3CE2A

Crystal structure of putative peptidase from chlamydophila abortus
Total Genus 244
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
244
sequence length
600
structure length
595
Chain Sequence
QVRPRSEISPQDCWDITPLYLNRKAWKADLDSFGLKSPTWPALQATQYQLDNSESLLSLLTTLFSIERKLNKLYVYAHLTHDQDITNQEGIADLKSITHLHTLFAEETSWVQPALTSLSESLIAQHLSAPCLAPYRFYLEKIFRLSIHTGTPGEEKILASAFTPLEVASKAFSSLSDSEIPFGQATDSEGNSHPLSHALASLYMQSTDRELRKTSYLAQCERYHSYRHTFANLLNGKIQAHVFYAKNKRYNSCLQAALYHNNIPTTVYTNLIDIVKKNSSLITKYFSIKQRCLNLKDFHFYDVYAPLSQEKKYTFQEAVDLIYTSLSPLGTEYIDTLKQGLTTQGWVDKYENLNKRSGAYSSGCYDSHPYVLLNYTGTLYDVSVIAHEGGHSMHSYFSRKHQPFHDAQYPIFLAEIASTLNEMLLMDSMLKESDSKEEKITILTRCLDTIFSTLFRQVLFASFEYDIHHAAEHGVPLTEEYLSSTYKNLQNEFYGEIITFDVLSNIEWARIPHFYYNFYVYQYATGIIAALCFLEKILNNEDNALNSYLNFLKSGGSDFPLEILKKSGLDMGTVEPIQKAFCFIEKKIQELSSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of putative peptidase from Chlamydophila abortus.
rcsb
source organism Chlamydophila abortus
molecule tags Structural genomics, unknown function
molecule keywords Putative peptidase
total genus 244
structure length 595
sequence length 600
ec nomenclature
pdb deposition date 2008-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01432 Peptidase_M3 Peptidase family M3
A PF08439 Peptidase_M3_N Oligopeptidase F
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.830 Mainly Alpha Orthogonal Bundle Helix Hairpins putative peptidase helix hairpin domain like 3ce2A02
1.10.1370.20 Mainly Alpha Orthogonal Bundle Neurolysin; domain 3 Neurolysin; domain 3 3ce2A03
1.20.140.70 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Butyryl-CoA Dehydrogenase, subunit A; domain 3 3ce2A01
2QR4A 3CE2A
chains in the Genus database with same CATH superfamily
3G6EV 4KHPB 1SERA 4WFBV 1K73W 2H1JA 2JS3A 2XS8A 2YSUB 4YHHB 4E01A 2LW1A 1S72V 3FCJA 1Q90D 5BRKA 1DLBA 4O4JA 3OGCC 2ZXWB 2R03A 2ZD9A 2XOKG 5J9PC 4OX9O 4JAAA 1OJHA 5LA6A 3K5MA 4X28A 3X0XA 2P5OA 4IGGA 4X1KB 2ODMA 3W7SA 1IBLO 1XNQB 4DR4B 4PA6A 2DYRC 1XQ8A 1R2JA 1RJ1A 2BTOA 4DV6O 5EBLC 1N32B 3ASOB 4L1FA 2HVKC 4W9UA 4U3JA 1NI8A 1AI6A 3WU2Z 2NN4A 1Y74B 4O4LA 4L87A 4X88A 2N04A 4DV3O 1WPXA 1FFXA 2IJIA 4JAUA 3DXRA 4Q4UA 5LL6Y 4X9QA 4X66O 3ASNC 2YXHA 3AFFA 2VQEO 2UUCB 3S7WA 5JCOC 1J95A 1Y791 1YDXA 4BW5A 5J6AA 3EOMA 3QO5A 4UVCA 3GWOA 4MTOA 2ZQMA 5KAIZ 4JYBA 1RJ4A 4CH4A 1SZXA 1N34B 4GKKO 3CRAA 3GWKC 2NLJC 3CC7V 1W59A 2FB5A 2ZE6A 4X1KA 3LUTB 2KQXA 2Y69B 3U0ZA 1VQ4V 2FTKA 4RWUA 1ZLZA 1AI5A 3D3QA 1N34O 2CJ5A 4YXWG 5LMUO 3CSXA 4LF8B 3MHHC 5AG2A 1SA0A 1AR4A 3I56V 3E8FA 2Q0OC 1Y8OA 1P4RA 1Y67A 2JJ2G 3D2RA 1NKDA 2K9PA 2YI8A 2CE4A 1FXVA 3KCXA 5A9GA 2EC5A 2Q73A 2ADPA 4Q6GA 5J2TB 4L38A 3JALB 2WPDG 2OYQA 2YC0A 2E0AA 2Y0IA 4RM7A 2EX3A 2Q69A 3OR7C 2R72A 5BMVB 1F4NA 1AR1B 4F4LA 5JJJB 2VQFB 5LMNB 3E8BA 3ZRWB 3MAQA 2ZDIA 3FFQA 4BWAA 3SPCA 1SQVH 4N23A 4DR4O 4FF3A 1VQMV 1MOFA 3TZ2A 2Q67A 4H0LB 4J80A 1Q86W 2UUAB 1AP5A 2UU9O 3CS5A 4LF4B 2CTRA 2LP7A 4XDJA 4OX9B 3E22B 3BNHA 4BR6A 1K90A 1NJIW 3G71V 2W6JG 4TV9B 1MZEA 4LF7O 3G80A 5CA3A 2N05A 4CS3A 5EIBD 1SQBH 1R1BA 4PDRA 4JI4O 4GZRB 3E89A 2BU6A 1KQSU 2IH3C 3TGUH 1SQFA 4LF9B 3P32A 4P9PA 2WLMA 3BNJA 1XFYA 3VQVA 1XFXA 2UXXA 1M56B 3CPWU 4X1IB 3KMLA 4CS2A 1NH2D 5BRMA 4JI1O 4LFCB 5K3IA 5JH7A 3ABMB 3AHMA 2P06A 3SPIA 4WFFA 4JI8B 1DTOA 1WP7A 3CX5F 1H2KA 3ZMSA 3MPIA 4I9QA 1CEZA 4U83A 4LH7A 4MS2A 4WBNB 3SYCA 2OCHA 3OWMA 4IYHA 2FL4A 1Q81W 2JK5C 3D9EA 3CCQV 2ETNA 1IBKO 1I1IP 4DUZO 1BMFG 5EIBC 1K5QA 4B08A 4KCFA 1IDSA 4JV5O 3NR7A 2Q5ZA 5JVDA 4GX1A 4ZXVA 4E4EA 2XNDG 1XFWA 2F4VB 4GLXA 4B3TB 5D5QA 1IXMA 3WB0A 2JS5A 3MD0A 3ZS8C 1ENVA 1AILA 1E79G 1TVKA 3T4ZA 3F29A 1H2GA 1WAZA 4JI5O 1YJ9V 4B7EA 4EB6B 4YY3B 3VQXA 4D7SA 5EZYB 3K03A 3CC4V 2EJRA 1K5SA 1KYOF 2Q7GA 5IYDO 4ZIBA 2HHHO 2R9IA 2YYGA 2AZ0A 3CRKA 4I50B 4C7UA 1K9XA 4J41A 2BCCH 4WJYA 4KFMA 1H8HG 3Q23A 2YIBD 4IHJB 2C0UA 4NKGB 1RSOB 1VF6A 2Z3YA 4X1YB 1Z5WA 3TK1A 4G27B 3CEIA 4FF1A 3JATA 2H3OA 3CD6V 2YYIA 3N2GA 3ZIAG 5H5NA 1KC8W 4JI6B 1ZX3A 4G97A 3K9AA 5EYPA 1SIRA 1Q6UA 3E8GA 3KCYA 1NU1H 4FLUA 3CCEV 3ABUA 4I5SA 3RYHB 2CJ8A 1KA4A 4LFAO 1GTOA 1FXHA 1VQPV 4LR3A 1FFTB 2CGNA 4UB6Z 5TISZ 3O9OA 4UVBA 1BHAA 2EBFX 4GX2A 2VRZA 3AG2B 2DVLA 1TUEB 4MVMA 3D36A 4A5UB 2BU8A 3B2EE 4YJ2A 4X20A 4TSFG 3T2MA 4FFKA 1MG1A 2JEUA 5B1AC 3AEIA 1DGSA 4FK5C 1ZL8B 1XILA 4DR1O 3ZN1A 1K97A 2QR4A 3L72H 4B7KA 2X6AA 5BR8B 1Y8PA 4CZZA 4I7ZB 2CH7B 4H13B 1HNXB 3X29A 3K79A 2BTQB 4H7QA 5ITZA 4UV9A 4PI0A 1RSOA 3CCRV 1D5NA 3GB7C 1HNWB 5IYBO 3J80N 3HKEB 4Q17A 3C90A 1FPOA 4K35A 1L0LH 4UCSA 2ZR2A 2UXCO 5GTHZ 2XAHA 3AG3B 1FJGB 1V55B 3B96A 3RYCA 2VQEB 2UUCO 1N4CA 5KHIA 3RT3C 3TJTA 4LF5O 3ZRSA 5EC1C 1OCRC 1Y76B 3JAKB 1ZAUA 2Q8HA 1QLEB 1AJNA 2YDEA 2BU2A 1XHXA 1WNSA 3OUSA 2JGDA 1X91A 4FM1A 1UFIA 1IURA 4NTWA 1FXKB 2WLIA 3SYQA 4ASUG 4DYLA 4F6EA 4DV6B 3TZ5A 1US6A 5IE9A 2ZXWC 3LDCA 5LXTB 1IBLB 5IJ0B 4KUMA 4WCEV 1BUCA 1K9MW 2YUAA 1MSWD 4MPEA 3P4TA 3UO3A 1V54B 2IH1C 2O36A 2BOCC 1PNKA 3N0RA 2ZDYA 4JI0O 3BCCH 3JYCA 3E35A 1OCRB 4FXYP 1M1KW 1IS2A 5C8YA 1GKFA 1GM8A 1J5EB 1SQQH 2E80A 3DGEA 4OPHA 5HFLA 3OFNG 4LWSA 4DUYB 5L3CA 2QWPB 1KBHA 1XUQA 3ZBHA 4B3MO 3DXRB 5KX5B 2WA3A 4J9YB 2HG5C 5LOVA 2R9AA 1XMQO 3LDDA 1QVGU 4TV9A 3U10A 3MPJA 1NS1A 1YXBA 3UQ8A 3CXCU 1S77D 4UCOA 3RVYA 1HDJA 5CA1B 2G38A 1J5EO 4HKSA 4M9AA 1KECA 3K58A 4DV7O 4R8CA 1XBLA 3SPHA 4FLVA 1JJ2U 4TWKA 1RP3A 2QWQB 4LFBO 1Y0VA 1S26A 2Q6AA 2LFSA 3RN4A 1N8RW 1PNMA 4MW3A 4FF4A 1M90W 4NXMB 5C8YB 4O4JB 3WG7C 3K0DA 4BW9A 4H85A 4ZOLB 4FM2A 2VS0A 4N5FA 2FKXA 4QPKA 1QHTA 2GUZB 3K08A 5B1AB 4DR5B 3B4SA 1NR1A 2DWDC 2IJKA 2HJNA 3RYIB 1HNZB 1R3KC 1U8VA 1SESA 5ITZB 3ZX6A 3OTOO 4LCUC 2XAFA 4DZYA 4FLWA 1JFFA 2WLJA 1L1FA 3E86A 1QCEA 2ITCC 1OAHA 2IU0A 3BA9A 3GM6A 1V9PA 2M7WA 2ZIMA 4IL6Z 4L8JA 1A32A 4MPNA 4DR2B 1FS0G 4DV5B 1UPGA 1N33B 3GVMA 1XREA 1Z2GA 2LFWA 4V25A 5LHIA 3FX7A 2QTOA 3OGIB 5DN6G 1S5HC 1BZKA 4MP2A 1MA1A 2A3QA 1NT2B 4FZ4A 1MNGA 4I55A 1S76D 5LGTA 1XFZA 3R7KA 5BR8O 1G4YB 1I08A 4JI2O 4JYYA 1JOYA 4AKIA 2BTQA 3LSUA 5L3GA 2PZSA 2JBTA 4FLYA 1NH2B 2RMKB 1JJOA 1KU9A 2FMLA 2CH7A 3JD4A 3R65A 4I50A 1UDYA 5K1XA 2HLDG 4K0KO 1GM9A 4KXRA 4MTFA 2H1NA 3BVOA 2QM4A 4I0XB 5KHHA 3ETEA 2JIZG 3OMNB 2EBAA 4W4KA 2EIKB 3FB5C 3CRRA 3TXQA 4LFAB 2V7QG 2Y48A 1Y66A 4NXNB 4JPRA 2VF1A 3LG1A 3ZEDA 4UCTA 2F4VO 4DV5O 2RCVA 1FKAO 1EN6A 4AI8A 3QNEA 1VQ7V 5JQGB 2CTWA 2WA4A 2Y4UA 2PY5A 4DR6B 4J42A 1HR0B 1YJNV 5KUMA 4DV0O 4ABMA 2YIDA 1NTMH 2H94A 2P4KA 5EBWC 5H6RA 1AROP 4X89A 3ABKC 1PL4A 2ARHA 4JI3O 4JI5B 2CTQA 4X1YA 2YIAA 1YVWA 4DV1O 3BHPA 4O4LB 2CTPA 4PUTA 5B5WA 1PV0A 1BHBA 3ZMUA 2FP1A 2A7WA 4DV4O 4D7TA 4K8XA 1AJQA 1W0JG 2UXBB 2Q8GA 2BSKA 4LFCO 5E1AC 5JQGA 1XG2B 3ASNB 4NXMO 2XT9A 5CMUA 5K3HA 4LF9O 1WB7A 1Q3EA 1EGCA 3UU9A 1QQCA 3CRMA 3D9DA 3ABLC 2NR5A 1L0NH 5JVDB 3SJQC 2Q7EA 2DQ3A 4Q5CA 2DN9A 2GDSA 5LYJB 5FL7G 3MXLA 2WWWA 3D1IA 4CS4A 4KA8A 1K3EA 4ZHQA 1FD9A 1HR0O 1OCZB 2UUAO 4L3YA 1EN5A 4DR6O 4U7OA 5GW7A 2OIEA 3E2EA 3D9GA 4GKJO 1WS9A 1VP7A 4JI1B 4B3MB 2E75B 2ZM6B 1GK9A 2Y69C 4G28B 4HAMA 2ADQB 4PJ0Z 4PV1B 3CP1A 3SDLA 3A0RA 1XMOB 1K93A 2HKOA 2J7AA 5GJWE 4DW1A 3I5DA 2QWNB 1SC5A 3STLC 3AG1C 1NVPB 3L75H 4LF7B 4JIZA 3JALA 2UUBB 5J2TA 1XL4A 1GMGA 3SYAA 1YTFB 2IW5A 2QKCA 3X2QB 3AK1A 4JEKA 1PNLA 4MVUA 4MPCA 1LUVA 3SPJA 2PGGA 3M99B 2PF4E 3F7VC 3C3SA 3H1HH 5LMUB 1M9NA 1KD1W 3CCJV 3C3LA 3L1TA 3FB7C 3CE2A 5CBGA 1YTFD 3K9SA 5L44A 2JIFA 3SR2C 1SQGA 1S4BP 4G5EA 2OT5A 4LBEC 1QNMA 1VIBA 3E83A 3VQWA 4PD4F 1WP8A 4IHJA 3RYIA 3CRQA 1IXBA 1TAEA 3AG4C 3ETQA 2AHZA 1BS3A 4PA4A 1B04A 1F23A 3AG7A 4DR2O 2QWOB 3SJAC 2Y4TA 2AXTZ 1SQPH 1FXKC 2DQ0A 2YYLA 1B6QA 4LF8O 3BNFA 4MP7A 2ZE5A 2HVJC 1W07A 3AHNA 2P90A 1X8ZA 1S3JA 2DOSA 5A2QN 3G6BA 3PJSK 3OTOB 4RQFA 2BOBC 1COWG 3ZHRA 1R6TA 1SS3A 1SA0B 1K8AW 5H9CA 5B5VA 4LP8A 2E81A 3ABKB 2YS8A 3ZN0A 3K04A 3D9FA 5GJVE 2YGWA 2ZKOA 2WSSG 3L73H 3LSQA 2QTSA 2XAQA 3QF7A 1IZ3A 3HWCA 1K34A 2PYJA 4QJFB 5JWPA 1SC5B 1B06A 4QPJA 2CJ7A 2EIMB 4FMTA 4RAIA 4I0XA 3OMIB 5LP6A 1R3JC 1T9GA 5IT9N 1P84F 1AVMA 2CAZC 2W0XA 3ZHSA 1YCIA 3FAVB 4XDLA 4X65B 2M6YA 3HKDB 4X28C 2ZINA 4FVMA 2ZE8A 2UUBO 2ZIOA 1IVHA 2YI9A 3ASOC 1OZ0A 2ZT9B 2NNUA 3QO7A 3TZ0A 4PDVA 2DYRB 3W7XA 4FFBB 2F43G 4CH3A 2JBRA 4NB5A 4FM0A 3ZHTA 1VQLV 2ATKC 2A0LA 2L35A 3TXSA 2PNRA 2ZM6O 3M8AA 2CJ4A 1FFXB 2F23A 3E8HA 3B40A 2YYMA 3JASA 3UKMA 1GU6A 4R50A 1YIJV 3NF4A 2LFRA 3ZRXA 1Q43A 4DUYO 2WLNA 5IJ9B 2QWRB 3CMAV 1THZA 1Q82W 1JPXA 2DE0X 3MDSA 3O65A 4PA9A 2JGDB 1KP2A 3JSLA 1SZTA 3Q24A 2JDIG 2BSKB 3M9VA 2ZDXA 1G8MA 4WF9V 3RYHA 2QA4V 1VQKV 4KHPO 4JTDB 5L43A 3EONA 1F7YA 1H8EG 2LQTA 3GNCA 4LC1A 1SF9A 1QU7A 5FPOA 1WPBA 4CC6A 4FF2A 1CXZB 2EZPA 4GKJB 3SGIA 3D6BA 2L6LA 2Q0AA 1OHHG 1R6KA 4PA3A 2AHYA 3DTUB 4UB8Z 2F66C 2F95B 1ZSPA 2CUGA 4RO2A 3THOA 1JQIA 3J7AU 2ZO5A 1R3BA 3AHOA 1TA8A 5B1BC 1S5LZ 1AJPA 5EK0A 2UXNA 1ZUQA 3IC9A 4PELA 4FZ1A 4JI3B 3ZHVA 1LUWA 1XDCA 3LNMB 3P3PA 3RFRA 4CH5A 4JYAB 2VR0A 3F5WC 4NR1A 3HKDA 3CCUV 4O4IB 4P9OA 4O2BA 5KHGA 4JI8O 2Q8IA 4J1VA 1RP3B 4AKHA 4KL1A 1GKXA 1H38A 1Q8IA 1RPRA 3OMAB 4OGQB 3IFXA 5JCOA 1GRJA 4O4HA 4JTAB 2WBIA 1BT8A 5KUKA 1H2SB 3BPZA 3HKBA 3JD3A 5CB4B 1RFYA 2PTMA 4EFEA 3M7MX 5M4KA 2UXDO 1HNXO 2EBHX 4DXWA 4LWSB 3H9VA 1R73A 3RW0A 5GTIZ 1Z5VA 2ZKJA 2O57A 3T1HO 4J11A 2IU3A 1EN4A 2YYKA 4DV0B 3H1JH 3SXQA 4DOYA 1AI4A 1WB8A 2BU7A 3BY6A 4K8ZA 3UT5B 2XS1A 3UO2A 2Q8FA 1LNQA 3K5LA 2ZAFA 1IX9A 3Q4HA 3FAVA 4K3AA 4U3JB 1YSCA 2VQFO 5LMNO 3STZC 5LP6B 2OEVA 1K8TA 1ZTEA 3N27A 4WFAV 5L3BA 2QKAA 1GN4A 2B9ZA 1M57C 4K0KB 5F2VO 3B77A 5EBMC 4JI6O 1KUQA 4B3SB 1JMKC 4NVPA 5B1BB 2FYUH 2LJ2A 4O2AB 4GUNA 1GO3F 2LGWA 3B8MA 3JAWB 1R3IC 2OTJV 4XBFA 4JI2B 1QBZA 5H6QA 3VADA 4WFGA 3T1HB 3N2KB 2HHHB 2C12A 4AQYO 2F93B 2WLLA 4JZ2A 2GBOA 2GV9A 4YY3O 3A8TA 2HR3A 4IYIA 4I9WA 2XHBA 5LGUA 4TUYB 1D2DA 3UCSC 3OWAA 2XASA 3J81N 4JIOA 1XNRO 2EIJC 5IDJA 3KG2A 4NTXA 1K7DA 4HZ3A 5L3FA 1HW7A 4P79A 4X64B 2RDZA 1HP8A 4H44B 4GYCB 2PYLA 2E74B 3I55V 4JV5B 1XFVA 4X1IA 3DC6A 2EULA 3D8CA 2AW9A 2QJ1A 4ZHQB 3ABMC 4J7KA 5M4PA 3L71H 2R0MA 3HQ2A 4JZGA 2YXYA 4X66B 4LFBB 3ABTA 4QE9A 2IX5A 3UBRA 5K3JA 3APQA 4DV7B 1P7BA 2DWEC 2VWJA 1DF4A 1OCOC 4WFHA 2IBZH 4BIZA 1I94B 3CMEV 2AZ2A 3E22A 4XVXA 3HPLC 3H1IH 4IV6A 3ZCCA 1Q7YW 4OPAA 5LP6C 4JF3A 1XMQB 1UKWA 4F0XA 2AGAA 3UT5A 4NTYA 2Q8VA 1VQ6V 1MABG 2YICA 1H2NA 4PDMA 3K5NA 4ZBMA 2OCCB 5J2UB 2YEVB 1VMGA 3W7WA 2EILB 3EVKA 1W2BU 3OEHG 1BE3H 4TV8A 1I7FA 1OCOB 5CB4A 2Q68A 4DR3B 2DDHA 2Y0PA 1PKXA 4Q1OA 1G6UA 3N2KA 1KP3A 1EGDA 2E5LO 5LYJA 4E00A 3FD9A 2OR0A 3L74H 1UJWB 4EFBA 3QO8A 4O2AA 3ZHQA 4DR7O 5K3GA 2EJ7A 3PN1A 4PHZA 3QVNA 2OCCC 2HJFC 1JA8A 1O9HA 4P13A 2Q7HA 2K1EA 2FONA 4O4IA 4XDKA 2X7RB 5DECA 4MVQA 4IIJA 5KHJA 3OIBA 1MZFA 3IGAC 4EEQA 4GCZA 3UM7A 1PM9A 4LNUB 5E79Z 1X90A 4ZYJA 3BAAA 4R7CA 3CB2A 1E1QG 4D6TH 4OXSA 3K59A 2DYSC 4CH6A 4JI0B 1EGEA 1FJGO 2OJQA 5KMGA 3CCMV 2XUMA 2UXCB 3AFEA 3K0GA 2IJJA 4I4TB 1OCCC 4GX5A 2QKSA 4J9ZB 2EIKC 3JSNA 1TGOA 3T1YO 1HNWO 3X2QC 3A0BZ 4ZKIA 3R66A 1FXKA 2WLIB 2EINC 3WB1A 2R0NA 2YEVA 1AR5A 2EIMC 1BQZA 2JVDA 1SETA 3A2FA 1IBMO 1EFRG 4RQEA 3CC2V 3LGQA 4FLZA 1D5AA 1Y74A 2ITDC 3RYFB 4KSFA 3IAYA 3BNGA 2A1TA 2JJ1G 2R02A 5BXZA 1X4TA 4DR1B 4P30A 3WG7B 2E76B 3MKHA 4DO2A 3DC5A 4B3SO 3BEHA 3VKHA 1BSMA 2ZR3A 4PDLA 2P4VA 5EYPB 2D2CB 4BIUA 3Q0AA 4FFBA 1F51A 2PI5A 4H33A 2V4DA 3L70H 2QSAA 1VQNV 1V55C 1XFUA 1FS9A 2RNBA 4UV8A 2HP8A 3ZRWA 4R6ZA 5KHKA 1QLEC 5KAFZ 1N32O 1AB3A 1AI7A 1PD3A 1OV9A 1ZL8A 4Z1VA 4CBCA 1XNQO 2F6LA 5IWAO 4AI6A 2R70A 5GONA 4FLTA 4YJ2B 4U3FH 2WLLB 3P3NA 4MTXA 2RQ6A 5FLXN 4TOIA 5K1PA 3MHSC 4G2KA 1XOUA 3RYFA 3LDEA 2JRIA 1TUBA 3SF6A 3MMOA 5D5PA 5B66Z 3P30A 3JAWA 4MW8A 1JQ0A 2FP2A 2GTAA 3CRLA 1M4UA 1QVFU 2DMXA 1F4MA 3K3WA 4UCVA 1BGYH 4B3TO 5B5EZ 4IT5A 1XEQA 2QDOA 3RVZA 2P6JA 5LOVB 1E1RG 4NYKA 5JJNB 1NR7A 3BRCA 3OM3B 1N0JA 3C2PA 2IM9A 3ZMVA 3HB3B 4YJ3B 4DUZB 2CK3G 2ZNIA 1YZBA 3H1LH 1H2MA 1O9GA 5FPRA 4JYAO 1WJZA 1NTKH 4ZI7A 1VQ9V 3IJ4A 3G4SV 3CJHA 1Y8NA 2XTAA 5CBHA 1U97A 1K92A 4ZI7B 2X6BA 1N36O 4J7JA 3VKGA 2EBOA 3X0YA 4X62B 3EHBB 3SJCC 1RM1C 2PO4A 2XQRB 4HNAA 4FJCC 3B8NA 2XAJA 1BL8A 1XL6A 2CJ6A 4LH6A 2OWOA 2QGNA 3FYIB 5IJ0A 5FNVA 2UXBO 1NVPD 3BFRA 3FO3A 3APOA 1K33A 3PFDA 4JAVA 3TZ4A 4PI2A 1GN3A 4JI7O 1FS8A 1FAFA 5DM6V 1EBOA 1GH6A 2ZCEA 5CA0A 4AHCA 4JI4B 3ZMZA 2AZEA 4H37A 5FNVB 5KX5A 1PK0A 1S0VA 3FB8C 4HYOA 1Y76A 5LA6B 3RWRD 3CCLV 2VWKA 4HBNA 1U96A 3RYCB 3AG2C 1QDBA 3CCSV 4I55B 2YXLA 3LSSA 2UU9B 4LF4O 5LHGA 1EZJA 4Q5BA 3HKCA 3OW2U 2MW2B 2B1GA 1EM1A 1LR1A 5IWAB 4UUJC 3T1CA 1HWYA 1JR9A 5IYCO 2V1DA 1M57B 4UVAA 3CJHB 1PI1A 3D3IA 1I0HA 5JJEB 4KS9A 2C2AA 3FYEB 2LW7A 3OUFA 5HFMA 3F7YC 4NXNO 1YITV 4L3ZA 2UXWA 4FPPA 5LXTA 3CWBH 2GTSA 4NXLA 4E2LA 1VF5B 5BY1A 4X65O 2BTZA 4DK1A 2XAGA 4LF6B 2GHYA 2EIJB 1ROPA 2YYJA 4MVSA 4MVOA 4KA7A 3JD2A 4W4LA 2BU5A 3H01A 2EINB 1V54C 2N74A 3GQTA 3JAKA 1IVSA 5KLVH 3S3WA 1WA8B 1RM1B 3SJBC 3II9A 1W0KG 1SIQA 5IJ9A 4OO2A 3FB6C 2D3OW 1PP9H 1XHZA 4H81A 2GBBA 3VQYA 4DV2O 1GAXA 1JCHA 3HKCB 3ML0A 4P2ZA 1QR8A 1CPYA 4X8AA 1R3LC 5KA5A 2JEXA 1S5JA 4AKGA 2RFQA 1KMIZ 1VARA 1PL0A 3K5OA 1Y6XA 2RDCA 5CA0B 4I4TA 4HR3A 1P7GA 4TQDA 5CA1A 5KA6A 4JYCA 2REHA 1CP9A 3TETA 3CCVV 2F1MA 3T4DA 4DV2B 3IC7A 2P7TC 1GKZA 1IBMB 2YIBA 1NZ6A 2WAMA 3B09A 4DW0A 5IYZA 1OCCB 1BCCH 4O2BB 5L3DA 4GKKB 3Q4HB 2CDYA 3OTFA 5IY5B 3T1YB 4BAYA 2ILMA 2B5UA 1KB9F 5CBFA 4JGSA 3AG1B 1JM6A 3TORA 3ZRVA 3DSQA 4LF6O 4UCUA 4JASA 1EZVH 1Q6IA 3EXAA 4DR3O 1GM7A 5B3SC 5L3EA 4TT3G 1DK1A 3OT7A 4TV8B 4YHHO 2IJHA 3CHXA 4DV3B 3RKHA 4KTOA 4EKWA 2ZDIC 3HR0A 1BQ0A 1YEWA 3AK3A 1XMOO 2H8PC 4FIPC 5J2UA 4U7NA 1RPOA 1URFA 5EZYA 3OE7G 2BE3A 1QR9A 2GSMB 1TVKB 4J10A 3ETGA 1OCZC 2Q4PA 2E5LB 4KP4A 2AO2A 2Q9LA 4QE7A 3BA8A 1YJWV 2E3CA 2A9HA 4MTGA 1Q6HA 3CRCA 5GONB 3FKSG 1T5EA 2KG7B 2X6CA 1YI2V 3HKEA 2VIGA 2LGQA 1Q5OA 2EILC 3VBBA 3TTBA 5DEDA 1VF7A 3ETDA 2QE7G 4JI7B 4QNHB 2QEXV 3OEEG 3S3XA 5LBQA 2GUZA 2RN9A 4Z1MG 4Q0TA 4RUEA 4ZOLA 1JVMA 1SQXH 1H2LA 3HOAA 4YIOA 1M93A 2R9RB 4DV4B 1QLNA 4X62O 2LO1A 1DF5A 5E3XA 5IY5C 1JX9A 1I94O 1NTZH 1XNRB 2KSDA 3JARB 5M4MA 5BMVA 4DV1B 4MVZA 2Z5UA 4HKRA 3C46A 4F6RB 1RX0A 2ZE7A 4LF5B 2OTLV 1ORQC 2Z1QA 2ZNJA 4AQYB 4QICA 1WA8A 1WLEA 2DJVA 2WLKA 1WN7A 1K4CC 3A0HZ 5B3SB 3JASB 1ZWIC 1N0NA 3RGBA 4DRXA 4QIWF 2R05A 4FLXA 3WB2A 2KG7A 5BZBA 1B3QA 4MT8A 4B3RB 2PG0A 4X64O 4HNAB 1VQ5V 1YF2A 3OD4A 1NBMG 2W0FC 4E02A 3F5TA 3NXSA 2A06H 2PI4A 4WFEA 5J71A 2JGUA 1LVCA 1GN2A 1VQ8V 2D29A 3SCEA 2HJDA 3OAAG 3SPGA 4MVRA 1GJVA 2KKWA 3SKSA 4TQFA 3SWOA 2X0LA 1M5IA 4GT1A 1MMMA 4EB6A 4TUYA 4LNUA 4ICGA 3AK2A 5LHHA 3JCZA 4IIJB 1M56C 3TCUA 5LGNA 5EC2C 2O3EA 1VF6C 4PA7A 1KA2A 3C3TA 3WFVA 1P49A 5B6BA 1XI1A 2OEXA 3ZJZA 4QGPA 5M4NA 4IRNA 4BIOA 1TUBB 1X59A 3QTCA 4FZ0A 3HKBB 3W7TA 1VQOV 4O5MA 4J7ZA 4UFZA 4O4HB 3JD1A 1N33O 4B3RO 5IYZB 1L8DA 5H2FZ 5B1NA 3SYPA 3AG3C 1KKDA 4Q20A 3W7UA 1K4DC 1NQTA 4WBNA 4GX0A 2PUSA 4DK0A 3KZIZ 3EFFK 5CN0A 3JARA 3QG5A 1AP6A 1FYJA 2QM8A 4MSWC 3SYOA 3JAMN 2CGOA 3MDEA 3ABLB 2HFEC 3D36C 2UXDB 5JH7B 2OIGA 2RJZA 2DW4A 1Y4MA 1HNZO 4L3XA 3RBZA 3VOUA 2B1IA 4DR5O 4UCRA 4KSAA 4UXNA 2P22C 4YJ3A 4LQQB 1SK6A 3ICXA 2WLHA 5C93A 1YHQV 4LQSB 1MSDA 3G67A 3K06A 4DRXB 3DWCA 2CX9A 4X20B 3AG4B 1G1XB 2DYSB 1VEWA 2Z0AA 3L9DA 4RUFA 1R6NA 1IBKB 3CYOA 3BABA 1N36B 3ZHUA 5B1OA 4Z2WA 2QM7A 1I5YA 3OR6C 4F6RA 1SRYA 1KKCA 3LNNA 4N21A 3U11A 1FS7A 4V26A 4YIPA 2KB1A 3KKYA 2HEPA 1SKVA 2RF7A 1JFFB 3JCUZ 3N2GB 3JATB 3JD0A 3K57A 2EZOA 4DR7B 2OT4A 2P67A 3CXHF 4CC5A 2IX6A 3Q22A 2A79B 1I5XA 4AILC 2MK3A 4JTCB 3ZMTA 3MDDA 2JBSA 1PPJH 3H1KH 5KMGB 2W6IG 1GN6A
chains in the Genus database with same CATH topology
4P79A 3AHOA 3C3LA 5L43A 2AO2A 3VKGA 3CE2A 3DWCA 4KS9A 1K8TA 2GBBA 2H1JA 2PO4A 5L44A 1Y791 2AZEA 5GJVE 1PK0A 3C2PA 2YGWA 4PUTA 1RP3A 2EC5A 4QICA 4FF3A 1KA4A 2H1NA 4KA7A 3HOAA 1XFVA 4FZ4A 1Y0VA 2FP1A 5GJWE 1S26A 2QR4A 1XFWA 3AHNA 1K9XA 1LVCA 1XFYA 2FP2A 1XFZA 1XFXA 3N0RA 4FF2A 3VKHA 2F6LA 3Q23A 1KA2A 4KSAA 4F0XA 2EBFX 3Q22A 3KMLA 4AI6A 1SK6A 4FF4A 1K90A 5E3XA 3Q0AA 1K93A 4KSFA 4AKIA 3AHMA 2EBHX 3HQ2A 4FF1A 4AKGA 3X29A 3SKSA 3Q24A 4AKHA 2LFWA 4KA8A 4G97A 1XFUA 2VF1A 1SC5A 4HKRA 4HKSA 3C46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QR4 A;  3CE2 A; 
#chains in the Genus database with same CATH topology
 3G6E V;  4KHP B;  1SER A;  4WFB V;  1K73 W;  2H1J A;  2JS3 A;  2XS8 A;  2YSU B;  4YHH B;  4E01 A;  2LW1 A;  1S72 V;  3FCJ A;  1Q90 D;  5BRK A;  1DLB A;  4O4J A;  3OGC C;  2ZXW B;  2R03 A;  2ZD9 A;  2XOK G;  5J9P C;  4OX9 O;  4JAA A;  1OJH A;  5LA6 A;  3K5M A;  4X28 A;  3X0X A;  2P5O A;  4IGG A;  4X1K B;  2ODM A;  3W7S A;  1IBL O;  1XNQ B;  4DR4 B;  4PA6 A;  2DYR C;  1XQ8 A;  1R2J A;  1RJ1 A;  2BTO A;  4DV6 O;  5EBL C;  1N32 B;  3ASO B;  4L1F A;  2HVK C;  4W9U A;  4U3J A;  1NI8 A;  1AI6 A;  3WU2 Z;  2NN4 A;  1Y74 B;  4O4L A;  4L87 A;  4X88 A;  2N04 A;  4DV3 O;  1WPX A;  1FFX A;  2IJI A;  4JAU A;  3DXR A;  4Q4U A;  5LL6 Y;  4X9Q A;  4X66 O;  3ASN C;  2YXH A;  3AFF A;  2VQE O;  2UUC B;  3S7W A;  5JCO C;  1J95 A;  1Y79 1;  1YDX A;  4BW5 A;  5J6A A;  3EOM A;  3QO5 A;  4UVC A;  3GWO A;  4MTO A;  2ZQM A;  5KAI Z;  4JYB A;  1RJ4 A;  4CH4 A;  1SZX A;  1N34 B;  4GKK O;  3CRA A;  3GWK C;  2NLJ C;  3CC7 V;  1W59 A;  2FB5 A;  2ZE6 A;  4X1K A;  3LUT B;  2KQX A;  2Y69 B;  3U0Z A;  1VQ4 V;  2FTK A;  4RWU A;  1ZLZ A;  1AI5 A;  3D3Q A;  1N34 O;  2CJ5 A;  4YXW G;  5LMU O;  3CSX A;  4LF8 B;  3MHH C;  5AG2 A;  1SA0 A;  1AR4 A;  3I56 V;  3E8F A;  2Q0O C;  1Y8O A;  1P4R A;  1Y67 A;  2JJ2 G;  3D2R A;  1NKD A;  2K9P A;  2YI8 A;  2CE4 A;  1FXV A;  3KCX A;  5A9G A;  2EC5 A;  2Q73 A;  2ADP A;  4Q6G A;  5J2T B;  4L38 A;  3JAL B;  2WPD G;  2OYQ A;  2YC0 A;  2E0A A;  2Y0I A;  4RM7 A;  2EX3 A;  2Q69 A;  3OR7 C;  2R72 A;  5BMV B;  1F4N A;  1AR1 B;  4F4L A;  5JJJ B;  2VQF B;  5LMN B;  3E8B A;  3ZRW B;  3MAQ A;  2ZDI A;  3FFQ A;  4BWA A;  3SPC A;  1SQV H;  4N23 A;  4DR4 O;  4FF3 A;  1VQM V;  1MOF A;  3TZ2 A;  2Q67 A;  4H0L B;  4J80 A;  1Q86 W;  2UUA B;  1AP5 A;  2UU9 O;  3CS5 A;  4LF4 B;  2CTR A;  2LP7 A;  4XDJ A;  4OX9 B;  3E22 B;  3BNH A;  4BR6 A;  1K90 A;  1NJI W;  3G71 V;  2W6J G;  4TV9 B;  1MZE A;  4LF7 O;  3G80 A;  5CA3 A;  2N05 A;  4CS3 A;  5EIB D;  1SQB H;  1R1B A;  4PDR A;  4JI4 O;  4GZR B;  3E89 A;  2BU6 A;  1KQS U;  2IH3 C;  3TGU H;  1SQF A;  4LF9 B;  3P32 A;  4P9P A;  2WLM A;  3BNJ A;  1XFY A;  3VQV A;  1XFX A;  2UXX A;  1M56 B;  3CPW U;  4X1I B;  3KML A;  4CS2 A;  1NH2 D;  5BRM A;  4JI1 O;  4LFC B;  5K3I A;  5JH7 A;  3ABM B;  3AHM A;  2P06 A;  3SPI A;  4WFF A;  4JI8 B;  1DTO A;  1WP7 A;  3CX5 F;  1H2K A;  3ZMS A;  3MPI A;  4I9Q A;  1CEZ A;  4U83 A;  4LH7 A;  4MS2 A;  4WBN B;  3SYC A;  2OCH A;  3OWM A;  4IYH A;  2FL4 A;  1Q81 W;  2JK5 C;  3D9E A;  3CCQ V;  2ETN A;  1IBK O;  1I1I P;  4DUZ O;  1BMF G;  5EIB C;  1K5Q A;  4B08 A;  4KCF A;  1IDS A;  4JV5 O;  3NR7 A;  2Q5Z A;  5JVD A;  4GX1 A;  4ZXV A;  4E4E A;  2XND G;  1XFW A;  2F4V B;  4GLX A;  4B3T B;  5D5Q A;  1IXM A;  3WB0 A;  2JS5 A;  3MD0 A;  3ZS8 C;  1ENV A;  1AIL A;  1E79 G;  1TVK A;  3T4Z A;  3F29 A;  1H2G A;  1WAZ A;  4JI5 O;  1YJ9 V;  4B7E A;  4EB6 B;  4YY3 B;  3VQX A;  4D7S A;  5EZY B;  3K03 A;  3CC4 V;  2EJR A;  1K5S A;  1KYO F;  2Q7G A;  5IYD O;  4ZIB A;  2HHH O;  2R9I A;  2YYG A;  2AZ0 A;  3CRK A;  4I50 B;  4C7U A;  1K9X A;  4J41 A;  2BCC H;  4WJY A;  4KFM A;  1H8H G;  3Q23 A;  2YIB D;  4IHJ B;  2C0U A;  4NKG B;  1RSO B;  1VF6 A;  2Z3Y A;  4X1Y B;  1Z5W A;  3TK1 A;  4G27 B;  3CEI A;  4FF1 A;  3JAT A;  2H3O A;  3CD6 V;  2YYI A;  3N2G A;  3ZIA G;  5H5N A;  1KC8 W;  4JI6 B;  1ZX3 A;  4G97 A;  3K9A A;  5EYP A;  1SIR A;  1Q6U A;  3E8G A;  3KCY A;  1NU1 H;  4FLU A;  3CCE V;  3ABU A;  4I5S A;  3RYH B;  2CJ8 A;  1KA4 A;  4LFA O;  1GTO A;  1FXH A;  1VQP V;  4LR3 A;  1FFT B;  2CGN A;  4UB6 Z;  5TIS Z;  3O9O A;  4UVB A;  1BHA A;  2EBF X;  4GX2 A;  2VRZ A;  3AG2 B;  2DVL A;  1TUE B;  4MVM A;  3D36 A;  4A5U B;  2BU8 A;  3B2E E;  4YJ2 A;  4X20 A;  4TSF G;  3T2M A;  4FFK A;  1MG1 A;  2JEU A;  5B1A C;  3AEI A;  1DGS A;  4FK5 C;  1ZL8 B;  1XIL A;  4DR1 O;  3ZN1 A;  1K97 A;  2QR4 A;  3L72 H;  4B7K A;  2X6A A;  5BR8 B;  1Y8P A;  4CZZ A;  4I7Z B;  2CH7 B;  4H13 B;  1HNX B;  3X29 A;  3K79 A;  2BTQ B;  4H7Q A;  5ITZ A;  4UV9 A;  4PI0 A;  1RSO A;  3CCR V;  1D5N A;  3GB7 C;  1HNW B;  5IYB O;  3J80 N;  3HKE B;  4Q17 A;  3C90 A;  1FPO A;  4K35 A;  1L0L H;  4UCS A;  2ZR2 A;  2UXC O;  5GTH Z;  2XAH A;  3AG3 B;  1FJG B;  1V55 B;  3B96 A;  3RYC A;  2VQE B;  2UUC O;  1N4C A;  5KHI A;  3RT3 C;  3TJT A;  4LF5 O;  3ZRS A;  5EC1 C;  1OCR C;  1Y76 B;  3JAK B;  1ZAU A;  2Q8H A;  1QLE B;  1AJN A;  2YDE A;  2BU2 A;  1XHX A;  1WNS A;  3OUS A;  2JGD A;  1X91 A;  4FM1 A;  1UFI A;  1IUR A;  4NTW A;  1FXK B;  2WLI A;  3SYQ A;  4ASU G;  4DYL A;  4F6E A;  4DV6 B;  3TZ5 A;  1US6 A;  5IE9 A;  2ZXW C;  3LDC A;  5LXT B;  1IBL B;  5IJ0 B;  4KUM A;  4WCE V;  1BUC A;  1K9M W;  2YUA A;  1MSW D;  4MPE A;  3P4T A;  3UO3 A;  1V54 B;  2IH1 C;  2O36 A;  2BOC C;  1PNK A;  3N0R A;  2ZDY A;  4JI0 O;  3BCC H;  3JYC A;  3E35 A;  1OCR B;  4FXY P;  1M1K W;  1IS2 A;  5C8Y A;  1GKF A;  1GM8 A;  1J5E B;  1SQQ H;  2E80 A;  3DGE A;  4OPH A;  5HFL A;  3OFN G;  4LWS A;  4DUY B;  5L3C A;  2QWP B;  1KBH A;  1XUQ A;  3ZBH A;  4B3M O;  3DXR B;  5KX5 B;  2WA3 A;  4J9Y B;  2HG5 C;  5LOV A;  2R9A A;  1XMQ O;  3LDD A;  1QVG U;  4TV9 A;  3U10 A;  3MPJ A;  1NS1 A;  1YXB A;  3UQ8 A;  3CXC U;  1S77 D;  4UCO A;  3RVY A;  1HDJ A;  5CA1 B;  2G38 A;  1J5E O;  4HKS A;  4M9A A;  1KEC A;  3K58 A;  4DV7 O;  4R8C A;  1XBL A;  3SPH A;  4FLV A;  1JJ2 U;  4TWK A;  1RP3 A;  2QWQ B;  4LFB O;  1Y0V A;  1S26 A;  2Q6A A;  2LFS A;  3RN4 A;  1N8R W;  1PNM A;  4MW3 A;  4FF4 A;  1M90 W;  4NXM B;  5C8Y B;  4O4J B;  3WG7 C;  3K0D A;  4BW9 A;  4H85 A;  4ZOL B;  4FM2 A;  2VS0 A;  4N5F A;  2FKX A;  4QPK A;  1QHT A;  2GUZ B;  3K08 A;  5B1A B;  4DR5 B;  3B4S A;  1NR1 A;  2DWD C;  2IJK A;  2HJN A;  3RYI B;  1HNZ B;  1R3K C;  1U8V A;  1SES A;  5ITZ B;  3ZX6 A;  3OTO O;  4LCU C;  2XAF A;  4DZY A;  4FLW A;  1JFF A;  2WLJ A;  1L1F A;  3E86 A;  1QCE A;  2ITC C;  1OAH A;  2IU0 A;  3BA9 A;  3GM6 A;  1V9P A;  2M7W A;  2ZIM A;  4IL6 Z;  4L8J A;  1A32 A;  4MPN A;  4DR2 B;  1FS0 G;  4DV5 B;  1UPG A;  1N33 B;  3GVM A;  1XRE A;  1Z2G A;  2LFW A;  4V25 A;  5LHI A;  3FX7 A;  2QTO A;  3OGI B;  5DN6 G;  1S5H C;  1BZK A;  4MP2 A;  1MA1 A;  2A3Q A;  1NT2 B;  4FZ4 A;  1MNG A;  4I55 A;  1S76 D;  5LGT A;  1XFZ A;  3R7K A;  5BR8 O;  1G4Y B;  1I08 A;  4JI2 O;  4JYY A;  1JOY A;  4AKI A;  2BTQ A;  3LSU A;  5L3G A;  2PZS A;  2JBT A;  4FLY A;  1NH2 B;  2RMK B;  1JJO A;  1KU9 A;  2FML A;  2CH7 A;  3JD4 A;  3R65 A;  4I50 A;  1UDY A;  5K1X A;  2HLD G;  4K0K O;  1GM9 A;  4KXR A;  4MTF A;  2H1N A;  3BVO A;  2QM4 A;  4I0X B;  5KHH A;  3ETE A;  2JIZ G;  3OMN B;  2EBA A;  4W4K A;  2EIK B;  3FB5 C;  3CRR A;  3TXQ A;  4LFA B;  2V7Q G;  2Y48 A;  1Y66 A;  4NXN B;  4JPR A;  2VF1 A;  3LG1 A;  3ZED A;  4UCT A;  2F4V O;  4DV5 O;  2RCV A;  1FKA O;  1EN6 A;  4AI8 A;  3QNE A;  1VQ7 V;  5JQG B;  2CTW A;  2WA4 A;  2Y4U A;  2PY5 A;  4DR6 B;  4J42 A;  1HR0 B;  1YJN V;  5KUM A;  4DV0 O;  4ABM A;  2YID A;  1NTM H;  2H94 A;  2P4K A;  5EBW C;  5H6R A;  1ARO P;  4X89 A;  3ABK C;  1PL4 A;  2ARH A;  4JI3 O;  4JI5 B;  2CTQ A;  4X1Y A;  2YIA A;  1YVW A;  4DV1 O;  3BHP A;  4O4L B;  2CTP A;  4PUT A;  5B5W A;  1PV0 A;  1BHB A;  3ZMU A;  2FP1 A;  2A7W A;  4DV4 O;  4D7T A;  4K8X A;  1AJQ A;  1W0J G;  2UXB B;  2Q8G A;  2BSK A;  4LFC O;  5E1A C;  5JQG A;  1XG2 B;  3ASN B;  4NXM O;  2XT9 A;  5CMU A;  5K3H A;  4LF9 O;  1WB7 A;  1Q3E A;  1EGC A;  3UU9 A;  1QQC A;  3CRM A;  3D9D A;  3ABL C;  2NR5 A;  1L0N H;  5JVD B;  3SJQ C;  2Q7E A;  2DQ3 A;  4Q5C A;  2DN9 A;  2GDS A;  5LYJ B;  5FL7 G;  3MXL A;  2WWW A;  3D1I A;  4CS4 A;  4KA8 A;  1K3E A;  4ZHQ A;  1FD9 A;  1HR0 O;  1OCZ B;  2UUA O;  4L3Y A;  1EN5 A;  4DR6 O;  4U7O A;  5GW7 A;  2OIE A;  3E2E A;  3D9G A;  4GKJ O;  1WS9 A;  1VP7 A;  4JI1 B;  4B3M B;  2E75 B;  2ZM6 B;  1GK9 A;  2Y69 C;  4G28 B;  4HAM A;  2ADQ B;  4PJ0 Z;  4PV1 B;  3CP1 A;  3SDL A;  3A0R A;  1XMO B;  1K93 A;  2HKO A;  2J7A A;  5GJW E;  4DW1 A;  3I5D A;  2QWN B;  1SC5 A;  3STL C;  3AG1 C;  1NVP B;  3L75 H;  4LF7 B;  4JIZ A;  3JAL A;  2UUB B;  5J2T A;  1XL4 A;  1GMG A;  3SYA A;  1YTF B;  2IW5 A;  2QKC A;  3X2Q B;  3AK1 A;  4JEK A;  1PNL A;  4MVU A;  4MPC A;  1LUV A;  3SPJ A;  2PGG A;  3M99 B;  2PF4 E;  3F7V C;  3C3S A;  3H1H H;  5LMU B;  1M9N A;  1KD1 W;  3CCJ V;  3C3L A;  3L1T A;  3FB7 C;  3CE2 A;  5CBG A;  1YTF D;  3K9S A;  5L44 A;  2JIF A;  3SR2 C;  1SQG A;  1S4B P;  4G5E A;  2OT5 A;  4LBE C;  1QNM A;  1VIB A;  3E83 A;  3VQW A;  4PD4 F;  1WP8 A;  4IHJ A;  3RYI A;  3CRQ A;  1IXB A;  1TAE A;  3AG4 C;  3ETQ A;  2AHZ A;  1BS3 A;  4PA4 A;  1B04 A;  1F23 A;  3AG7 A;  4DR2 O;  2QWO B;  3SJA C;  2Y4T A;  2AXT Z;  1SQP H;  1FXK C;  2DQ0 A;  2YYL A;  1B6Q A;  4LF8 O;  3BNF A;  4MP7 A;  2ZE5 A;  2HVJ C;  1W07 A;  3AHN A;  2P90 A;  1X8Z A;  1S3J A;  2DOS A;  5A2Q N;  3G6B A;  3PJS K;  3OTO B;  4RQF A;  2BOB C;  1COW G;  3ZHR A;  1R6T A;  1SS3 A;  1SA0 B;  1K8A W;  5H9C A;  5B5V A;  4LP8 A;  2E81 A;  3ABK B;  2YS8 A;  3ZN0 A;  3K04 A;  3D9F A;  5GJV E;  2YGW A;  2ZKO A;  2WSS G;  3L73 H;  3LSQ A;  2QTS A;  2XAQ A;  3QF7 A;  1IZ3 A;  3HWC A;  1K34 A;  2PYJ A;  4QJF B;  5JWP A;  1SC5 B;  1B06 A;  4QPJ A;  2CJ7 A;  2EIM B;  4FMT A;  4RAI A;  4I0X A;  3OMI B;  5LP6 A;  1R3J C;  1T9G A;  5IT9 N;  1P84 F;  1AVM A;  2CAZ C;  2W0X A;  3ZHS A;  1YCI A;  3FAV B;  4XDL A;  4X65 B;  2M6Y A;  3HKD B;  4X28 C;  2ZIN A;  4FVM A;  2ZE8 A;  2UUB O;  2ZIO A;  1IVH A;  2YI9 A;  3ASO C;  1OZ0 A;  2ZT9 B;  2NNU A;  3QO7 A;  3TZ0 A;  4PDV A;  2DYR B;  3W7X A;  4FFB B;  2F43 G;  4CH3 A;  2JBR A;  4NB5 A;  4FM0 A;  3ZHT A;  1VQL V;  2ATK C;  2A0L A;  2L35 A;  3TXS A;  2PNR A;  2ZM6 O;  3M8A A;  2CJ4 A;  1FFX B;  2F23 A;  3E8H A;  3B40 A;  2YYM A;  3JAS A;  3UKM A;  1GU6 A;  4R50 A;  1YIJ V;  3NF4 A;  2LFR A;  3ZRX A;  1Q43 A;  4DUY O;  2WLN A;  5IJ9 B;  2QWR B;  3CMA V;  1THZ A;  1Q82 W;  1JPX A;  2DE0 X;  3MDS A;  3O65 A;  4PA9 A;  2JGD B;  1KP2 A;  3JSL A;  1SZT A;  3Q24 A;  2JDI G;  2BSK B;  3M9V A;  2ZDX A;  1G8M A;  4WF9 V;  3RYH A;  2QA4 V;  1VQK V;  4KHP O;  4JTD B;  5L43 A;  3EON A;  1F7Y A;  1H8E G;  2LQT A;  3GNC A;  4LC1 A;  1SF9 A;  1QU7 A;  5FPO A;  1WPB A;  4CC6 A;  4FF2 A;  1CXZ B;  2EZP A;  4GKJ B;  3SGI A;  3D6B A;  2L6L A;  2Q0A A;  1OHH G;  1R6K A;  4PA3 A;  2AHY A;  3DTU B;  4UB8 Z;  2F66 C;  2F95 B;  1ZSP A;  2CUG A;  4RO2 A;  3THO A;  1JQI A;  3J7A U;  2ZO5 A;  1R3B A;  3AHO A;  1TA8 A;  5B1B C;  1S5L Z;  1AJP A;  5EK0 A;  2UXN A;  1ZUQ A;  3IC9 A;  4PEL A;  4FZ1 A;  4JI3 B;  3ZHV A;  1LUW A;  1XDC A;  3LNM B;  3P3P A;  3RFR A;  4CH5 A;  4JYA B;  2VR0 A;  3F5W C;  4NR1 A;  3HKD A;  3CCU V;  4O4I B;  4P9O A;  4O2B A;  5KHG A;  4JI8 O;  2Q8I A;  4J1V A;  1RP3 B;  4AKH A;  4KL1 A;  1GKX A;  1H38 A;  1Q8I A;  1RPR A;  3OMA B;  4OGQ B;  3IFX A;  5JCO A;  1GRJ A;  4O4H A;  4JTA B;  2WBI A;  1BT8 A;  5KUK A;  1H2S B;  3BPZ A;  3HKB A;  3JD3 A;  5CB4 B;  1RFY A;  2PTM A;  4EFE A;  3M7M X;  5M4K A;  2UXD O;  1HNX O;  2EBH X;  4DXW A;  4LWS B;  3H9V A;  1R73 A;  3RW0 A;  5GTI Z;  1Z5V A;  2ZKJ A;  2O57 A;  3T1H O;  4J11 A;  2IU3 A;  1EN4 A;  2YYK A;  4DV0 B;  3H1J H;  3SXQ A;  4DOY A;  1AI4 A;  1WB8 A;  2BU7 A;  3BY6 A;  4K8Z A;  3UT5 B;  2XS1 A;  3UO2 A;  2Q8F A;  1LNQ A;  3K5L A;  2ZAF A;  1IX9 A;  3Q4H A;  3FAV A;  4K3A A;  4U3J B;  1YSC A;  2VQF O;  5LMN O;  3STZ C;  5LP6 B;  2OEV A;  1K8T A;  1ZTE A;  3N27 A;  4WFA V;  5L3B A;  2QKA A;  1GN4 A;  2B9Z A;  1M57 C;  4K0K B;  5F2V O;  3B77 A;  5EBM C;  4JI6 O;  1KUQ A;  4B3S B;  1JMK C;  4NVP A;  5B1B B;  2FYU H;  2LJ2 A;  4O2A B;  4GUN A;  1GO3 F;  2LGW A;  3B8M A;  3JAW B;  1R3I C;  2OTJ V;  4XBF A;  4JI2 B;  1QBZ A;  5H6Q A;  3VAD A;  4WFG A;  3T1H B;  3N2K B;  2HHH B;  2C12 A;  4AQY O;  2F93 B;  2WLL A;  4JZ2 A;  2GBO A;  2GV9 A;  4YY3 O;  3A8T A;  2HR3 A;  4IYI A;  4I9W A;  2XHB A;  5LGU A;  4TUY B;  1D2D A;  3UCS C;  3OWA A;  2XAS A;  3J81 N;  4JIO A;  1XNR O;  2EIJ C;  5IDJ A;  3KG2 A;  4NTX A;  1K7D A;  4HZ3 A;  5L3F A;  1HW7 A;  4P79 A;  4X64 B;  2RDZ A;  1HP8 A;  4H44 B;  4GYC B;  2PYL A;  2E74 B;  3I55 V;  4JV5 B;  1XFV A;  4X1I A;  3DC6 A;  2EUL A;  3D8C A;  2AW9 A;  2QJ1 A;  4ZHQ B;  3ABM C;  4J7K A;  5M4P A;  3L71 H;  2R0M A;  3HQ2 A;  4JZG A;  2YXY A;  4X66 B;  4LFB B;  3ABT A;  4QE9 A;  2IX5 A;  3UBR A;  5K3J A;  3APQ A;  4DV7 B;  1P7B A;  2DWE C;  2VWJ A;  1DF4 A;  1OCO C;  4WFH A;  2IBZ H;  4BIZ A;  1I94 B;  3CME V;  2AZ2 A;  3E22 A;  4XVX A;  3HPL C;  3H1I H;  4IV6 A;  3ZCC A;  1Q7Y W;  4OPA A;  5LP6 C;  4JF3 A;  1XMQ B;  1UKW A;  4F0X A;  2AGA A;  3UT5 A;  4NTY A;  2Q8V A;  1VQ6 V;  1MAB G;  2YIC A;  1H2N A;  4PDM A;  3K5N A;  4ZBM A;  2OCC B;  5J2U B;  2YEV B;  1VMG A;  3W7W A;  2EIL B;  3EVK A;  1W2B U;  3OEH G;  1BE3 H;  4TV8 A;  1I7F A;  1OCO B;  5CB4 A;  2Q68 A;  4DR3 B;  2DDH A;  2Y0P A;  1PKX A;  4Q1O A;  1G6U A;  3N2K A;  1KP3 A;  1EGD A;  2E5L O;  5LYJ A;  4E00 A;  3FD9 A;  2OR0 A;  3L74 H;  1UJW B;  4EFB A;  3QO8 A;  4O2A A;  3ZHQ A;  4DR7 O;  5K3G A;  2EJ7 A;  3PN1 A;  4PHZ A;  3QVN A;  2OCC C;  2HJF C;  1JA8 A;  1O9H A;  4P13 A;  2Q7H A;  2K1E A;  2FON A;  4O4I A;  4XDK A;  2X7R B;  5DEC A;  4MVQ A;  4IIJ A;  5KHJ A;  3OIB A;  1MZF A;  3IGA C;  4EEQ A;  4GCZ A;  3UM7 A;  1PM9 A;  4LNU B;  5E79 Z;  1X90 A;  4ZYJ A;  3BAA A;  4R7C A;  3CB2 A;  1E1Q G;  4D6T H;  4OXS A;  3K59 A;  2DYS C;  4CH6 A;  4JI0 B;  1EGE A;  1FJG O;  2OJQ A;  5KMG A;  3CCM V;  2XUM A;  2UXC B;  3AFE A;  3K0G A;  2IJJ A;  4I4T B;  1OCC C;  4GX5 A;  2QKS A;  4J9Z B;  2EIK C;  3JSN A;  1TGO A;  3T1Y O;  1HNW O;  3X2Q C;  3A0B Z;  4ZKI A;  3R66 A;  1FXK A;  2WLI B;  2EIN C;  3WB1 A;  2R0N A;  2YEV A;  1AR5 A;  2EIM C;  1BQZ A;  2JVD A;  1SET A;  3A2F A;  1IBM O;  1EFR G;  4RQE A;  3CC2 V;  3LGQ A;  4FLZ A;  1D5A A;  1Y74 A;  2ITD C;  3RYF B;  4KSF A;  3IAY A;  3BNG A;  2A1T A;  2JJ1 G;  2R02 A;  5BXZ A;  1X4T A;  4DR1 B;  4P30 A;  3WG7 B;  2E76 B;  3MKH A;  4DO2 A;  3DC5 A;  4B3S O;  3BEH A;  3VKH A;  1BSM A;  2ZR3 A;  4PDL A;  2P4V A;  5EYP B;  2D2C B;  4BIU A;  3Q0A A;  4FFB A;  1F51 A;  2PI5 A;  4H33 A;  2V4D A;  3L70 H;  2QSA A;  1VQN V;  1V55 C;  1XFU A;  1FS9 A;  2RNB A;  4UV8 A;  2HP8 A;  3ZRW A;  4R6Z A;  5KHK A;  1QLE C;  5KAF Z;  1N32 O;  1AB3 A;  1AI7 A;  1PD3 A;  1OV9 A;  1ZL8 A;  4Z1V A;  4CBC A;  1XNQ O;  2F6L A;  5IWA O;  4AI6 A;  2R70 A;  5GON A;  4FLT A;  4YJ2 B;  4U3F H;  2WLL B;  3P3N A;  4MTX A;  2RQ6 A;  5FLX N;  4TOI A;  5K1P A;  3MHS C;  4G2K A;  1XOU A;  3RYF A;  3LDE A;  2JRI A;  1TUB A;  3SF6 A;  3MMO A;  5D5P A;  5B66 Z;  3P30 A;  3JAW A;  4MW8 A;  1JQ0 A;  2FP2 A;  2GTA A;  3CRL A;  1M4U A;  1QVF U;  2DMX A;  1F4M A;  3K3W A;  4UCV A;  1BGY H;  4B3T O;  5B5E Z;  4IT5 A;  1XEQ A;  2QDO A;  3RVZ A;  2P6J A;  5LOV B;  1E1R G;  4NYK A;  5JJN B;  1NR7 A;  3BRC A;  3OM3 B;  1N0J A;  3C2P A;  2IM9 A;  3ZMV A;  3HB3 B;  4YJ3 B;  4DUZ B;  2CK3 G;  2ZNI A;  1YZB A;  3H1L H;  1H2M A;  1O9G A;  5FPR A;  4JYA O;  1WJZ A;  1NTK H;  4ZI7 A;  1VQ9 V;  3IJ4 A;  3G4S V;  3CJH A;  1Y8N A;  2XTA A;  5CBH A;  1U97 A;  1K92 A;  4ZI7 B;  2X6B A;  1N36 O;  4J7J A;  3VKG A;  2EBO A;  3X0Y A;  4X62 B;  3EHB B;  3SJC C;  1RM1 C;  2PO4 A;  2XQR B;  4HNA A;  4FJC C;  3B8N A;  2XAJ A;  1BL8 A;  1XL6 A;  2CJ6 A;  4LH6 A;  2OWO A;  2QGN A;  3FYI B;  5IJ0 A;  5FNV A;  2UXB O;  1NVP D;  3BFR A;  3FO3 A;  3APO A;  1K33 A;  3PFD A;  4JAV A;  3TZ4 A;  4PI2 A;  1GN3 A;  4JI7 O;  1FS8 A;  1FAF A;  5DM6 V;  1EBO A;  1GH6 A;  2ZCE A;  5CA0 A;  4AHC A;  4JI4 B;  3ZMZ A;  2AZE A;  4H37 A;  5FNV B;  5KX5 A;  1PK0 A;  1S0V A;  3FB8 C;  4HYO A;  1Y76 A;  5LA6 B;  3RWR D;  3CCL V;  2VWK A;  4HBN A;  1U96 A;  3RYC B;  3AG2 C;  1QDB A;  3CCS V;  4I55 B;  2YXL A;  3LSS A;  2UU9 B;  4LF4 O;  5LHG A;  1EZJ A;  4Q5B A;  3HKC A;  3OW2 U;  2MW2 B;  2B1G A;  1EM1 A;  1LR1 A;  5IWA B;  4UUJ C;  3T1C A;  1HWY A;  1JR9 A;  5IYC O;  2V1D A;  1M57 B;  4UVA A;  3CJH B;  1PI1 A;  3D3I A;  1I0H A;  5JJE B;  4KS9 A;  2C2A A;  3FYE B;  2LW7 A;  3OUF A;  5HFM A;  3F7Y C;  4NXN O;  1YIT V;  4L3Z A;  2UXW A;  4FPP A;  5LXT A;  3CWB H;  2GTS A;  4NXL A;  4E2L A;  1VF5 B;  5BY1 A;  4X65 O;  2BTZ A;  4DK1 A;  2XAG A;  4LF6 B;  2GHY A;  2EIJ B;  1ROP A;  2YYJ A;  4MVS A;  4MVO A;  4KA7 A;  3JD2 A;  4W4L A;  2BU5 A;  3H01 A;  2EIN B;  1V54 C;  2N74 A;  3GQT A;  3JAK A;  1IVS A;  5KLV H;  3S3W A;  1WA8 B;  1RM1 B;  3SJB C;  3II9 A;  1W0K G;  1SIQ A;  5IJ9 A;  4OO2 A;  3FB6 C;  2D3O W;  1PP9 H;  1XHZ A;  4H81 A;  2GBB A;  3VQY A;  4DV2 O;  1GAX A;  1JCH A;  3HKC B;  3ML0 A;  4P2Z A;  1QR8 A;  1CPY A;  4X8A A;  1R3L C;  5KA5 A;  2JEX A;  1S5J A;  4AKG A;  2RFQ A;  1KMI Z;  1VAR A;  1PL0 A;  3K5O A;  1Y6X A;  2RDC A;  5CA0 B;  4I4T A;  4HR3 A;  1P7G A;  4TQD A;  5CA1 A;  5KA6 A;  4JYC A;  2REH A;  1CP9 A;  3TET A;  3CCV V;  2F1M A;  3T4D A;  4DV2 B;  3IC7 A;  2P7T C;  1GKZ A;  1IBM B;  2YIB A;  1NZ6 A;  2WAM A;  3B09 A;  4DW0 A;  5IYZ A;  1OCC B;  1BCC H;  4O2B B;  5L3D A;  4GKK B;  3Q4H B;  2CDY A;  3OTF A;  5IY5 B;  3T1Y B;  4BAY A;  2ILM A;  2B5U A;  1KB9 F;  5CBF A;  4JGS A;  3AG1 B;  1JM6 A;  3TOR A;  3ZRV A;  3DSQ A;  4LF6 O;  4UCU A;  4JAS A;  1EZV H;  1Q6I A;  3EXA A;  4DR3 O;  1GM7 A;  5B3S C;  5L3E A;  4TT3 G;  1DK1 A;  3OT7 A;  4TV8 B;  4YHH O;  2IJH A;  3CHX A;  4DV3 B;  3RKH A;  4KTO A;  4EKW A;  2ZDI C;  3HR0 A;  1BQ0 A;  1YEW A;  3AK3 A;  1XMO O;  2H8P C;  4FIP C;  5J2U A;  4U7N A;  1RPO A;  1URF A;  5EZY A;  3OE7 G;  2BE3 A;  1QR9 A;  2GSM B;  1TVK B;  4J10 A;  3ETG A;  1OCZ C;  2Q4P A;  2E5L B;  4KP4 A;  2AO2 A;  2Q9L A;  4QE7 A;  3BA8 A;  1YJW V;  2E3C A;  2A9H A;  4MTG A;  1Q6H A;  3CRC A;  5GON B;  3FKS G;  1T5E A;  2KG7 B;  2X6C A;  1YI2 V;  3HKE A;  2VIG A;  2LGQ A;  1Q5O A;  2EIL C;  3VBB A;  3TTB A;  5DED A;  1VF7 A;  3ETD A;  2QE7 G;  4JI7 B;  4QNH B;  2QEX V;  3OEE G;  3S3X A;  5LBQ A;  2GUZ A;  2RN9 A;  4Z1M G;  4Q0T A;  4RUE A;  4ZOL A;  1JVM A;  1SQX H;  1H2L A;  3HOA A;  4YIO A;  1M93 A;  2R9R B;  4DV4 B;  1QLN A;  4X62 O;  2LO1 A;  1DF5 A;  5E3X A;  5IY5 C;  1JX9 A;  1I94 O;  1NTZ H;  1XNR B;  2KSD A;  3JAR B;  5M4M A;  5BMV A;  4DV1 B;  4MVZ A;  2Z5U A;  4HKR A;  3C46 A;  4F6R B;  1RX0 A;  2ZE7 A;  4LF5 B;  2OTL V;  1ORQ C;  2Z1Q A;  2ZNJ A;  4AQY B;  4QIC A;  1WA8 A;  1WLE A;  2DJV A;  2WLK A;  1WN7 A;  1K4C C;  3A0H Z;  5B3S B;  3JAS B;  1ZWI C;  1N0N A;  3RGB A;  4DRX A;  4QIW F;  2R05 A;  4FLX A;  3WB2 A;  2KG7 A;  5BZB A;  1B3Q A;  4MT8 A;  4B3R B;  2PG0 A;  4X64 O;  4HNA B;  1VQ5 V;  1YF2 A;  3OD4 A;  1NBM G;  2W0F C;  4E02 A;  3F5T A;  3NXS A;  2A06 H;  2PI4 A;  4WFE A;  5J71 A;  2JGU A;  1LVC A;  1GN2 A;  1VQ8 V;  2D29 A;  3SCE A;  2HJD A;  3OAA G;  3SPG A;  4MVR A;  1GJV A;  2KKW A;  3SKS A;  4TQF A;  3SWO A;  2X0L A;  1M5I A;  4GT1 A;  1MMM A;  4EB6 A;  4TUY A;  4LNU A;  4ICG A;  3AK2 A;  5LHH A;  3JCZ A;  4IIJ B;  1M56 C;  3TCU A;  5LGN A;  5EC2 C;  2O3E A;  1VF6 C;  4PA7 A;  1KA2 A;  3C3T A;  3WFV A;  1P49 A;  5B6B A;  1XI1 A;  2OEX A;  3ZJZ A;  4QGP A;  5M4N A;  4IRN A;  4BIO A;  1TUB B;  1X59 A;  3QTC A;  4FZ0 A;  3HKB B;  3W7T A;  1VQO V;  4O5M A;  4J7Z A;  4UFZ A;  4O4H B;  3JD1 A;  1N33 O;  4B3R O;  5IYZ B;  1L8D A;  5H2F Z;  5B1N A;  3SYP A;  3AG3 C;  1KKD A;  4Q20 A;  3W7U A;  1K4D C;  1NQT A;  4WBN A;  4GX0 A;  2PUS A;  4DK0 A;  3KZI Z;  3EFF K;  5CN0 A;  3JAR A;  3QG5 A;  1AP6 A;  1FYJ A;  2QM8 A;  4MSW C;  3SYO A;  3JAM N;  2CGO A;  3MDE A;  3ABL B;  2HFE C;  3D36 C;  2UXD B;  5JH7 B;  2OIG A;  2RJZ A;  2DW4 A;  1Y4M A;  1HNZ O;  4L3X A;  3RBZ A;  3VOU A;  2B1I A;  4DR5 O;  4UCR A;  4KSA A;  4UXN A;  2P22 C;  4YJ3 A;  4LQQ B;  1SK6 A;  3ICX A;  2WLH A;  5C93 A;  1YHQ V;  4LQS B;  1MSD A;  3G67 A;  3K06 A;  4DRX B;  3DWC A;  2CX9 A;  4X20 B;  3AG4 B;  1G1X B;  2DYS B;  1VEW A;  2Z0A A;  3L9D A;  4RUF A;  1R6N A;  1IBK B;  3CYO A;  3BAB A;  1N36 B;  3ZHU A;  5B1O A;  4Z2W A;  2QM7 A;  1I5Y A;  3OR6 C;  4F6R A;  1SRY A;  1KKC A;  3LNN A;  4N21 A;  3U11 A;  1FS7 A;  4V26 A;  4YIP A;  2KB1 A;  3KKY A;  2HEP A;  1SKV A;  2RF7 A;  1JFF B;  3JCU Z;  3N2G B;  3JAT B;  3JD0 A;  3K57 A;  2EZO A;  4DR7 B;  2OT4 A;  2P67 A;  3CXH F;  4CC5 A;  2IX6 A;  3Q22 A;  2A79 B;  1I5X A;  4AIL C;  2MK3 A;  4JTC B;  3ZMT A;  3MDD A;  2JBS A;  1PPJ H;  3H1K H;  5KMG B;  2W6I G;  1GN6 A; 
#chains in the Genus database with same CATH homology
 4P79 A;  3AHO A;  3C3L A;  5L43 A;  2AO2 A;  3VKG A;  3CE2 A;  3DWC A;  4KS9 A;  1K8T A;  2GBB A;  2H1J A;  2PO4 A;  5L44 A;  1Y79 1;  2AZE A;  5GJV E;  1PK0 A;  3C2P A;  2YGW A;  4PUT A;  1RP3 A;  2EC5 A;  4QIC A;  4FF3 A;  1KA4 A;  2H1N A;  4KA7 A;  3HOA A;  1XFV A;  4FZ4 A;  1Y0V A;  2FP1 A;  5GJW E;  1S26 A;  2QR4 A;  1XFW A;  3AHN A;  1K9X A;  1LVC A;  1XFY A;  2FP2 A;  1XFZ A;  1XFX A;  3N0R A;  4FF2 A;  3VKH A;  2F6L A;  3Q23 A;  1KA2 A;  4KSA A;  4F0X A;  2EBF X;  3Q22 A;  3KML A;  4AI6 A;  1SK6 A;  4FF4 A;  1K90 A;  5E3X A;  3Q0A A;  1K93 A;  4KSF A;  4AKI A;  3AHM A;  2EBH X;  3HQ2 A;  4FF1 A;  4AKG A;  3X29 A;  3SKS A;  3Q24 A;  4AKH A;  2LFW A;  4KA8 A;  4G97 A;  1XFU A;  2VF1 A;  1SC5 A;  4HKR A;  4HKS A;  3C46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...