 5BZBA 3CRLA 2WWWA 2YIAA 4WBNA 4JTCB 1OCOB 2EZOA 2BTOA 5H6RA 1EN6A 5A2QN 4JI1B 2EIJC 2Z3YA 2DQ0A 1L0NH 1NH2B 4I55A 5JQGB 1AI7A 3JAKB 4ZOLB 3CJHB 4DO2A 3SJAC 4NB5A 4TUYA 3U0ZA 3CCEV 4J42A 4I50A 1UKWA 2OR0A 4E4EA 1XHZA 3LGQA 1JX9A 1EN5A 4N23A 1I5XA 2NLJC 1M93A 5EBWC 5BR8O 3BCCH 3F29A 4KA8A 4O4HA 4IHJB 4TV8A 4Q5CA 1KB9F 1XI1A 1Y8NA 2Q69A 3OGCC 2PYLA 3JCZA 5LYJA 2IH1C 3TZ2A 4NYKA 3X0XA 3L71H 2BTQB 1K8TA 2VR0A 3ZHUA 2XS8A 1RSOA 4DW1A 1IBLO 2ZCEA 3RWRD 4IYIA 2HVKC 1FAFA 4FF3A 2A1TA 3ZX6A 3RT3C 4YJ2B 4X1KA 2L6LA 1BQ0A 3HKDB 3Q22A 1NTZH 1DF4A 4DR4O 1I5YA 1WNSA 1XMQB 5IWAO 1YSCA 4AILC 1UPGA 2EX3A 3L70H 3E22A 4HKRA 1FFXB 1H38A 1Q6IA 2JDIG 2QE7G 2P6JA 5IT9N 3K9SA 1N36B 4E02A 4NXLA 4DV4O 4X1IB 3D3QA 4Q17A 3H1LH 4J1VA 2IU0A 1URFA 4NXNO 1ORQC 4ZKIA 2CJ5A 3OMIB 5D5QA 1WP8A 1KKDA 5KUKA 3HKBA 1U8VA 3C2PA 1GM7A 4TOIA 2O3EA 1K73W 1R2JA 1XL4A 1PL0A 4G28B 3A0BZ 4P79A 3MXLA 4JI0O 1KBHA 3RW0A 4LQQB 3PN1A 4B3TB 2B1GA 1KYOF 3B8MA 3BRCA 3OW2U 3AK2A 3P3NA 1L8DA 2RNBA 2A79B 4HKSA 5LXTB 1WPBA 1Q5OA 2F93B 3ASNC 1SQXH 5EC1C 2IBZH 2F43G 2P90A 1NZ6A 3HKCA 3TZ5A 2ZXWC 2WLHA 3D6BA 2QEXV 1G4YB 4B7KA 2XS1A 2RQ6A 3K9AA 1ZX3A 4PI2A 2F4VO 3JARA 1QVGU 1PP9H 4JYYA 4TWKA 2Y4TA 3ABKC 4JI4O 4MPCA 2E3CA 2LGWA 4PA4A 3DWCA 3AFFA 1A32A 3OTFA 1JVMA 2VIGA 2E0AA 5JCOA 3AHMA 1JMKC 4FJCC 3GNCA 3ZEDA 2RDZA 1M56C 1JFFA 4XDKA 4WCEV 4BWAA 1SIQA 1YJNV 2JBRA 2CTWA 5KLVH 1J5EB 4FXYP 4UCTA 2WA3A 5GTHZ 4JI3B 2E5LB 4JAAA 4UCUA 1S3JA 3JAWB 4OGQB 1K5SA 3D36A 2KQXA 3HR0A 4MS2A 1L1FA 1B04A 1F4NA 4LFBB 2PGGA 3ZHVA 2HP8A 2EILC 1R1BA 5LP6A 2HEPA 1VARA 5B1NA 4FF4A 2BU5A 3K59A 1QU7A 2Y48A 5L43A 4LF5O 1GAXA 4FF1A 2GTSA 1SA0B 1FPOA 2LFWA 2JEUA 2PF4E 3LNNA 3DXRB 2PZSA 5FNVA 1JM6A 4M9AA 1Y74A 2QGNA 3H01A 4IV6A 2Q8HA 2LQTA 2CH7B 2EINC 3N2KA 3S3XA 2ZAFA 1HNXB 1NBMG 3LDCA 2VQFO 2CAZC 4FPPA 1Q6HA 4RWUA 2A3QA 3OTOO 3D9DA 4IT5A 4LF8O 1Q8IA 3FB8C 2ILMA 4FIPC 1TVKA 3K5LA 1F4MA 4DR5O 4UVAA 3UKMA 1SC5B 5ITZA 3L1TA 1FD9A 4GUNA 4DK0A 3MDDA 2Q7GA 2HHHO 3IC7A 1CPYA 2G38A 1THZA 3BPZA 4LF4O 2X6CA 2E75B 2ADPA 2GV9A 4RO2A 1HDJA 1Q43A 4AQYO 1I7FA 4K8XA 2X7RB 4J9YB 3WFVA 4B3MO 1N33O 2UU9O 4DR6B 3RYHB 3WG7C 1KECA 1XMOO 3OFNG 2X6AA 4GKKO 5BY1A 2FKXA 1KA2A 1P7BA 3E2EA 2AHZA 4D7SA 1Y791 3RYIB 3A8TA 1BCCH 1IBMO 4LFCB 1FXKA 2AZ2A 2QM4A 2ZNJA 2R0NA 4X28A 3CXHF 4GYCB 3E83A 2UXBO 2ODMA 4BW5A 2Q7EA 3B77A 3K5MA 2FYUH 3N27A 3FX7A 3Q4HA 1R3JC 5GONB 4YHHO 2W0FC 2YI9A 3QG5A 4PDVA 4Z1VA 4JI2O 1M1KW 4L38A 4YY3B 1U97A 3B4SA 3O9OA 4PDMA 2BU8A 5EYPA 4MTFA 1FKAO 1JOYA 4CZZA 3SYAA 5A9GA 5B5VA 1PNKA 1OCOC 2KSDA 4JYBA 5EC2C 4MW8A 4J80A 2ZINA 4RQEA 1K4DC 4OX9O 2ZQMA 3DC6A 2AO2A 4DR7B 1JA8A 3FB7C 1AI4A 5FL7G 3SR2C 1NH2D 1FS9A 1WLEA 2Q67A 1VF7A 2ARHA 2UXDB 2Z0AA 2MW2B 2Q73A 2F95B 4B3SB 4KS9A 4DUYB 4UFZA 2AZ0A 3SXQA 3E89A 1KQSU 4LR3A 4B08A 3FO3A 1GTOA 1R6TA 2K1EA 4DV7B 2D3OW 1HNZB 4DUZB 4U7OA 1YEWA 4OPHA 1B06A 2Q5ZA 4PJ0Z 2VRZA 3AG7A 2PG0A 5CN0A 5J9PC 1XOUA 4GX2A 3DC5A 1S5JA 3MAQA 5E1AC 1TA8A 1IZ3A 2N05A 2W6JG 5IJ0B 4O2BA 1Y8OA 1GN4A 1XBLA 1YCIA 1K5QA 3UT5A 3LSQA 1R3KC 5CBGA 3ASOB 4F6EA 4XVXA 2BOBC 2KG7B 4DV1B 2CTRA 2XNDG 1QQCA 1XILA 2ZE5A 1H2MA 4LF7B 4A5UB 1PK0A 2ZNIA 1OJHA 3D9GA 1SETA 3JCUZ 2IM9A 4H85A 3Q23A 2H1JA 3OWAA 3DGEA 5EBMC 1BUCA 2LW1A 3HKEA 1SQQH 1HR0O 1BSMA 1K90A 1Y76A 1NT2B 3CCMV 4PI0A 5FPOA 3ZN0A 2DOSA 4Q0TA 2F1MA 1L0LH 3AEIA 2Q68A 2LGQA 3I56V 3BNGA 2JGDB 5H9CA 4UCOA 4LCUC 1B3QA 2A7WA 1TGOA 1XREA 5B1OA 1N32O 1M9NA 1RFYA 2IJJA 4JV5O 3OMAB 2BU2A 4DRXB 1IURA 5IDJA 4IYHA 1OCRB 3FB5C 4FK5C 5B3SB 2WLIA 3TTBA 1NVPB 5DECA 1WJZA 2HR3A 1Q6UA 1FJGB 4QICA 1I0HA 4MVRA 1FFTB 4JI6O 2WLNA 1BS3A 4X8AA 4FFBB 4MTGA 2XAJA 1YTFD 3APOA 4B3RB 4MP7A 1N0JA 3SPIA 4PHZA 1TUEB 1Z5WA 1XQ8A 3FB6C 1S26A 3JD1A 2QJ1A 2BSKB 2ZE7A 4E00A 1AR1B 3TZ4A 4K3AA 3SWOA 2XOKG 4CBCA 1IS2A 5KAFZ 3ZHQA 2QSAA 2YXLA 4J41A 3VOUA 2DQ3A 2WLLA 1S77D 4MPEA 1WS9A 4O4JB 4F6RA 1OV9A 5M4PA 1RJ4A 3QF7A 3JD3A 4X66O 2PY5A 2Q8FA 1SQGA 5K3JA 1V54B 1VMGA 3NXSA 4ZI7B 1B6QA 1QDBA 4I55B 1QHTA 4JZGA 5LGNA 4PUTA 4PDRA 1JR9A 1D5AA 4TUYB 1SQPH 1KP2A 1AI5A 3R66A 2PI4A 2FONA 2IW5A 4X62B 4JTAB 3CCUV 1AB3A 4I0XB 1IXMA 1NQTA 3CPWU 1K8AW 4H0LB 4O4HB 1GH6A 4GX5A 4TV8B 4TQFA 4U7NA 2GDSA 1X8ZA 1ZLZA 2XAHA 1KKCA 1MZFA 2P67A 1M57B 4Q6GA 3E8HA 5LYJB 1VQLV 5JH7B 1EBOA 4JI7O 3AHOA 1G6UA 2YEVA 4NTYA 1QLNA 4LNUA 5L3FA 4W4KA 1SRYA 1VQ7V 3W7SA 1RSOB 1IX9A 4DV0O 3HB3B 4GX1A 2BCCH 3IAYA 4AHCA 2H1NA 2Q0OC 4JI5B 3LDEA 4MVOA 2RFQA 4X1KB 2C0UA 2ITCC 2FMLA 4R6ZA 5LBQA 4K0KO 2VF1A 1BE3H 4DR1B 4XDLA 2EJ7A 1RPRA 4PELA 2CGOA 2HJFC 3ICXA 2D2CB 3JD4A 4KHPB 3L74H 3E22B 1XDCA 1Y0VA 5CB4A 1N8RW 4P13A 2PI5A 1EGEA 5TISZ 1N34B 2WSSG 2MK3A 5K1PA 3BEHA 3GVMA 3W7UA 2X0LA 1VQMV 1YITV 2F23A 2UUBO 3X29A 2OT5A 2LFRA 3ZHTA 4Z1MG 3HKBB 4UUJC 4LF6B 4JF3A 5J2TA 2XQRB 1K34A 4Q4UA 3CMAV 4W4LA 1DF5A 1H2NA 3EOMA 4J10A 5LHHA 1T5EA 1AVMA 1PD3A 2IJHA 1NU1H 2DW4A 4BAYA 3OAAG 2AXTZ 2A9HA 4J7ZA 1KA4A 1S4BP 4X64B 4C7UA 3UCSC 2RDCA 3X2QB 1HNWB 1ZTEA 5DN6G 3ZHSA 3LSSA 1IDSA 2GBBA 2M6YA 5BRKA 4O4LA 5LA6B 5KHHA 4BR6A 2K9PA 2KB1A 4NXMB 3CXCU 1K93A 3JARB 1R3IC 4FLVA 4CH6A 3P30A 4JGSA 3VQYA 3HWCA 2QDOA 4HAMA 1MSDA 4H13B 5AG2A 2DMXA 4AKGA 2R72A 3AG2C 3SKSA 5EZYA 1JFFB 3K3WA 5BMVA 1JQ0A 3CYOA 2Q9LA 5LMNB 4GZRB 4MW3A 3F5WC 4I9QA 2Q8IA 1GN2A 2ZDXA 1WN7A 5C8YA 5KA5A 2UXCO 4EFEA 3BABA 2BTZA 5B6BA 3VKHA 2QWPB 1NTKH 4RUEA 4WFAV 5GTIZ 5JVDA 4WFHA 2JS5A 1BL8A 1S76D 3CP1A 3ETDA 4GKJO 5LP6B 5L44A 2IU3A 2ITDC 4NTWA 2NR5A 1K3EA 2UUCB 5K3IA 3CEIA 5L3DA 2ETNA 1T9GA 2R9AA 4DR3O 4JI8O 2OYQA 3OMNB 3N2GA 3CCJV 1K33A 1IVHA 3CJHA 5KMGB 5FNVB 4LBEC 3E86A 3J7AU 1Y74B 2Y0PA 4FVMA 1E1QG 2PNRA 5KX5B 1S0VA 1RJ1A 2YYIA 4P9OA 1VIBA 4NVPA 4LF9B 1CXZB 4JYAO 5K3GA 4ZYJA 4BIUA 2DWEC 4NR1A 1JJOA 3CMEV 3H1KH 1X90A 4IHJA 2FP2A 3CCLV 3ASOC 3K5OA 2O57A 2A06H 1G1XB 3TGUH 5HFLA 5LHGA 2EZPA 1R3BA 1TVKB 4R50A 3RYCB 3B96A 4ASUG 2OTJV 2JJ1G 3JD2A 3JALB 3SJCC 2BTQA 4ICGA 4P2ZA 2J7AA 1DLBA 3JSLA 4FLZA 5F2VO 3BHPA 4DV2B 5IY5B 2HVJC 3LDDA 3BY6A 2B9ZA 2UUAO 3CCSV 3LUTB 4DR2B 4FZ0A 1QNMA 3U10A 1VF6A 3G67A 1SF9A 4UXNA 3CB2A 1IBKB 4MVUA 4FLUA 2O36A 1US6A 1W0KG 2R70A 4CS4A 3CRKA 4CC6A 4XDJA 1X4TA 3CC2V 1PPJH 3ML0A 4P30A 4F0XA 4QGPA 3D9EA 5BRMA 3CC4V 4DV5B 2QWRB 3WB1A 2QA4V 1XNQB 4LFAB 2JRIA 1I94O 5IYZA 1OCRC 4TV9A 1W07A 5B3SC 2OEXA 2JIZG 2B1IA 3LNMB 3ABUA 4JIZA 1FS0G 3PFDA 2W6IG 3SCEA 1YI2V 1KD1W 2Q4PA 2P22C 1EM1A 4QPKA 4X20A 4X9QA 3QO8A 1Y6XA 1Z5VA 2ZO5A 3AG3B 3CRAA 3K58A 1M5IA 5C93A 3TCUA 3OR7C 3Q4HB 2OCHA 2ZM6O 4DV6O 1KUQA 1Q86W 4U83A 3T1YB 3IFXA 5EYPB 2EIKB 1XG2B 2ZE8A 4WFFA 4O2AB 2F6LA 1AP5A 1XNRB 1N4CA 3M99B 2OCCB 1AR5A 3TK1A 4DYLA 3AK3A 2DYRB 2XAFA 5KHGA 3IC9A 2ZKJA 1K9MW 1V54C 3T1HO 3JD0A 5CA1B 3C46A 5H2FZ 4I4TA 2CDYA 3RYFA 3I55V 1COWG 2Q6AA 5E3XA 3STLC 3B8NA 4NKGB 3CE2A 4JI1O 4DK1A 3CWBH 3VBBA 3SJBC 2GBOA 1OCZB 1NR7A 3OR6C 3T1CA 2A0LA 4X65B 2ZT9B 3QO7A 3JAWA 3ZRSA 2Q8VA 5CMUA 1RM1B 3BA9A 1EZJA 2QM8A 1GJVA 2CJ6A 1M57C 2QKCA 4MVZA 5LMUB 2VQEB 1F51A 3ZMSA 1RP3A 2YYGA 3K03A 1X59A 4UVCA 3I5DA 3QTCA 4O2BB 2LFSA 3SPGA 3AHNA 3SYOA 1VEWA 1VQ8V 4QE9A 4LWSB 1ZWIC 3UT5B 3RKHA 3LSUA 1R3LC 1SA0A 3W7XA 1LR1A 4FMTA 4O5MA 4CH5A 1K9XA 3K57A 4KP4A 5B1AB 3HOAA 4XBFA 2OJQA 4DV3B 3D8CA 5GJVE 2DDHA 2CH7A 1U96A 2GSMB 3ABTA 3FYIB 1XMQO 3Q24A 1Q7YW 2YI8A 1IXBA 3HQ2A 5M4NA 5GW7A 4J7JA 3UO3A 3D2RA 1SKVA 1N36O 4G5EA 3OGIB 3ZMZA 3H1IH 1EGCA 3APQA 2PO4A 4CS3A 2HJNA 3F7VC 4OO2A 1Y8PA 4WFEA 4L3ZA 2PTMA 2DJVA 4EKWA 3G80A 4L3XA 4YJ3A 5IE9A 4GX0A 3ABMB 3GQTA 3BNHA 2XTAA 3A0RA 1S5LZ 4CC5A 5KAIZ 5BR8B 3FAVA 4ZHQB 3TETA 4RAIA 4DZYA 1BHAA 2CE4A 3X2QC 4B3TO 4O4IA 1Y67A 4AKHA 3AG1B 3K5NA 1OCCB 4FLYA 2L35A 1MSWD 1XL6A 1VQNV 1P4RA 1SIRA 2P5OA 1JPXA 4I5SA 1IBLB 1GU6A 1K97A 2IJIA 1NTMH 2JBTA 1WA8A 5B1BB 3STZC 3GB7C 3THOA 4DR4B 3JSNA 1YVWA 3TXSA 2WLLB 1QR9A 3FKSG 5IWAB 4FLWA 2ADQB 1V55B 1Q3EA 4F6RB 3ZRWA 3ZRXA 5CA0B 3P4TA 2ZE6A 4OPAA 1J95A 2BU6A 1RPOA 4EB6B 4RQFA 1PNMA 4DV4B 3D36C 2N04A 4FZ1A 1J5EO 5LOVA 4TQDA 5J2UA 3BNJA 4NXNB 2CTPA 2WA4A 1W0JG 1LNQA 2YIDA 4JI3O 1VQ9V 2E5LO 5LP6C 1SERA 3JATA 2OWOA 4K35A 4HNAB 2UXWA 1QCEA 2WAMA 2EBOA 5M4MA 2R02A 2RMKB 2ZD9A 4FM2A 4LFBO 1X91A 1R6KA 4J9ZB 1NJIW 4JI0B 5B5WA 1NKDA 1SS3A 5KA6A 4FF2A 5L3GA 4L1FA 4UB6Z 1GN6A 3CSXA 1XFUA 5K3HA 2LO1A 4LH7A 3EFFK 1PI1A 3ZJZA 2GUZA
chains in the Genus database with same CATH topology
4FF3A 2FP2A 3Q22A 3KMLA 1Y791 3C46A 1KA4A 5GJWE 1LVCA 4PUTA 3Q0AA 5E3XA 1PK0A 2EC5A 1XFYA 4HKRA 3CE2A 4AKHA 1SC5A 2EBFX 2GBBA 4FF4A 3Q23A 1K93A 2H1JA 5L43A 3C3LA 1K90A 3VKGA 4FF1A 2LFWA 2YGWA 4AKGA 3AHOA 1RP3A 3C2PA 4FZ4A 4KSAA 3SKSA 2AZEA 1XFVA 1XFZA 4P79A 3AHNA 4KSFA 4F0XA 2H1NA 2AO2A 2VF1A 2EBHX 4AKIA 4HKSA 1K9XA 3VKHA 4QICA 3HOAA 1XFWA 1XFXA 5GJVE 5L44A 4KS9A 4G97A 1Y0VA 3Q24A 3DWCA 4KA8A 1SK6A 2FP1A 1S26A 3HQ2A 4KA7A 3X29A 2QR4A 4FF2A 3AHMA 3N0RA 1K8TA 1XFUA 2PO4A 4AI6A 2F6LA 1KA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CE2 A;  2QR4 A; 
#chains in the Genus database with same CATH topology
 1E79 G;  3SYQ A;  1AJN A;  2Q8G A;  2F4V B;  4JI4 B;  4YIP A;  1HNX O;  4G27 B;  2RN9 A;  2VWK A;  4PA7 A;  2LJ2 A;  2JBS A;  5IJ9 A;  2EC5 A;  3RVY A;  1H8H G;  3NF4 A;  2UXX A;  4Q20 A;  3E35 A;  2EBF X;  3VQX A;  3ZMU A;  1GMG A;  2YYK A;  4U3J A;  1H2L A;  2P7T C;  4WBN B;  2IJK A;  2JEX A;  3OUS A;  5IY5 C;  1MOF A;  3VKG A;  4P9P A;  2KG7 A;  5LHI A;  2FB5 A;  2QTS A;  2EIM B;  3RVZ A;  1OAH A;  3QVN A;  1QVF U;  3SGI A;  4JIO A;  1F7Y A;  1FYJ A;  1YJW V;  2E74 B;  3O65 A;  5J2T B;  1K7D A;  2R9R B;  2AZE A;  4I50 B;  1XFZ A;  3UU9 A;  2XAQ A;  3ZN1 A;  4KSF A;  1EN4 A;  2QKS A;  2WLJ A;  1Y4M A;  2WBI A;  3K08 A;  4DOY A;  5D5P A;  4DR6 O;  3M9V A;  2EBH X;  1JCH A;  1FXV A;  1UDY A;  3ABL B;  3RN4 A;  2Z5U A;  1GO3 F;  4TSF G;  4LF5 B;  1XFW A;  2JGD A;  4JAV A;  2ZDI C;  4MSW C;  4X28 C;  3ZS8 C;  1MAB G;  4FFK A;  5IYD O;  2ZIO A;  1WPX A;  1VF5 B;  4MT8 A;  4LFC O;  1YXB A;  2YYL A;  3AG3 C;  3MD0 A;  2YC0 A;  4FM0 A;  3NR7 A;  1DGS A;  2VQF B;  3KCY A;  2P06 A;  3CRC A;  3ETE A;  4JYC A;  4BW9 A;  3OTO B;  4LF8 B;  5EZY B;  3CRR A;  3R7K A;  3W7T A;  2EIK C;  3U11 A;  5BMV B;  3G6B A;  4DR5 B;  5L3C A;  1H2S B;  1OZ0 A;  3OWM A;  3CHX A;  2ZKO A;  2OCC C;  3JAS A;  2E80 A;  3EXA A;  2F66 C;  3P3P A;  2DYR C;  3MHS C;  2CX9 A;  2VWJ A;  4YY3 O;  5C8Y B;  2H3O A;  2HHH B;  1GKZ A;  1S72 V;  4KTO A;  1G8M A;  1MZE A;  4WFG A;  1XHX A;  4LF4 B;  5JVD B;  3C3S A;  2ZR2 A;  2V7Q G;  4JTD B;  4HZ3 A;  4UV8 A;  3ZCC A;  4DR7 O;  2LP7 A;  4IIJ A;  4MTX A;  4O4J A;  1OCZ C;  4AQY B;  4B3M B;  2NNU A;  1N33 B;  2UU9 B;  2GHY A;  2XAS A;  2UXD O;  1BQZ A;  2KKW A;  1XMO B;  4UCV A;  4ZI7 A;  3B40 A;  3BFR A;  4B3S O;  3N2G B;  1Q82 W;  1RM1 C;  4GKK B;  4B7E A;  3ZMV A;  4DUY O;  2ZIM A;  1QLE B;  2YSU B;  4KXR A;  3P32 A;  3OEH G;  1O9G A;  2AHY A;  4DV7 O;  1TUB A;  1E1R G;  3HKC B;  1HNZ O;  1K4C C;  4DUZ O;  1SQF A;  1ZL8 A;  4I0X A;  1IBM B;  1DTO A;  5JJJ B;  2IH3 C;  4GCZ A;  4H44 B;  1HP8 A;  2DYS B;  2BE3 A;  2P4V A;  1SQV H;  2UXB B;  5JWP A;  2V4D A;  3JYC A;  3CCR V;  4X1Y A;  5JH7 A;  5B1A C;  1VQ6 V;  3MPJ A;  2XAG A;  3SPJ A;  1YJ9 V;  1XFX A;  2ZDY A;  3FYE B;  2Z1Q A;  3A2F A;  4YHH B;  2PYJ A;  2YIB D;  4DV1 O;  4JI2 B;  3MMO A;  3TJT A;  2JK5 C;  4LF7 O;  1ARO P;  3W7W A;  5L3B A;  4K8Z A;  3K04 A;  1ZAU A;  4GT1 A;  3C3T A;  4D6T H;  2OT4 A;  1R6N A;  4L87 A;  1O9H A;  3G6E V;  3SF6 A;  2E81 A;  2QR4 A;  4RM7 A;  1HW7 A;  3ZHR A;  3F5T A;  5H6Q A;  4FLX A;  4OX9 B;  5M4K A;  3UM7 A;  1YDX A;  1PNL A;  3MPI A;  3BAA A;  1QBZ A;  2YXY A;  3UQ8 A;  4IGG A;  2N74 A;  1VP7 A;  4H81 A;  3ABM C;  4QIW F;  4YXW G;  3OE7 G;  4JPR A;  5IYZ B;  5JQG A;  4TV9 B;  3SJQ C;  3JAK A;  1P49 A;  4ZOL A;  1MA1 A;  2XT9 A;  2WPD G;  1EZV H;  3ETQ A;  4E2L A;  4MPN A;  3HPL C;  2NN4 A;  3AG1 C;  1OCC C;  3N2K B;  4X20 B;  2FL4 A;  1D5N A;  1K92 A;  4MVQ A;  3ZIA G;  1FJG O;  3CRM A;  4LP8 A;  4PA9 A;  3SDL A;  2QWN B;  4TT3 G;  1VQ4 V;  3H9V A;  4B3R O;  4U3F H;  5B1B C;  4QE7 A;  1MG1 A;  3CCQ V;  4CS2 A;  1YTF B;  1XFV A;  2BOC C;  5LA6 A;  4QNH B;  1FS8 A;  5ITZ B;  3EHB B;  4PA6 A;  5KHI A;  3R65 A;  1GN3 A;  1V55 C;  1KMI Z;  2IX6 A;  3II9 A;  4YJ2 A;  4L3Y A;  2OTL V;  1AJP A;  1BZK A;  3HKD A;  4KUM A;  2YXH A;  4WFB V;  4IL6 Z;  4I4T B;  5LL6 Y;  1BMF G;  3E8F A;  3LG1 A;  3AG4 B;  3RYF B;  4OXS A;  1VQP V;  1HR0 B;  3VQW A;  1SES A;  4MTO A;  4X89 A;  3T4D A;  3TXQ A;  5KHK A;  1FFX A;  2DN9 A;  4MVS A;  4WJY A;  2REH A;  4PV1 B;  4KCF A;  3AK1 A;  1I08 A;  3B09 A;  4X1I A;  2Y69 B;  2RF7 A;  3CD6 V;  1WB8 A;  3S3W A;  1N32 B;  1GM8 A;  4JV5 B;  4QPJ A;  4X62 O;  1NVP D;  3TOR A;  1RP3 B;  5JJE B;  1FXK B;  4H33 A;  4JAU A;  4UCR A;  1SZT A;  1DK1 A;  2XHB A;  4Q5B A;  3MKH A;  1H2K A;  4JI6 B;  2AGA A;  1AR4 A;  4BIZ A;  3KML A;  5KMG A;  2HKO A;  5LXT A;  1GK9 A;  1LVC A;  4V26 A;  4H37 A;  5KHJ A;  5CA3 A;  5KX5 A;  2QWQ B;  1XFY A;  4JI5 O;  3H1H H;  4PD4 F;  5EK0 A;  1RX0 A;  3SYP A;  1H2G A;  2UXN A;  4DR1 O;  3OT7 A;  3C3L A;  2EBA A;  1YHQ V;  1GM9 A;  3S7W A;  3X0Y A;  1SZX A;  2R9I A;  2WLM A;  4KHP O;  4ZIB A;  4EFB A;  1HWY A;  3RYC A;  4UCS A;  3FFQ A;  2EIM C;  2BU7 A;  4UV9 A;  2YGW A;  3UBR A;  3JAL A;  4I7Z B;  4UVB A;  4LQS B;  2HG5 C;  4X66 B;  3K0D A;  1Q81 W;  4IRN A;  2CK3 G;  1XUQ A;  3WB2 A;  1N34 O;  1FXH A;  2YYM A;  4AI8 A;  3CX5 F;  4YJ3 B;  1VQ5 V;  1OHH G;  1F23 A;  4X88 A;  4LF6 O;  2V1D A;  2EIJ B;  2PUS A;  3OUF A;  2WLK A;  2IX5 A;  3E8B A;  1CEZ A;  3ABL C;  3FAV B;  1JJ2 U;  3KCX A;  4MVM A;  1FS7 A;  4O4I B;  4G97 A;  5KUM A;  3BNF A;  2QM7 A;  4JI7 B;  3WB0 A;  4X64 O;  3SPC A;  1GKF A;  1HNW O;  1SK6 A;  4DV0 B;  2CJ4 A;  1ZUQ A;  2DWD C;  3IJ4 A;  3DXR A;  3ETG A;  4NXM O;  4Q1O A;  3RBZ A;  1WA8 B;  4ZBM A;  2ZDI A;  5FLX N;  3UO2 A;  4K0K B;  1ENV A;  4CH3 A;  2HFE C;  2DE0 X;  1I1I P;  1IVS A;  1WP7 A;  3G4S V;  3K06 A;  3ZRW B;  3J81 N;  2E76 B;  2R05 A;  3BVO A;  2C2A A;  3HKE B;  1Y76 B;  1D2D A;  2GTA A;  3CCV V;  2QTO A;  3SYC A;  2Q0A A;  3KG2 A;  5K1X A;  5LMN O;  3AG2 B;  5J2U B;  5LOV B;  2RCV A;  4O2A A;  1SC5 A;  2UUB B;  3ZRV A;  2HLD G;  3AFE A;  2H8P C;  3JAT B;  1YZB A;  4H7Q A;  4J11 A;  3RFR A;  4GLX A;  3MDE A;  3JAM N;  1UFI A;  5E79 Z;  1WAZ A;  3CS5 A;  5CA1 A;  3RGB A;  3FCJ A;  2WLI B;  3E8G A;  2CJ7 A;  3D3I A;  2UUC O;  1QLE C;  1WB7 A;  1W2B U;  2JGU A;  3RYH A;  5JJN B;  1M90 W;  3ZBH A;  3FD9 A;  3T2M A;  2OIG A;  1KP3 A;  3TZ0 A;  3KZI Z;  2YDE A;  1UJW B;  2YUA A;  1BGY H;  2GUZ B;  4JZ2 A;  2DYS C;  2B5U A;  1VQK V;  1YIJ V;  4UB8 Z;  3L75 H;  3K0G A;  3L73 H;  3RYI A;  2EUL A;  4LF9 O;  2ZR3 A;  3GWK C;  3ASN B;  5L3E A;  5JCO C;  4NTX A;  2JIF A;  3BA8 A;  4HR3 A;  4LC1 A;  5IJ9 B;  2ZXW B;  4G2K A;  4EEQ A;  2JVD A;  2OEV A;  4U3J B;  4LWS A;  3ABK B;  1W59 A;  4W9U A;  3CRQ A;  1BT8 A;  3M7M X;  5GON A;  4F4L A;  3MHH C;  5IYB O;  3J80 N;  2EJR A;  4R8C A;  4DV2 O;  2YIC A;  3QO5 A;  1VF6 C;  1V9P A;  2JS3 A;  2DVL A;  1M56 B;  1MMM A;  1AI6 A;  2UXC B;  2YIB A;  1P7G A;  4AI6 A;  2CJ8 A;  3OM3 B;  3D1I A;  4DR2 O;  1PKX A;  2JJ2 G;  1LUW A;  2W0X A;  3PJS K;  3CC7 V;  4GKJ B;  3D9F A;  4MP2 A;  1GRJ A;  3QNE A;  4I9W A;  1IBK O;  3H1J H;  5DED A;  4V25 A;  3B2E E;  4HBN A;  2OIE A;  3Q0A A;  4RUF A;  4DR3 B;  4JI8 B;  5B66 Z;  3G71 V;  3IGA C;  1KU9 A;  5IYC O;  2YEV B;  4KFM A;  4DV5 O;  2EIL B;  4QJF B;  1GKX A;  4LNU B;  4WF9 V;  4FLT A;  3K79 A;  3WU2 Z;  4JAS A;  3SPH A;  4LFA O;  1XNQ O;  3EVK A;  1M4U A;  1N0N A;  4N5F A;  4BIO A;  1MNG A;  2XUM A;  3F7Y C;  1ZSP A;  3DSQ A;  1P84 F;  1NS1 A;  4JYA B;  3EON A;  4PDL A;  4ZHQ A;  2RJZ A;  2FTK A;  2CGN A;  4FZ4 A;  1EGD A;  5CBF A;  4DW0 A;  2EIN B;  3L9D A;  1KC8 W;  5IJ0 A;  1ROP A;  3T4Z A;  1Y66 A;  3DTU B;  3KKY A;  5CB4 B;  1CP9 A;  1XEQ A;  3JAS B;  1VQO V;  4KL1 A;  2VS0 A;  3T1Y O;  4E01 A;  2ATK C;  5B5E Z;  2YYJ A;  4AKI A;  2CTQ A;  4YIO A;  4J7K A;  1XNR O;  3AG4 C;  1AJQ A;  1Q90 D;  1S5H C;  2UUA B;  5J71 A;  4ZXV A;  1PL4 A;  5BXZ A;  1Z2G A;  1BHB A;  2YS8 A;  1SQB H;  3OIB A;  4IIJ B;  3MDS A;  2M7W A;  4D7T A;  5LGU A;  5CA0 A;  2D29 A;  2Y69 C;  2FP1 A;  2R03 A;  4EB6 A;  5H5N A;  1YF2 A;  5J6A A;  2QWO B;  2H94 A;  5CBH A;  1JQI A;  4KA7 A;  4HYO A;  4JEK A;  1PV0 A;  2X6B A;  4L8J A;  1EFR G;  3C90 A;  3N0R A;  4X65 O;  1I94 B;  5FPR A;  3WG7 B;  1TUB B;  1FXK C;  2Y0I A;  2Q7H A;  3L72 H;  1ZL8 B;  4O4L B;  4N21 A;  4HNA A;  1TAE A;  2Y4U A;  4LH6 A;  5LMU O;  4DRX A;  2VQE O;  3ZMT A;  2QKA A;  4Z2W A;  5GJW E;  5DM6 V;  4ABM A;  4X1Y B;  1NI8 A;  3GWO A;  2LW7 A;  3OEE G;  5HFM A;  2C12 A;  1QR8 A;  4FFB A;  2ZM6 B;  4DV6 B;  4CH4 A;  5EBL C;  5EIB C;  2AW9 A;  5EIB D;  1AP6 A;  5LGT A;  3A0H Z;  1LUV A;  2HJD A;  4R7C A;  1H8E G;  1R73 A;  4DV3 O;  3VAD A;  4FM1 A;  2R0M A;  2P4K A;  1PM9 A;  2BSK A;  2CUG A;  1NR1 A;  3GM6 A;  3OD4 A;  4PA3 A;  1AIL A;  4KSA A;  3VQV A;  4DXW A;  3T1H B;  3M8A A;  5BZB A;  3CRL A;  2WWW A;  2YIA A;  4WBN A;  4JTC B;  1OCO B;  2EZO A;  2BTO A;  5H6R A;  1EN6 A;  5A2Q N;  4JI1 B;  2EIJ C;  2Z3Y A;  2DQ0 A;  1L0N H;  1NH2 B;  4I55 A;  5JQG B;  1AI7 A;  3JAK B;  4ZOL B;  3CJH B;  4DO2 A;  3SJA C;  4NB5 A;  4TUY A;  3U0Z A;  3CCE V;  4J42 A;  4I50 A;  1UKW A;  2OR0 A;  4E4E A;  1XHZ A;  3LGQ A;  1JX9 A;  1EN5 A;  4N23 A;  1I5X A;  2NLJ C;  1M93 A;  5EBW C;  5BR8 O;  3BCC H;  3F29 A;  4KA8 A;  4O4H A;  4IHJ B;  4TV8 A;  4Q5C A;  1KB9 F;  1XI1 A;  1Y8N A;  2Q69 A;  3OGC C;  2PYL A;  3JCZ A;  5LYJ A;  2IH1 C;  3TZ2 A;  4NYK A;  3X0X A;  3L71 H;  2BTQ B;  1K8T A;  2VR0 A;  3ZHU A;  2XS8 A;  1RSO A;  4DW1 A;  1IBL O;  2ZCE A;  3RWR D;  4IYI A;  2HVK C;  1FAF A;  4FF3 A;  2A1T A;  3ZX6 A;  3RT3 C;  4YJ2 B;  4X1K A;  2L6L A;  1BQ0 A;  3HKD B;  3Q22 A;  1NTZ H;  1DF4 A;  4DR4 O;  1I5Y A;  1WNS A;  1XMQ B;  5IWA O;  1YSC A;  4AIL C;  1UPG A;  2EX3 A;  3L70 H;  3E22 A;  4HKR A;  1FFX B;  1H38 A;  1Q6I A;  2JDI G;  2QE7 G;  2P6J A;  5IT9 N;  3K9S A;  1N36 B;  4E02 A;  4NXL A;  4DV4 O;  4X1I B;  3D3Q A;  4Q17 A;  3H1L H;  4J1V A;  2IU0 A;  1URF A;  4NXN O;  1ORQ C;  4ZKI A;  2CJ5 A;  3OMI B;  5D5Q A;  1WP8 A;  1KKD A;  5KUK A;  3HKB A;  1U8V A;  3C2P A;  1GM7 A;  4TOI A;  2O3E A;  1K73 W;  1R2J A;  1XL4 A;  1PL0 A;  4G28 B;  3A0B Z;  4P79 A;  3MXL A;  4JI0 O;  1KBH A;  3RW0 A;  4LQQ B;  3PN1 A;  4B3T B;  2B1G A;  1KYO F;  3B8M A;  3BRC A;  3OW2 U;  3AK2 A;  3P3N A;  1L8D A;  2RNB A;  2A79 B;  4HKS A;  5LXT B;  1WPB A;  1Q5O A;  2F93 B;  3ASN C;  1SQX H;  5EC1 C;  2IBZ H;  2F43 G;  2P90 A;  1NZ6 A;  3HKC A;  3TZ5 A;  2ZXW C;  2WLH A;  3D6B A;  2QEX V;  1G4Y B;  4B7K A;  2XS1 A;  2RQ6 A;  3K9A A;  1ZX3 A;  4PI2 A;  2F4V O;  3JAR A;  1QVG U;  1PP9 H;  4JYY A;  4TWK A;  2Y4T A;  3ABK C;  4JI4 O;  4MPC A;  2E3C A;  2LGW A;  4PA4 A;  3DWC A;  3AFF A;  1A32 A;  3OTF A;  1JVM A;  2VIG A;  2E0A A;  5JCO A;  3AHM A;  1JMK C;  4FJC C;  3GNC A;  3ZED A;  2RDZ A;  1M56 C;  1JFF A;  4XDK A;  4WCE V;  4BWA A;  1SIQ A;  1YJN V;  2JBR A;  2CTW A;  5KLV H;  1J5E B;  4FXY P;  4UCT A;  2WA3 A;  5GTH Z;  4JI3 B;  2E5L B;  4JAA A;  4UCU A;  1S3J A;  3JAW B;  4OGQ B;  1K5S A;  3D36 A;  2KQX A;  3HR0 A;  4MS2 A;  1L1F A;  1B04 A;  1F4N A;  4LFB B;  2PGG A;  3ZHV A;  2HP8 A;  2EIL C;  1R1B A;  5LP6 A;  2HEP A;  1VAR A;  5B1N A;  4FF4 A;  2BU5 A;  3K59 A;  1QU7 A;  2Y48 A;  5L43 A;  4LF5 O;  1GAX A;  4FF1 A;  2GTS A;  1SA0 B;  1FPO A;  2LFW A;  2JEU A;  2PF4 E;  3LNN A;  3DXR B;  2PZS A;  5FNV A;  1JM6 A;  4M9A A;  1Y74 A;  2QGN A;  3H01 A;  4IV6 A;  2Q8H A;  2LQT A;  2CH7 B;  2EIN C;  3N2K A;  3S3X A;  2ZAF A;  1HNX B;  1NBM G;  3LDC A;  2VQF O;  2CAZ C;  4FPP A;  1Q6H A;  4RWU A;  2A3Q A;  3OTO O;  3D9D A;  4IT5 A;  4LF8 O;  1Q8I A;  3FB8 C;  2ILM A;  4FIP C;  1TVK A;  3K5L A;  1F4M A;  4DR5 O;  4UVA A;  3UKM A;  1SC5 B;  5ITZ A;  3L1T A;  1FD9 A;  4GUN A;  4DK0 A;  3MDD A;  2Q7G A;  2HHH O;  3IC7 A;  1CPY A;  2G38 A;  1THZ A;  3BPZ A;  4LF4 O;  2X6C A;  2E75 B;  2ADP A;  2GV9 A;  4RO2 A;  1HDJ A;  1Q43 A;  4AQY O;  1I7F A;  4K8X A;  2X7R B;  4J9Y B;  3WFV A;  4B3M O;  1N33 O;  2UU9 O;  4DR6 B;  3RYH B;  3WG7 C;  1KEC A;  1XMO O;  3OFN G;  2X6A A;  4GKK O;  5BY1 A;  2FKX A;  1KA2 A;  1P7B A;  3E2E A;  2AHZ A;  4D7S A;  1Y79 1;  3RYI B;  3A8T A;  1BCC H;  1IBM O;  4LFC B;  1FXK A;  2AZ2 A;  2QM4 A;  2ZNJ A;  2R0N A;  4X28 A;  3CXH F;  4GYC B;  3E83 A;  2UXB O;  2ODM A;  4BW5 A;  2Q7E A;  3B77 A;  3K5M A;  2FYU H;  3N27 A;  3FX7 A;  3Q4H A;  1R3J C;  5GON B;  4YHH O;  2W0F C;  2YI9 A;  3QG5 A;  4PDV A;  4Z1V A;  4JI2 O;  1M1K W;  4L38 A;  4YY3 B;  1U97 A;  3B4S A;  3O9O A;  4PDM A;  2BU8 A;  5EYP A;  4MTF A;  1FKA O;  1JOY A;  4CZZ A;  3SYA A;  5A9G A;  5B5V A;  1PNK A;  1OCO C;  2KSD A;  4JYB A;  5EC2 C;  4MW8 A;  4J80 A;  2ZIN A;  4RQE A;  1K4D C;  4OX9 O;  2ZQM A;  3DC6 A;  2AO2 A;  4DR7 B;  1JA8 A;  3FB7 C;  1AI4 A;  5FL7 G;  3SR2 C;  1NH2 D;  1FS9 A;  1WLE A;  2Q67 A;  1VF7 A;  2ARH A;  2UXD B;  2Z0A A;  2MW2 B;  2Q73 A;  2F95 B;  4B3S B;  4KS9 A;  4DUY B;  4UFZ A;  2AZ0 A;  3SXQ A;  3E89 A;  1KQS U;  4LR3 A;  4B08 A;  3FO3 A;  1GTO A;  1R6T A;  2K1E A;  4DV7 B;  2D3O W;  1HNZ B;  4DUZ B;  4U7O A;  1YEW A;  4OPH A;  1B06 A;  2Q5Z A;  4PJ0 Z;  2VRZ A;  3AG7 A;  2PG0 A;  5CN0 A;  5J9P C;  1XOU A;  4GX2 A;  3DC5 A;  1S5J A;  3MAQ A;  5E1A C;  1TA8 A;  1IZ3 A;  2N05 A;  2W6J G;  5IJ0 B;  4O2B A;  1Y8O A;  1GN4 A;  1XBL A;  1YCI A;  1K5Q A;  3UT5 A;  3LSQ A;  1R3K C;  5CBG A;  3ASO B;  4F6E A;  4XVX A;  2BOB C;  2KG7 B;  4DV1 B;  2CTR A;  2XND G;  1QQC A;  1XIL A;  2ZE5 A;  1H2M A;  4LF7 B;  4A5U B;  1PK0 A;  2ZNI A;  1OJH A;  3D9G A;  1SET A;  3JCU Z;  2IM9 A;  4H85 A;  3Q23 A;  2H1J A;  3OWA A;  3DGE A;  5EBM C;  1BUC A;  2LW1 A;  3HKE A;  1SQQ H;  1HR0 O;  1BSM A;  1K90 A;  1Y76 A;  1NT2 B;  3CCM V;  4PI0 A;  5FPO A;  3ZN0 A;  2DOS A;  4Q0T A;  2F1M A;  1L0L H;  3AEI A;  2Q68 A;  2LGQ A;  3I56 V;  3BNG A;  2JGD B;  5H9C A;  4UCO A;  4LCU C;  1B3Q A;  2A7W A;  1TGO A;  1XRE A;  5B1O A;  1N32 O;  1M9N A;  1RFY A;  2IJJ A;  4JV5 O;  3OMA B;  2BU2 A;  4DRX B;  1IUR A;  5IDJ A;  4IYH A;  1OCR B;  3FB5 C;  4FK5 C;  5B3S B;  2WLI A;  3TTB A;  1NVP B;  5DEC A;  1WJZ A;  2HR3 A;  1Q6U A;  1FJG B;  4QIC A;  1I0H A;  4MVR A;  1FFT B;  4JI6 O;  2WLN A;  1BS3 A;  4X8A A;  4FFB B;  4MTG A;  2XAJ A;  1YTF D;  3APO A;  4B3R B;  4MP7 A;  1N0J A;  3SPI A;  4PHZ A;  1TUE B;  1Z5W A;  1XQ8 A;  3FB6 C;  1S26 A;  3JD1 A;  2QJ1 A;  2BSK B;  2ZE7 A;  4E00 A;  1AR1 B;  3TZ4 A;  4K3A A;  3SWO A;  2XOK G;  4CBC A;  1IS2 A;  5KAF Z;  3ZHQ A;  2QSA A;  2YXL A;  4J41 A;  3VOU A;  2DQ3 A;  2WLL A;  1S77 D;  4MPE A;  1WS9 A;  4O4J B;  4F6R A;  1OV9 A;  5M4P A;  1RJ4 A;  3QF7 A;  3JD3 A;  4X66 O;  2PY5 A;  2Q8F A;  1SQG A;  5K3J A;  1V54 B;  1VMG A;  3NXS A;  4ZI7 B;  1B6Q A;  1QDB A;  4I55 B;  1QHT A;  4JZG A;  5LGN A;  4PUT A;  4PDR A;  1JR9 A;  1D5A A;  4TUY B;  1SQP H;  1KP2 A;  1AI5 A;  3R66 A;  2PI4 A;  2FON A;  2IW5 A;  4X62 B;  4JTA B;  3CCU V;  1AB3 A;  4I0X B;  1IXM A;  1NQT A;  3CPW U;  1K8A W;  4H0L B;  4O4H B;  1GH6 A;  4GX5 A;  4TV8 B;  4TQF A;  4U7N A;  2GDS A;  1X8Z A;  1ZLZ A;  2XAH A;  1KKC A;  1MZF A;  2P67 A;  1M57 B;  4Q6G A;  3E8H A;  5LYJ B;  1VQL V;  5JH7 B;  1EBO A;  4JI7 O;  3AHO A;  1G6U A;  2YEV A;  4NTY A;  1QLN A;  4LNU A;  5L3F A;  4W4K A;  1SRY A;  1VQ7 V;  3W7S A;  1RSO B;  1IX9 A;  4DV0 O;  3HB3 B;  4GX1 A;  2BCC H;  3IAY A;  4AHC A;  2H1N A;  2Q0O C;  4JI5 B;  3LDE A;  4MVO A;  2RFQ A;  4X1K B;  2C0U A;  2ITC C;  2FML A;  4R6Z A;  5LBQ A;  4K0K O;  2VF1 A;  1BE3 H;  4DR1 B;  4XDL A;  2EJ7 A;  1RPR A;  4PEL A;  2CGO A;  2HJF C;  3ICX A;  2D2C B;  3JD4 A;  4KHP B;  3L74 H;  3E22 B;  1XDC A;  1Y0V A;  5CB4 A;  1N8R W;  4P13 A;  2PI5 A;  1EGE A;  5TIS Z;  1N34 B;  2WSS G;  2MK3 A;  5K1P A;  3BEH A;  3GVM A;  3W7U A;  2X0L A;  1VQM V;  1YIT V;  2F23 A;  2UUB O;  3X29 A;  2OT5 A;  2LFR A;  3ZHT A;  4Z1M G;  3HKB B;  4UUJ C;  4LF6 B;  4JF3 A;  5J2T A;  2XQR B;  1K34 A;  4Q4U A;  3CMA V;  4W4L A;  1DF5 A;  1H2N A;  3EOM A;  4J10 A;  5LHH A;  1T5E A;  1AVM A;  1PD3 A;  2IJH A;  1NU1 H;  2DW4 A;  4BAY A;  3OAA G;  2AXT Z;  2A9H A;  4J7Z A;  1KA4 A;  1S4B P;  4X64 B;  4C7U A;  3UCS C;  2RDC A;  3X2Q B;  1HNW B;  1ZTE A;  5DN6 G;  3ZHS A;  3LSS A;  1IDS A;  2GBB A;  2M6Y A;  5BRK A;  4O4L A;  5LA6 B;  5KHH A;  4BR6 A;  2K9P A;  2KB1 A;  4NXM B;  3CXC U;  1K93 A;  3JAR B;  1R3I C;  4FLV A;  4CH6 A;  3P30 A;  4JGS A;  3VQY A;  3HWC A;  2QDO A;  4HAM A;  1MSD A;  4H13 B;  5AG2 A;  2DMX A;  4AKG A;  2R72 A;  3AG2 C;  3SKS A;  5EZY A;  1JFF B;  3K3W A;  5BMV A;  1JQ0 A;  3CYO A;  2Q9L A;  5LMN B;  4GZR B;  4MW3 A;  3F5W C;  4I9Q A;  2Q8I A;  1GN2 A;  2ZDX A;  1WN7 A;  5C8Y A;  5KA5 A;  2UXC O;  4EFE A;  3BAB A;  2BTZ A;  5B6B A;  3VKH A;  2QWP B;  1NTK H;  4RUE A;  4WFA V;  5GTI Z;  5JVD A;  4WFH A;  2JS5 A;  1BL8 A;  1S76 D;  3CP1 A;  3ETD A;  4GKJ O;  5LP6 B;  5L44 A;  2IU3 A;  2ITD C;  4NTW A;  2NR5 A;  1K3E A;  2UUC B;  5K3I A;  3CEI A;  5L3D A;  2ETN A;  1T9G A;  2R9A A;  4DR3 O;  4JI8 O;  2OYQ A;  3OMN B;  3N2G A;  3CCJ V;  1K33 A;  1IVH A;  3CJH A;  5KMG B;  5FNV B;  4LBE C;  3E86 A;  3J7A U;  1Y74 B;  2Y0P A;  4FVM A;  1E1Q G;  2PNR A;  5KX5 B;  1S0V A;  1RJ1 A;  2YYI A;  4P9O A;  1VIB A;  4NVP A;  4LF9 B;  1CXZ B;  4JYA O;  5K3G A;  4ZYJ A;  4BIU A;  2DWE C;  4NR1 A;  1JJO A;  3CME V;  3H1K H;  1X90 A;  4IHJ A;  2FP2 A;  3CCL V;  3ASO C;  3K5O A;  2O57 A;  2A06 H;  1G1X B;  3TGU H;  5HFL A;  5LHG A;  2EZP A;  1R3B A;  1TVK B;  4R50 A;  3RYC B;  3B96 A;  4ASU G;  2OTJ V;  2JJ1 G;  3JD2 A;  3JAL B;  3SJC C;  2BTQ A;  4ICG A;  4P2Z A;  2J7A A;  1DLB A;  3JSL A;  4FLZ A;  5F2V O;  3BHP A;  4DV2 B;  5IY5 B;  2HVJ C;  3LDD A;  3BY6 A;  2B9Z A;  2UUA O;  3CCS V;  3LUT B;  4DR2 B;  4FZ0 A;  1QNM A;  3U10 A;  1VF6 A;  3G67 A;  1SF9 A;  4UXN A;  3CB2 A;  1IBK B;  4MVU A;  4FLU A;  2O36 A;  1US6 A;  1W0K G;  2R70 A;  4CS4 A;  3CRK A;  4CC6 A;  4XDJ A;  1X4T A;  3CC2 V;  1PPJ H;  3ML0 A;  4P30 A;  4F0X A;  4QGP A;  3D9E A;  5BRM A;  3CC4 V;  4DV5 B;  2QWR B;  3WB1 A;  2QA4 V;  1XNQ B;  4LFA B;  2JRI A;  1I94 O;  5IYZ A;  1OCR C;  4TV9 A;  1W07 A;  5B3S C;  2OEX A;  2JIZ G;  2B1I A;  3LNM B;  3ABU A;  4JIZ A;  1FS0 G;  3PFD A;  2W6I G;  3SCE A;  1YI2 V;  1KD1 W;  2Q4P A;  2P22 C;  1EM1 A;  4QPK A;  4X20 A;  4X9Q A;  3QO8 A;  1Y6X A;  1Z5V A;  2ZO5 A;  3AG3 B;  3CRA A;  3K58 A;  1M5I A;  5C93 A;  3TCU A;  3OR7 C;  3Q4H B;  2OCH A;  2ZM6 O;  4DV6 O;  1KUQ A;  1Q86 W;  4U83 A;  3T1Y B;  3IFX A;  5EYP B;  2EIK B;  1XG2 B;  2ZE8 A;  4WFF A;  4O2A B;  2F6L A;  1AP5 A;  1XNR B;  1N4C A;  3M99 B;  2OCC B;  1AR5 A;  3TK1 A;  4DYL A;  3AK3 A;  2DYR B;  2XAF A;  5KHG A;  3IC9 A;  2ZKJ A;  1K9M W;  1V54 C;  3T1H O;  3JD0 A;  5CA1 B;  3C46 A;  5H2F Z;  4I4T A;  2CDY A;  3RYF A;  3I55 V;  1COW G;  2Q6A A;  5E3X A;  3STL C;  3B8N A;  4NKG B;  3CE2 A;  4JI1 O;  4DK1 A;  3CWB H;  3VBB A;  3SJB C;  2GBO A;  1OCZ B;  1NR7 A;  3OR6 C;  3T1C A;  2A0L A;  4X65 B;  2ZT9 B;  3QO7 A;  3JAW A;  3ZRS A;  2Q8V A;  5CMU A;  1RM1 B;  3BA9 A;  1EZJ A;  2QM8 A;  1GJV A;  2CJ6 A;  1M57 C;  2QKC A;  4MVZ A;  5LMU B;  2VQE B;  1F51 A;  3ZMS A;  1RP3 A;  2YYG A;  3K03 A;  1X59 A;  4UVC A;  3I5D A;  3QTC A;  4O2B B;  2LFS A;  3SPG A;  3AHN A;  3SYO A;  1VEW A;  1VQ8 V;  4QE9 A;  4LWS B;  1ZWI C;  3UT5 B;  3RKH A;  3LSU A;  1R3L C;  1SA0 A;  3W7X A;  1LR1 A;  4FMT A;  4O5M A;  4CH5 A;  1K9X A;  3K57 A;  4KP4 A;  5B1A B;  3HOA A;  4XBF A;  2OJQ A;  4DV3 B;  3D8C A;  5GJV E;  2DDH A;  2CH7 A;  1U96 A;  2GSM B;  3ABT A;  3FYI B;  1XMQ O;  3Q24 A;  1Q7Y W;  2YI8 A;  1IXB A;  3HQ2 A;  5M4N A;  5GW7 A;  4J7J A;  3UO3 A;  3D2R A;  1SKV A;  1N36 O;  4G5E A;  3OGI B;  3ZMZ A;  3H1I H;  1EGC A;  3APQ A;  2PO4 A;  4CS3 A;  2HJN A;  3F7V C;  4OO2 A;  1Y8P A;  4WFE A;  4L3Z A;  2PTM A;  2DJV A;  4EKW A;  3G80 A;  4L3X A;  4YJ3 A;  5IE9 A;  4GX0 A;  3ABM B;  3GQT A;  3BNH A;  2XTA A;  3A0R A;  1S5L Z;  4CC5 A;  5KAI Z;  5BR8 B;  3FAV A;  4ZHQ B;  3TET A;  4RAI A;  4DZY A;  1BHA A;  2CE4 A;  3X2Q C;  4B3T O;  4O4I A;  1Y67 A;  4AKH A;  3AG1 B;  3K5N A;  1OCC B;  4FLY A;  2L35 A;  1MSW D;  1XL6 A;  1VQN V;  1P4R A;  1SIR A;  2P5O A;  1JPX A;  4I5S A;  1IBL B;  1GU6 A;  1K97 A;  2IJI A;  1NTM H;  2JBT A;  1WA8 A;  5B1B B;  3STZ C;  3GB7 C;  3THO A;  4DR4 B;  3JSN A;  1YVW A;  3TXS A;  2WLL B;  1QR9 A;  3FKS G;  5IWA B;  4FLW A;  2ADQ B;  1V55 B;  1Q3E A;  4F6R B;  3ZRW A;  3ZRX A;  5CA0 B;  3P4T A;  2ZE6 A;  4OPA A;  1J95 A;  2BU6 A;  1RPO A;  4EB6 B;  4RQF A;  1PNM A;  4DV4 B;  3D36 C;  2N04 A;  4FZ1 A;  1J5E O;  5LOV A;  4TQD A;  5J2U A;  3BNJ A;  4NXN B;  2CTP A;  2WA4 A;  1W0J G;  1LNQ A;  2YID A;  4JI3 O;  1VQ9 V;  2E5L O;  5LP6 C;  1SER A;  3JAT A;  2OWO A;  4K35 A;  4HNA B;  2UXW A;  1QCE A;  2WAM A;  2EBO A;  5M4M A;  2R02 A;  2RMK B;  2ZD9 A;  4FM2 A;  4LFB O;  1X91 A;  1R6K A;  4J9Z B;  1NJI W;  4JI0 B;  5B5W A;  1NKD A;  1SS3 A;  5KA6 A;  4FF2 A;  5L3G A;  4L1F A;  4UB6 Z;  1GN6 A;  3CSX A;  1XFU A;  5K3H A;  2LO1 A;  4LH7 A;  3EFF K;  1PI1 A;  3ZJZ A;  2GUZ A; 
#chains in the Genus database with same CATH homology
 4FF3 A;  2FP2 A;  3Q22 A;  3KML A;  1Y79 1;  3C46 A;  1KA4 A;  5GJW E;  1LVC A;  4PUT A;  3Q0A A;  5E3X A;  1PK0 A;  2EC5 A;  1XFY A;  4HKR A;  3CE2 A;  4AKH A;  1SC5 A;  2EBF X;  2GBB A;  4FF4 A;  3Q23 A;  1K93 A;  2H1J A;  5L43 A;  3C3L A;  1K90 A;  3VKG A;  4FF1 A;  2LFW A;  2YGW A;  4AKG A;  3AHO A;  1RP3 A;  3C2P A;  4FZ4 A;  4KSA A;  3SKS A;  2AZE A;  1XFV A;  1XFZ A;  4P79 A;  3AHN A;  4KSF A;  4F0X A;  2H1N A;  2AO2 A;  2VF1 A;  2EBH X;  4AKI A;  4HKS A;  1K9X A;  3VKH A;  4QIC A;  3HOA A;  1XFW A;  1XFX A;  5GJV E;  5L44 A;  4KS9 A;  4G97 A;  1Y0V A;  3Q24 A;  3DWC A;  4KA8 A;  1SK6 A;  2FP1 A;  1S26 A;  3HQ2 A;  4KA7 A;  3X29 A;  2QR4 A;  4FF2 A;  3AHM A;  3N0R A;  1K8T A;  1XFU A;  2PO4 A;  4AI6 A;  2F6L A;  1KA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...