3CF0A

Structure of d2 subdomain of p97/vcp in complex with adp
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
301
structure length
281
Chain Sequence
ALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Improved Structures of Full-Length p97, an AAA ATPase: Implications for Mechanisms of Nucleotide-Dependent Conformational Change.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Transitional endoplasmic reticulum ATPase
total genus 93
structure length 281
sequence length 301
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2008-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
A PF09336 Vps4_C Vps4 C terminal oligomerisation domain
A PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3cf0A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3cf0A01
2EW1A 4ARZB 3EC2A 2P6UA 1E1QA 4DSOA 1W2GA 2QRZA 2C9CA 2FWRA 1GZSA 1IBRA 3CX8A 3EARA 1XPUA 1Z47A 2REOA 1D8TA 1ZC3A 2AX4A 2CLSA 2ZETA 4DDWA 3IQXA 1ESNA 4DWJA 5K8IA 1L8QA 3K9NA 3TNFA 3GEEA 2UVQA 1D2EA 3BB4A 4PQFA 1ZU4A 3EA0A 3L2OB 3SEAA 1IXSB 2VP0A 3OEEA 4QNMA 4X8HA 1Z0JA 3CO5A 2G9NA 3IBGA 1M7GA 4YMTA 3L8ZA 4LBVA 3PEVA 3IQWA 3PUXA 1K5GA 2XSZD 3MJHA 3I8XA 5DI9A 5FPTA 4NZYA 2V1UA 1VCNA 5EUQB 1ETUA 1ZD9A 1J99A 2C95A 3F8TA 1WMSA 4C7OA 4C4PA 1P3JA 1V5WA 4HB2A 4F93B 4FMDF 4D0NA 1OFHA 1ODFA 1J90A 1U99A 1FOEB 4TZ6A 4UXHA 2OSBA 3CLVA 4CGZA 4Z8YA 5L3RA 3L82B 2PCLA 2A2ZA 3UPUA 3NHBA 3GQBA 1R5BA 4Q4AB 3BB3A 4OHVA 2FFHA 2AXNA 3OIUA 1VG8A 4HEJA 3BC1A 3Q7QA 3OESA 3TAUA 2W2TA 3D3QA 3UG6A 2CVFA 1AZSC 4BLQA 2XTMA 3RS7A 1CJTC 2CHQA 3NBYC 1LNZA 2CNWD 1I4LD 3A1WA 3VTKA 4G0NA 3AF3A 5FFMA 3V4FA 2J5XA 2J46A 3PITA 2RKOA 4JL6A 2XOKD 2D2EA 3SFZA 1OB5A 1BMFA 1QHIA 3PQCA 5JCPA 2HF9A 2ZI7A 1G4UR 2W58A 4YXWD 4MUAA 3K0FA 2O8BB 2YZ2A 2Q9CA 1BIFA 2PCJA 5BYJA 3KKOA 1KZGB 1JJ7A 3UKDA 5AUNB 2E9SA 2IS6A 4ZO4A 4Z1MA 3THXA 2IF2A 1A7JA 1UAAA 5IF9A 2NZ8A 1VTKA 2WICA 2CHVA 4IDPA 1BO6A 1KI7A 1LB1B 5EE5B 3IIKA 1P75A 4HUQB 1KY2A 2ANBA 1AQYA 3LWNA 3IPYA 3MHVC 3QKTA 4B44A 5BWMA 3LAWA 4TMWA 2GZDA 3QF4A 3SHWA 2WAXA 1R8SA 2QM8A 2WSSD 1CU1A 1MO6A 5LPNA 5BN4A 1ZU5A 1XTSA 2GESA 3Q9LA 4TLBA 2XJ9A 1P5ZB 3LV8A 4FWTA 2DBYA 2WWFA 1B23P 421PA 1TUIA 1PUIA 5FUWA 1KI8A 2VPPA 4TLEA 4PPNA 2Q6TA 1KMHA 1AA9A 4AG6A 2Q0HA 1TF2A 4IXMA 1IXZA 3A36A 1DEKA 2GBLC 4MRSA 1E4YA 3CPHA 1D2NA 3UK6A 3ASZA 1E2KA 1W0KD 2FEMA 1S8FA 4N0EA 121PA 1G7TA 2IXGA 4JBXA 4ZCLA 1ZJ6A 3TUIC 1LVGA 4AKGA 4D4LA 3V9PA 4AG5A 2W6IA 3HPRA 1G6HA 3QBTA 1XDBA 1G3IA 3H86A 3HYTA 5AJWA 1KAGA 2JLYA 2A5YB 2R6CA 3FYHA 1QVRA 1EFCA 2QTVB 1C4OA 2F1JA 2ZJ8A 4MKGA 3QUSA 3B7GA 2Q3MA 4MRPA 4POAA 3CF2A 1TQ2A 4LV8B 2ZXUA 4GSYA 1JPNA 1ZBDA 5CM9C 1FMLA 3WRXC 4ZDKA 1G5PA 4TL8A 3UIEA 2QRNA 2VHQA 1ONBA 4Z51A 2YHSA 3WBJA 2IXEA 4JLDA 3ZVLA 4AYXA 2EU8A 5LD2C 4PXAA 2D7DA 1Z0DA 4F7WA 4QJ4A 2AK3A 4AKHA 3ZZ0A 3CR8A 5KSZA 1AS0A 1NIPA 2QEQA 3EASA 1OH5A 2VBCA 1ZM2A 4JLMA 4PZLA 1P62B 5CB6A 721PA 1ZM9A 3PR1A 2ATVA 2WSSA 4Q02A 3B5JA 1UFQA 1XCMA 1YVDA 1CP2A 1DE0A 4L9SA 4LUCA 3K1JA 1LY1A 2GK7A 2YC2C 4G1UC 5KNDA 3JZMA 4ZCIA 4PZYA 4TTRA 1XD9A 2N42A 3DKPA 3THYB 2R9VA 4Y0VA 5JCZA 4PSVA 2VHTA 1PJRA 2WMNB 2WJJA 1E2JA 2EFEB 2PEZA 2Q3FA 1XMSA 4HYYA 2LCFA 1DBSA 1ESMA 4JVNA 2XXAA 3NBXX 2JJ1A 3I4LA 4KVGA 5TXGA 1W0JA 1RE0A 4M0LA 4KBGA 1P2VA 3HJNA 1SVLA 1W36D 4RZ3A 2FPKA 2XZLA 1OXUA 1KDOA 4K46A 2F55A 3KDSE 1UKZA 1QHYA 1Z6YA 2W6JA 3IHLA 5AJXA 4BZXA 4R98A 5JRJA 1N25A 1TL7C 3K0FB 1CS4C 1GITA 3AV0B 3AVQA 3M4YA 5D3MB 5FUXA 1MOZA 3SNHA 3WBKA 2GBLA 4OJQA 4QL3A 4YMWA 3DM9B 4Q4AA 1T5IA 3HU2A 2JCSA 4FWHA 1Z22A 2CL0X 2IYVA 6Q21A 1G3MA 1SHKA 2QP3A 2F1IA 2EWVA 1CTQA 3SYLA 1G41A 3U3KA 4B33A 1P73A 4YMVA 3QJYA 1F5NA 1U8ZA 2A3RA 1TQ4A 2WOJA 4A4DA 1KI6A 4BRWA 4Q9KA 3EIQA 1F2TA 1Z3IX 2PX0A 1EFUA 3DVLA 1R7RA 4Q47A 5IK2D 1R8QA 4BFYA 1HQCA 5HR5A 1P4SA 3CX6A 3K9HA 3KXIA 1N5KA 4YMSA 2AR7A 2YOGA 1FMJA 1II0A 3CIOA 4F38A 1VCMA 3KFVA 4IHQA 1KK2A 1ZIOA 4RCYA 4HLDA 3X1WA 1DAFA 4TT3A 5J4HA 4PO9A 3SR0A 1QZXA 4B2PA 1NP6A 3AB3A 3ZD6A 3K9LA 2DFKB 1GUAA 3FGNA 4NCHA 5E3HA 2JLZA 2JLWA 2G88A 5L3QA 3LX8A 1SXJE 4TQAA 2ZS8A 1XU4A 1AGPA 3LH5A 4GOKA 1QBKC 1TEVA 3AGPA 1II9A 2ZI4A 1T3SA 4NYJR 1E2MA 3LBIA 4L8GA 4C9BA 1O87A 1IAQA 2WJYA 1E1RD 1S9HA 1IJFA 2H1LA 2XXAB 4RD4A 1MT0A 2FSHA 1UBCA 1EXMA 2QGZA 4H1UA 2QTFA 1KJWA 3ZS8A 2J59A 4BEJA 1U90A 3DDCA 2BDTA 4OJKA 4UXJA 2UZ3A 3B1XA 2BJWA 3B82A 2ZYVX 3NH6A 4LHYA 3PFIA 3PUZA 3UANA 3HDTA 1XRJA 2ODWA 2ZE5A 1GTVA 4BFUA 4G5SA 3CBQA 2QENA 2HXYA 3FB4A 1WP9A 4WVFA 3SC3A 5AJYA 3NEYA 1TMKA 5CDFA 1YZQA 1M74A 2XSZA 1FNNA 2IX3A 3HPQA 4PSAA 1OXVA 4URWR 3U3OA 1R5NA 1Z0KA 2QP4A 3QQ5A 2BMDA 1SXJA 4DB2A 4QOSA 1TEXA 3N70A 3W3AA 4QC2A 2WKPA 2IBMA 4XWAA 2W0MA 3O8BA 1XD8A 221PA 4GP7A 1KI6B 1OHHA 5JECA 5KNBA 2Z83A 3OE7A 3NXSA 4EFLA 1N5IA 3I72A 3ZYCA 4B32A 1J2JA 4MGKR 4XSHA 1P6XA 4MYHA 1II8B 4B76A 2ZRKA 3W90A 3P1JA 4URYR 5JHGB 4OHZA 2GCOB 2IK8A 1E32A 1QHXA 3EAQA 5BYKA 4A2QA 4MYUA 1NLYA 2GETA 4OHXA 1YR9A 3FMOB 1NKSA 1PUJA 3C8UA 2GF9A 2YC4C 3WY9A 4B2IA 2ZRNA 2FOLA 4MQBA 5GADl 3RLFA 4KFTA 5C4GB 1Q21A 3NDPA 1QVAA 2QAGB 3NC1C 1GRQA 2QE7A 1M7BA 2UKDA 3GJ3A 4MKFA 4CF7A 4KXFB 1SKYB 5F98A 1W36B 1W48A 3LBNA 1Z0AA 3CRMA 2OLJA 3IUYA 2KB0A 3KXKA 2QAGC 2JATA 2F43A 4DCSA 4IDOA 5FR1A 2IUTA 1DAGA 3MSXA 3HU3A 2ZR9A 3UMSA 1GM5A 3LQRA 1TU3A 2GEVA 3GJ8A 1OIVA 3SJAA 1N0WA 4L9WA 3PEYA 2NZJA 4LYHA 4Q7MB 2X19A 2V55B 4II7A 4TQUS 3TR5A 1P2SA 3P27A 5EE1A 1LV7A 3VAAA 2VF8A 3MD0A 4HLUC 4I1SA 2JJ2D 4D25A 5TARA 4LJ4A 2FZ4A 3CH4B 3QXJA 4GPTA 4P32A 3WMGA 3X1XA 4PSKA 4OI1A 2WIAA 3SBDA 1COWA 4CVNA 2ZVPX 2FMXA 1OHHD 1FFHA 3U6BA 4EAQA 1X1RA 1E9SA 2AFHE 2WKQA 3AF2A 1E79A 1ZUHA 1XB2A 4C0LA 4NYMQ 4FI3C 2G1KA 1ZD8A 3Q3JB 2NPIA 2IHYA 2KBFA 3QSYA 3GEHA 2C78A 1WBBA 3V4RA 4JL8A 5FI1B 4C0HA 5DLQC 2ANCA 1Z28A 1QHNA 2C04A 2O8BA 5TDHA 1UDXA 4UNQA 2FNAA 3C16C 4PC7A 4IDHA 4DLXA 1KMQA 3R7WA 3ZJYA 2RGBA 4TMXA 4KLNA 1ZC4A 1Z06A 4JN6A 4E5UA 1KSJA 3E5HA 4CEHA 2HJGA 1SVSA 3LVRE 2BM1A 1SHZA 4HLUA 2ZYTX 2QPAA 1KAOA 1UPTA 3U3MA 2XAUA 4K8OA 3TW4A 2EFDB 2ZITA 3KUCA 4FMDB 4ESHA 4AK9A 8OHMA 4O2LA 1DPFA 4GFDA 2CCGA 2A78A 5F2EA 3AF0A 3W5IA 4KCGA 4Q66C 1WDTA 4R9UC 1E2PA 2BEJA 4DC9A 2E1RA 3CKLA 2JJ8A 1XEWY 1X8LA 1LW7A 1NJGA 5JFGA 3WXMA 4OQNA 3GMTA 1E9FA 1KI1A 4TLAA 3BH7A 3UATA 3Q5DA 1TF5A 4UJ5A 1P9NA 2ZRBA 2RGCA 3ZS9A 1DTSA 4QGAA 4LGMA 1G8FA 3WYAA 2G83A 1FTNA 1SXJB 1G19A 1ZAKA 1YZTA 3GJ6A 2Z43A 1UM8A 1YZUA 1JAIA 4NL4H 5P21A 2W6ID 4X8MA 4OK5A 2IL1A 4ERNA 1KI2A 5DIFA 3IEVA 4IOKA 1XTJA 3GLGE 2RGNA 3FPAA 5CIWA 3U3RA 2HCBA 2R6AA 4KFSA 1NMZA 1UEIA 3E70C 3OEED 3EWSA 2J45A 2B92A 1KY3A 2W2XA 3FHCB 1ELOA 4XD7A 2IYLD 2ZRPA 2IHBA 1BYIA 1JQJC 1E0AA 1P9WA 3B2EA 4ESVA 3K0CA 4M9SA 3MWKA 2ZRAA 3AVOA 4C0BA 4F4JA 3F3YA 5TY0A 2CEAA 2ZM5A 1YRBA 3RWMB 2DY1A 4PPQA 1W0JD 4M1SA 3RS4A 5DYGA 2WV9A 4BQSA 3MAAC 2O0HA 2VF7A 4G5OA 4ILEA 2V54A 4B71A 2IYWA 1ZNYA 2EWWA 3FKSA 3JVVA 4WZAE 4EUNA 2HYDA 4W9MC 1ZM3A 2JLRA 4URVR 2YOFA 3D8BA 1UKVY 1BKDR 1XEXA 2ZSAA 4HB3A 4FD2A 1GSIA 2E87A 1FW6A 3T1TA 1FL9A 4OHYA 3IILA 4Q5IA 1FP6A 3QKRB 1IN6A 3TRFA 2BVNA 3I1FA 1P7CA 1UKYA 4QJ5A 4AYWA 3LXXA 5BXQC 3L0SA 1DAHA 2VYFA 3WNDA 5FPHA 3T1QA 4RFSA 2WPDD 3OAAA 4NYIR 1NY6A 4XVUA 5KUTA 3A1VA 4M9XA 4ZDIA 4FXPA 3GLFA 2DPXA 2CDNA 2OCPA 4QXAA 2GJKA 4V0NA 2PMDA 5FUYA 3IIJA 3X1DA 4YQFA 4ZIRA 1S2MA 4C0AC 1MKYA 2ZSBA 4HLQB 3SJCA 4I1VA 5EP1A 2N1BA 1YZKA 4U02A 3ZZTA 1LS1A 1KSHA 4D81A 3G82C 1VYVA 1GAJA 1E9BA 1FUUA 4Q4LA 2W83A 1HV8A 4TT3D 1JXMA 1E9RA 4W7SA 4KBFA 3RS2A 2KSQA 3OFNA 1NIJA 4BWYA 2RGEA 3DMNA 1JEDA 1R0WA 1R2QA 4FMBB 1G5RA 4KJZA 2WKRA 1N5LA 2FSIA 2R62A 1Z6XA 2LKCA 3FMPB 2YYZA 1NLZA 5JI3E 4TWZA 3ZVNA 4ITRC 3EZ6A 2CNWA 2FFQA 3X1ZA 3LNCA 3R8CA 3WRYC 5A4JA 2RGNC 4LPSA 2RGDA 2BOVA 1AS2A 3T06B 1XX6A 3VKWA 4R2IA 4JT4A 2Q9BA 5LD2B 3FKSD 3L43A 2V6JA 4JBWA 1SXJC 2JLUA 3GLIE 2GCOA 4KHZA 3AKYA 1G9XA 5AUPB 3QPWA 5FTJA 1TAGA 2AFIE 5HE8A 4MKHA 3TSZA 5J47A 1DADA 4HLCA 1Z07A 1JPJA 3U61B 3GLIB 1E3MA 1OXTA 2YWHA 821PA 3DZDA 1MABB 3ICQB 1OXXK 1VCOA 2R6GA 3RRMA 2BJVA 2IYQA 2QG6A 2JLQA 1Q12A 2RCNA 4LHWA 3BJIC 2O8FB 3LVQE 4XIGS 5EQTA 3JZAA 5G41A 5J4YA 5FPKA 3VHLB 2XZPA 4OI0A 2VP2A 4Q1BA 4GNKA 3ECCA 3EXAA 5L3SA 2X77A 4AKEA 3AVVA 2O0KA 3B60A 3CNLA 4A0RA 4BECA 5B64A 4F91B 4RY2A 4NYMR 2NO1A 3IBYA 1KK3A 4NU0A 4YC7A 1IY0A 1AN0A 3RS5A 2OZEA 3A1SA 2J41A 2ERXA 2G77B 1QF9A 2FZLA 2WAYA 4WXRA 4UJ3A 1Q22A 3GEIA 1BS1A 2F7SA 2WIBA 3OFND 1XD2B 1RW4A 4PFSA 1RKBA 2VHUA 3DZ8A 4NMMA 4TTPA 5AK0A 1G8HA 2OXRA 5A5GA 1PVOA 3F5FA 3QBVA 4RSGA 4XVQA 1G3UA 5LB2A 1KO7A 3KQKA 2HDNB 4FWGA 2B6HA 1CR0A 1GKUB 5KSOA 2RGAA 5JWHA 1QG4A 4R71A 2YNMA 1CR1A 1J8YF 1TUEA 3NKVA 3EA5A 3B8HA 4CRWB 4RD2A 3FWYA 1CEEA 4QBIA 1XPRA 4PC1A 1V43A 4QHYA 1X3SA 3C14C 1XJ0A 1F6BA 1E79D 2VP4A 3LBHA 4UQOA 4DKXA 1D2MA 3VR3A 1OYWA 4EJSB 4EKDA 3SYNA 4Z8XA 3MRSA 1CR4A 1AIPA 4LDJA 3CONA 4C3ZA 1X8KA 3VR5A 3AGQA 5CM8B 4BRUA 2DZNB 2HT6A 2O8DA 3K0SA 2WTUA 4CEHB 4M1TA 2AKAB 2BHRA 4M53A 1KSGA 3QENA 2ZPTX 4W5WA 1NN5A 5CLQA 3VKGA 2YWGA 5AUQA 2QQEA 4RD0A 5KSPA 4TSFA 4B43A 3TUZC 4RJLA 2ASEA 4BGDA 2XNDD 1JALA 5G3ZA 3BS4A 4PAMA 2IWRA 1VHTA 2WWWA 1OKKA 2W6JD 4KU4A 5CYOA 4EQ6B 2AN9A 3QPUA 4NH0A 2J7PA 2V6IA 4MGYR 2FDCA 3EZFA 2JJ2A 4URUR 3SHFA 4UNRA 1AKEA 3DPUA 1M34E 1KZ7B 4FWDA 2B7BA 3T1VA 1GL7A 2NQ2C 4JL5A 1FTSA 4PC2A 2XX3A 4A3VB 1EX7A 3KTAB 2ORVA 1OLOA 3QG5A 1L4YA 4JVMA 5K8TA 1VIAA 4GMDA 1H65A 3ZVRA 4XH9B 1D5CA 4L4UA 1HE1C 5L3VA 5KO2A 1NN3A 1CIPA 2OILA 4IVQA 3WHLA 1GP2A 1F3OA 5CLLA 3RNLA 3SQWA 1KGDA 5DYIA 3WMEA 4PHFA 1MO3A 3FMFA 5DNYB 2JDID 5JEEA 5IK2A 4HUTA 4Q00A 4L16A 3B6EA 4XTRA 3F0TA 1YR6A 1M7HA 2MSCB 5CIQA 1IY1A 1K6MA 3M1IA 3TSOA 1Q44A 4GITA 1S3GA 3QXXA 1S9DA 4AC9A 3U7HB 4LOAA 4AYTA 2I4IA 4TLDA 4AURA 4IFBA 3ZGXA 4PC6A 3N5CA 3WP1B 5HCNA 4R7ZA 3CNNA 2NO0A 2OBLA 2PZFA 2FN4A 2ECKA 2IYZA 3PCRB 3BFXA 4PPFA 1VG1A 1DAKA 4JIMA 2GXAA 3PJRA 3QXHA 4I4LA 1JR3E 3T1OA 4A92A 3AP3A 4A9AA 2QORA 2ERYA 4GRAA 1K8RA 2A30A 4HAYA 4NHOA 4LJ6A 1XEXB 4DUGA 1SZPA 3AKEA 1W2HA 4HDOB 4B73A 3BXZA 1TF7A 3BK7A 3QEJA 4QGGA 2JEOA 2GVZC 2W00A 3FFBA 1E98A 3KUDA 4Z54A 3FHTA 2NGRA 3VR4A 2OAP1 4WIAA 3AP2A 4Q9IA 3CB4A 3FE2A 2ZS9A 1I2MA 4HB4A 2YWFA 4ACBA 1RVDA 5GJVC 2QP9X 1XEWX 4LK2A 1F48A 3BOSA 1N6RA 5IRCD 1OE0A 1RJ9B 2JLSA 2NO9A 1XP8A 3CRRA 3CUEF 2WM9B 3HYRA 2YV5A 3MWLA 1T0HB 2P65A 2QMEA 3X1YA 1RRPA 4LI0A 4B3BA 1KI9A 1XD2A 4DCUA 1D6JA 2QAJA 4TYWA 5D3QA 2ZYWX 1WB9A 2H8KA 4PC3A 5FTKA 4ZI3A 1YZGA 3T61A 5LB4A 1YJ5A 4C2TA 1R6BX 2ZS7A 3AH8A 1DG3A 4Q18A 2AL7A 1KO4A 4FINA 1IHUA 4QBGB 5DHFA 2A5GA 3SS8A 3EW9A 4CIDA 2REXB 2FG5A 1II8A 1US8B 1H8HD 4D4MA 2FH5B 4B6FA 4CEIB 2AK2A 4QRHA 4PHGA 1VCIA 2PLFA 4JVLA 2VHCA 2F3TA 2PLRA 2QN6A 4JLAA 4UNSA 4DVGA 3K70D 2H5EA 4EIWA 5DGXA 5JRZA 1QZMA 2XB4A 1W47A 4DLSA 4YLGA 1Q3HA 2QPTA 1SVOA 4A8JA 3L0OA 3EG5A 4DT1B 3TW8B 2ZANA 4LZZA 4M21A 3GFOA 4JJKA 1U2RA 3RC8A 4JLOA 3NWJA 4HAWA 4PR0A 1FX0B 1LFDB 3R7WB 4WW0A 2XTZA 3BRWD 2V6ZM 1GL6A 2O8FA 4OQFA 4CW7A 5D3MA 1SVWA 2ONJA 3U7GA 3EIHA 3K0AA 1JNYA 2OG2A 1UEJA 4KFUA 2F1RA 3VHXA 4DDTA 2IYSA 4PX9A 3GJ7A 3NVAA 1S3SA 2Q21A 5IDVA 3OIVA 3ICEA 2Z5FA 2J0UA 4NE2A 1ZYUA 1AJEA 4OQXA 2ZRIA 5CK4A 4QFMA 3WHKA 2WWGA 3VR6A 1AK2A 1U9IA 2JIZA 2QMUA 4QGFA 1NG1A 1NVUQ 1F2TB 5FPSA 4DDUA 3UXMA 2PH1A 5KNCA 3BH0A 5C1BA 2WHXA 3KL4A 5J5CA 1HH4A 2ZSDA 4TYPA 2DZOB 4TMKA 1P72A 4G5QA 2QE7D 2IWHA 4KI0A 1NL3A 2QSYA 2O5VA 1KNXA 1WE2A 2DCUA 4JMPA 4KAXA 3QG1A 3GJ5A 3K53A 3KTAA 4KV9A 4XJXA 1ZCBA 4BPBA 4LHVA 2AWNA 3UMRA 1T4GA 1WA5A 3RSOA 1A82A 1G7CA 3EIEA 3LDAA 4TYNA 2P3SA 3C4JA 2F3RA 3H1TA 3QOFA 4IRUB 1U8AA 3AVWA 1X1SA 2K5UA 2ZI5A 1S0UA 2P5SA 1XMJA 1YR8A 2VQSA 5AWFC 3KFXA 2H18A 3U7EB 1XNJA 2Y8EA 4DBLC 3QIAA 3N2EA 2GJ8A 4H1VA 2VTKA 2YKGA 2O8DB 3DOEA 1Q3TA 3CW2A 3W5JA 2GZAA 1JECA 5F3WB 2H7VA 3LLUA 1BMFD 1E2NA 4US2R 4CT4B 4Q01A 4LJ5A 1ZNWA 4TTQA 3TIFA 2HYIC 4WA7A 5HCIA 3O8DA 4CYMA 3X2SA 3IDQA 4KODA 3GJ4A 2DYKA 1SVMA 4BLTA 3EZ9A 3RYTC 1TADA 1KYIA 2CE7A 2ODNA 2ZJ2A 4O2RA 2ATXA 1KDTA 3ND9A 5KPJA 4R2HA 3OIWA 3B9QA 1JI0A 1XTQA 2DHRA 3MFYA 1U0HC 3C41J 4QG7A 1N0VC 3FKQA 4OYHA 2FA9A 3GLFB 1MR3F 3AVPA 1OKKD 3RS0A 3U4QA 1UKEA 3EWAA 4BFWA 3CPJB 5KU1A 3PUWA 4IOJA 3VMFA 2XOKA 5DISB 2GNOA 5EUMA 1CJKC 2QT1A 2VA8A 4PO8A 1WQ1R 5FBWB 3THWA 1JR6A 1N6IA 1VYUA 4ABYA 4LYJA 621PA 2PT7A 1F60A 1XXHA 3LLMA 1HT1E 1ZVQA 1NN1A 1T0JB 3RRZA 1N6NA 4P4TA 2ZIAA 4F4IA 1VG0B 1NNEA 3MJRA 5SZKB 1W1WA 1NRJB 3B9PA 2VO1A 3AKCA 2ZAOA 3P32A 3K0EA 5FOVA 2IC5A 4RKFA 4B3CA 1W0KA 2YWEA 3ZVMA 5E4FA 1XCPA 1EGAA 4A82A 1DG1G 4CZ2A 1FP7A 5IHPA 3ZLJA 4RKEA 4P3YA 1B0UA 2WWIA 5UKDA 1G1MA 1T8TA 5GJCA 2XITA 3K0AB 2OT3B 1N5JA 4I1OA 4OHWA 3TAHA 4AIIA 5L3QB 3UWOA 2C8VA 3B1YA 1Z2CA 4OQMA 3T15A 3I5YA 4GMXA 5B57C 2OM2A 5E7JA 4F4CA 3ZDQA 2FSGA 4EQ6A 2WSMA 4NCNA 3NC0C 4RCZA 1CRPA 1G8PA 4DLTA 3EPJA 5GJBA 3CF6R 3SYKA 5EXSA 3Q8XB 1D9ZA 4JSTA 4PZZA 4DSTA 4LJAA 2IYUA 1UBFA 1ZNXA 1OW3B 4MUBA 2YJTD 2IA5A 4EPYA 3S1AA 1KJYA 1NY5A 2ONKA 2I1VB 4C2UA 1HY3A 1MRSA 2GVDC 2QU8A 3TK1A 4RZ2A 4BFSA 1X8JA 4M1OA 2GF0A 2REBA 4HZIA 4JS0A 4CEJB 1E9DA 1XCGB 4LRTA 4FN5A 1LTQA 1Z6GA 2ZJYA 4HI0E 1SVIA 4V03A 3LO5A 4QHSA 5K8UA 4Q4HA 5HE9A 1RC8A 3KB1A 4O25A 5EE3A 4N3NA 2WZQA 1NJFA 1W4RA 4GOJA 3GLGB 5JBQA 2QQ0A 3DKVA 5FOXA 4JSYA 3R20A 4XVRA 5BQ5A 3RABA 5B2ZA 1GIAA 2FE4A 3KJHA 3RWOA 4MDEA 3DHWC 3VU9A 4JT2A 2X8AA 1KIMA 2FF7A 3QF4B 4IKEA 3WMFA 4DXAA 3BB1A 4OL0A 2GRJA 3EPKA 2IT1A 5CK5A 1WBDA 4TYQA 1E1QD 3JVUA 5DE3A 3BAFA 5EP4A 2JLXA 4B3GA 2GXUA 3BH6A 4RD1A 3L0IB 5FOUA 4DRZA 1SVKA 3AUXA 4XSGA 2QPOA 4DLYA 2G0NA 4GI7A 5FL7D 1XTRA 2KJQA 1ZCAA 1ZUNB 3BERA 3I73A 1Z8FA 3AP1A 1ANKA 1SULA 3Q7PA 4A2PA 1AM4D 1H8EA 1F2UA 4WAUA 3OF5A 4Q4JB 5JJIA 2GJSA 1XTIA 2V1XA 2NPFA 5IT5A 1G3QA 4TQ9A 4LRSA 3LFUA 3BIFA 3HR8A 3OEHA 2A9KA 1YHNA 3QE0A 1VKJA 1Q57A 2C9YA 1R0ZA 4IW3B 1Q1BA 4EDHA 3T12A 4AI6A 1Z08A 2BKEA 4FMCF 1X6VA 1OXSC 4MRNA 2EVWX 5JLJA 3IKJA 4EPXA 2HXSA 5K8LA 2HJVA 3W34A 3W9YA 1H8HA 4LY6A 3REFA 1JB1A 4Q1CA 1S1MA 4DJTA 3I61A 4HZUA 4B48A 3NBZC 1X37A 1AZTA 1CXZA 1MO4A 5EXPA 4OI2A 3TH5A 4LBYA 4A2WA 3EZ7A 4HB0A 2VEDA 2QT0A 2GK6A 2P2LA 1L7VC 1GVNB 4IDNA 4YDSA 4Q1DA 2O0JA 4ASUA 1E96A 4IOMA 3QF7A 4QBFA 4GBMA 4C30A 2VSFA 4EJSC 4ZV4A 4GT1A 3AVYA 1MV5A 2ODEA 3I3SR 1T6NA 2DWOA 3AEZA 1AQUA 2NO7A 4A6XA 4A8JB 1HUQA 3QKUA 2ZU6A 3VR1A 1M1YE 1G16A 2P6NA 3U3JA 4KSBA 4WXPA 4M8NE 1XEFA 5EZ5A 5FL7A 2WJVA 2OCYC 2QL6A 4IXNA 4JLVA 3QKRA 1NF3A 2BMJA 1KJZA 1EWRA 5SZJA 1M8PA 5KPDA 3H4MA 1W7AA 1AGRA 1DOAA 1E6CA 4RZUA 4FIDA 4LHZA 2BC9A 4EPWA 2O8CA 4G5GA 1E2HA 4FW9A 1KKMA 3GLHA 2A7QA 5FBVB 1E0JA 2DVWB 2QGNA 4TMTA 3G0HA 1S1CA 2C77A 2GA8A 2FV8A 2HV8A 2O52A 3NH9A 3OIYA 1N6HA 3BBPA 4M1YA 1X86B 4C0JA 4NCIA 4UNNA 1G3RA 5A0FA 3W6PA 1G8YA 4ZPXA 4ZDJA 1UBGA 1EX6A 2ZJ5A 2FJUA 3KQHA 1PLLA 4FWIB 2D7CA 4TYYA 1G5TA 1OH7A 2BBOA 1N6LA 4B2LA 2QROA 3C5HA 1JXOA 5FOSA 1PLKA 4DLRA 3FOZA 2QSZA 1OF1A 3IGFA 2CJWB 1VG9B 2FX3A 1I2DA 4QHTA 1Z6TA 1JAHA 1M2OB 3TBKA 3TVDA 3EX7C 4PQRA 3W3ZB 5FOTA 2MSEB 3R8FA 1FQJA 2HEIA 2KI5A 1FPMA 3VKHA 2XNDA 1DARA 4V02A 5F9HA 2YVUA 3ADBA 4UNPA 2JIZD 3S1AB 3HP1A 2QTHA 4PAQA 1U94A 5TVKA 3LW8A 1KK0A 2ZR7A 4DLZA 4AKIA 3U60B 3RANA 1GILA 1T3LA 2X1VA 2DFLA 2F9MA 2IYTA 3RVBA 2J0QA 2D06A 1UBEA 4LC0A 4Y0AA 2ZI9A 3U2QA 3C15C 1KTVA 1E0SA 1NSTA 2CHGA 3U44A 1HEIA 3DO6A 5FBLB 3TJZA 3CRW1 1KI4A 3VX3A 1E2DA 4LHXA 5AJVB 2JJ1D 1OSNA 2OUKA 2YINC 3CPEA 1Y3AA 3GPLA 2Z0MA 4PANA 2ZUCA 2PMKA 4NYIQ 5KDLA 2V7QA 1QDEA 2OO7A 4FMCB 1W4BA 3HR7A 4GZLA 4TLCA 1Z29A 2GEUA 2VSXA 1RZ3A 5C18A 2F43B 3J81k 5C46F 4FCWA 1NVVR 1XJCA 1LS6A 4LRWA 5J40A 4CDGA 3EPLA 5JJLA 1ZINA 2V8OA 3MLEA 2BWJA 1VIYA 2BMEA 5HKKD 4D4JA 1XTKA 1G64A 3VNVA 2OHFA 2VSOA 1HYQA 1E69A 2QMHA 5DH9A 2OESA 3DMDA 1W4AA 1W4CA 3WNBA 2MMCA 2ZI6A 4TL7A 1US8A 4BASA 4B3XA 5JS8A 1W44A 1GDDA 1DO0A 2V3CC 4DCVA 3LY5A 1JEEA 2WJGA 4MKIA 4X8OA 4C0QC 2PT5A 3Q72A 2QA5A 2G3YA 1XXHB 5JWRA 4P31A 2NO6A 3GLGA 2EFCB 2GAOA 3VFDA 2VP9A 4LPKA 2PX3A 1QHHB 3RAPR 1NMXA 4ZCMA 5TMPA 1IY2A 4P0TA 1SKQA 4JBYA 5DSZA 1COWD 3HU1A 5FOWA 3D6TB 4OBEA 3KQUA 2RMKA 4M9QA 1OT3A 2GZHA 5KDDA 1U9IC 1D9XA 1Z5ZA 1E0KA 4FCVA 2VP5A 1ZM4A 3H2YA 1RRGA 3ND8A 5FR2A 4DLVA 1T8UA 1TQDA 2C99A 4P4SA 5AUOB 2RAPA 3MWJA 1NN0A 1XZQA 1CKEA 3VQTA 1JR3A 2W2VA 4B6EA 2WMOB 2HF8A 3EC1A 2I1QA 3KW6A 1GKIA 2IYXA 3RRNA 1XMVA 3P4YA 1KHTA 4Q1FA 2NIPA 3LXRA 2ZJZA 2LKDA 3D31A 4DZZA 2EFGA 3I62A 1JBKA 4Q48A 1KK1A 1G8GA 3UG7A 2ZR0A 2Z4RA 3BWDD 5BN3A 4KITB 3A4LA 1DVRA 1P2UA 2J0UB 1FQKA 2JA1A 3T5GA 4A36A 1N3BA 4HAXA 3ADCA 3PUVA 4V0MA 2GCNA 1TTTA 1QG2A 5E95A 2J9RA 1H8ED 3PXGA 2HCJB 1NG9A 1OFIA 1ZD1A 2OFWA 3QVVA 2CK3A 5DO9A 1RPZA 2N46A 5JI2E 1SKYE 1SGWA 4CEJA 1R4AA 1NVVQ 2PBRA 2IF0A 3IIMA 1LF0A 2J7KA 3A1UA 2ZU0C 2ZAMA 1U0JA 4BFTA 2ZRLA 4JLPA 2OCAA 5JSZA 1SXJD 2IYYA 4KSCA 5BN5A 2W0SA 1YRAA 4M4SA 2FPLA 4OI4A 3BFVA 2A5DA 4E07A 3IPXA 4Q1AA 1BH2A 4BLPA 2WVJA 4LX0A 4GDFA 4TL9A 2FPMA 3C5CA 4HAZA 2GXSA 1GG2A 1K5DA 2RB4A 2QMOA 4JLJA 4MRRA 3U44B 4JYBA 5EP2A 1NVXQ 3THWB 3FVQA 5JHHB 3THXB 2H17A 2OXCA 1CLUA 3CH5A 5GJWC 5FTNA 4A8JC 3QKSA 1YZNA 1T91A 2PL3A 1NI3A 4XD7D 1LF5A 3ONWA 2Z4SA 1ZNZA 4UKDA 1AS3A 1YU9A 2DFNA 2GKSA 3GD7A 1EG7A 2FFAA 3NG1A 1A1VA 1N6OA 1CF4A 1VMAA 2ZRFA 4Q1EA 2XGJA 3GCGA 3QY0A 4E09A 3OEHD 2CMKA 3SN6A 1EESA 4LJYA 4M22A 1DAIA 3B1VA 4US1R 3A58B 4LWZA 1L2TA 4MDFA 4QGHA 4L5BA 2CE2X 2NTYC 4JLKA 2GXQA 1EFTA 2A5JA 2PJZA 3B1WA 3THYA 4Q4HB 2AHOA 1KSFX 1IONA 4Q7JB 1N0UA 1A4RA 4D0GA 4JZKA 1E2EA 2R6DA 2CK3D 1HT2E 3SJBA 4DCTA 3U4QB 2PJRA 4KO8A 2GTPA 3P4XA 3OZXA 1E99A 1KO5A 2J0VA 2BM0A 2QNRA 1OYYA 3QI2A 4WZBE 4DLWA 5KDOA 3BD9A 3QPVA 4AD8A 1E9EA 1JQLB 2RHDA 2KWIA 1NLFA 1Q20A 1E4VA 4KYUA 1IQPA 4BLOA 4JKYA 2EYUA 1YZLA 3TKLA 1EFRA 1F2UB 4I1UA 3V00A 5H8WA 5LDDC 2JASA 2QI9C 1W5SA 2C2HA 1QHSA 2BBWA 4PHTA 5ELXA 4MH0R 4BE7B 2Q3HA 5EP3A 4U00A 1YQTA 3TMKA 1IM2A 1I4TD 4KYIB 5GVRA 2P67A 4MGIR 3MWYW 3R9IA 4I99A 3BORA 3NDBB 1HE8B 2DWPA 3UWKA 2PEYA 4LV5B 3N2IA 4X8LA 4BUJA 4PTLA 3I8SA 4DLUA 3AVUA 4C0KA 2O8EA 2BBSA 3KZ1E 4BFZA 4A1FA 3CX7A 1OJLA 4B34A 4MYTA 3KKQA 3IHWA 3PV0A 3KJGA 1P61B 1VDZA 4NP6A 3VX4A 4ZKDA 4YONB 1KI3A 2XB2A 3IO3A 3QKSB 4LBZA 1R0YA 5E7MA 3ADDA 4MYCA 2QY9A 2ZJBA 2OAQ1 2I3BA 3CWZA 3NBFA 2C9OA 2ZUDA 5H1YA 1KDRA 4FCTA 1N6PA 3M6AA 2ZE6A 5FI0B 4URXR 5CJPA 3GLHE 3ZIAD 2A5FA 3QXSA 2AD5A 3QEOA 2BIFA 1UADA 3KX2A 1ZW6A 3AQ4A 4Q9HA 3M0EA 1O3YA 4RFSB 1OH6A 1IN7A 1DAEA 1U0LA 4GZMA 2VL7A 1VECA 3NEJA 1RFLA 3LQQA 3T5DA 4A0GA 3LD9A 5FPYA 4MRVA 2XJ4A 3Q85A 2CLDX 3A37A 1R0XA 4M2LA 4W5JA 4ZKEA 5M04A 1VHLA 2CCJA 2EYQA 3CZPA 3P26A 2B8TA 2FGJA 3TE6A 2O8CB 1C9KA 1IN8A 1G6OA 3G5UA 2P5TB 5C4MA 2J87A 2XNSA 3C7KA 3SI7A 3RS3A 5TB5A 2Z6VA 5FTLA 2B7CA 2OFOA 3K0CC 4DDVA 1IN4A 2WJIA 1FUKA 1GRRA 4LBWA 4P33A 5J4VA 4NYJQ 4B35A 3CRVA 3I5XA 2RGGA 4WZ6A 1E2IA 3WYGA 5DI3B 2D4HA 3PIRA 4O0MA 3R9XA 1NBME 2ZRCA 4O3MA 4IVRA 1IN5A 2ORWA 1AKYA 3SFVA 1KO8A 4BFVA 3A8TA 3AUYA 2QBYB 2ZRGA 2GAAA 4TSFD 4PPGA 2R8RA 4A15A 3WNCA 3AF4A 3AKDA 1U81A 4ARZA 2UZIR 3B1ZA 4V0LA 1Z0FA 3KKNA 2ZROA 521PA 4XWOA 1ZM7A 2ZSEA 1IJEA 1YR7A 4P4SB 4PQYA 5KOYA 1Z2AA 2D3WA 1PZNA 1T9HA 4JJZA 1CR2A 2GHIA 2H57A 4Q4JA 5CYPA 5EE0A 4YMUA 4TMVA 3TSWA 4Q19A 1NKTA 1W36C 2GILA 4HAUA 1XBTA 4Q21A 1MH1A 2IS2A 1Q1QA 2RH5A 1GOTA 1KDPA 2R44A 5JEDA 1OFUX 2CBZA 2WJHA 1P60A 4S35A 3CZQA 4DSNA 4ZIRB 2LWIA 1NVWQ 2WPDA 3OAAD 4D6PA 2L0XA 1NBMA 1A2KC 5JMTA 2F9LA 4US0R 1C1KA 5HTKA 5L3SB 3W6NA 4WOPA 5ANRB 1XPOA 2JDIA 1VPLA 4DIEA 4RZXA 1A5TA 3ZD7A 3TQFA 5FUVA 1KMHB 2XEXA 2BBTA 2WBLC 2C96A 2DFTA 2AD1A 2ZUBA 1TU4A 3TVTA 1GNRA 3A4MA 3I32A 1RYHA 2QM7A 2PZGA 2BCJQ 4WBSA 3VLFB 2FFBA 5B30A 3LW7A 2BEKA 4M9ZA 1CBUA 1NSFA 1C1YA 2IUSA 2VRWA 2RGXA 4D0LB 1L4UA 1I4DD 4IFEA 3W8NA 4B3FX 3GJXC 2G6BA 4TN1A 5LBIA 2IS4A 3MUFA 3ZQJA 4A0HA 5G3YA 2ZI3A 1U8YA 5J4LA 1J70A 1EK0A 4DUGD 2KBEA 5FBQB 2FSFA 2HLDD 3DM5A 2DB3A 4NKRA 4N0DA 1KO1A 4IVPA 1ZP6A 1RRCA 4DCNA 1OPXA 3CNOA 5HZKA 5DI3A 4U7DA 5J4KA 1OV4A 1HTWA 3A1TA 4QJ3A 2J1LA 1W5TA 2CXXA 1GWNA 1EFHA 2DWQA 2RHMA 3CRQA 3GJ0A 3NHAA 1N2CE 4XTCS 4AWXA 3RHFA 5CB8A 3PEWA 2QZ4A 1RIFA 3MGCA 2YOHA 1NMYA 2FU5C 4KLZA 5JJKA 3L0PA 4J0QA 4QNRA 3TGPA 2VHJA 3GFPA 3BFKA 3KJEA 4XWKA 3B78A 1KNQA 1R5OA 4BFXA 2JLVA 1CJVC 2VIIA 3E2IA 3KKMA 4DIDA 4JVSB 1UJ2A 1MO5A 4V0ME 2ZSFA 3EPHA 4EFMA 1XMIA 4HSEA 4ASUD 4NPHA 2B21A 4NCKA 1FNMA 1NBMD 2WOOA 2ZQ5A 3T35A 1G20E 1XFAA 3P20A 4DB4A 3AJIB 4H9GA 3TQCA 1TX4B 2OBMA 2IS1A 2JGNA 3RDPA 1RRFA 2C98A 1MABA 4L15A 2R2AA 4B75A 5KTYA 2KE5A 1G291 1Z83A 3E1SA 4Q7LA 2KRKA 1G7RA 3CWQA 2D74A 4NONA 4D4KA 2CJWA 4RD6A 5HZHA 5KSYA 1IXRC 4PO1A 4IEIA 4B3DA 3O47A 1PLJA 1E9AA 4Q9JA 2OE2A 1Q0UA 4RVCA 4LJ8A 4F92B 3O8RA 3DOFA 1OH8A 3GFTA 3LA6A 4NDZA 3MMPA 5KYKA 2JAQA 1W46A 2WWHA 4JKIA 2ZJOA 3BGWA 1Z0IA 1T5LA 2C03A 4URZR 4CEIA 1E94E 4D82A 1XXHE 4M1WA 1G4AE 3QNUA 4AY2A 2CLCX 1EFRD 3O8CA 1HQYE 1S96A 3GLFE 4G3XA 2ZRMA 5JS7A 4PAOA 4D2IA 4B47A 4CT5A 4EPTA 4IDQA 3B13B 3ZQ6A 2B8WA 1E1RA 4YXWA 5GVSA 5TV2A 5BW8A 3W8RA 3K09A 2QUZA 2R6FA 3PUYA 3KXLA 2CL6X 2NOAA 4KVAA 2ZRHA 5H70A 4ACAA 3TLXA 4BEBA 5KHOC 4TL6A 3REGA 3VNUA 3KQNA 3MCAA 1E2FA 2AXPA 3QXCA 3FMIA 4C0SA 4C7OB 1Q1ZA 5AR1A 2F6RA 1MRNA 5EJEA 1E2GA 1TPZA 2ZJAA 2G0TA 1M6NA 5HPYB 2ORIA 5FL3A 5CITA 2QBYA 3ZH9B 2VH5R 1G18A 4DSUA 1CJMA 1J8MF 2V7QD 4BLRA 3ETLA 4UXIA 1HURA 2PZEA 3SQXA 2ZTSA 2D62A 4GP6A 1ZUIA 2VP6A 5FBRB 2ZREA 3ZZUA 3TUJC 1OFTA 3U5ZB 5DN6A 4A0FA 1RJ9A 4D26A 2IW3A 5SZIA 4M1KA 3IO5A 3FFAA 1U98A 2D2FA 1VYTA 3ZIAA 1DELA 1BOFA 4GL2A 2DR3A 1E2QA 3FHOA 1OIWA 4HZUB 5CJ2A 3THOA 4OK3A 3SJZA 3Q5EA 4Z1MD 4LV6A 5L8VA 2H92A 1QHHA 4TZ0A 1R10A 4LJ7A 1JJVA 3AF1A 2ZE8A 1XWIA 4G5RA 4MITA 3AVXA 3VU9B 4U5XA 3D7MA 1ZRHA 3BE4A 4K81B 2HUPA 1UF9A 2F1HA 2BV3A 5JSZB 5EE9A 1J7KA 2EFHB 4LC1A 3A6PC 3IEUA 3U6KA 2J7PD 2WWXA 4LSGA 3CM0A 3W6OA 2ZVQX 3K8YA 2CL7X 2GJAA 4NTZA 1ZMXA 2ODBA 1E9CA 4LYAA 2P6RA 3PG5A 2OEPA 4V0KA 5CDFE 3OE7D 5HKKA 2ZYUX 3T34A 3TR0A 1FZQA 4DEYA 1T3HA 5SZHB 3GLIA 1RYFA 1E2LA 3H0KA 1BYUA 2FEOA 3AVTA 2GCPA 3KJIA 4S2EA 5DHAA 4ZDWA 1Z6AA 4ZI2A 5JWOA 4LJ9A 1GFIA 1OIXA 2OFXA 5F9FA 2FGKA 4HDQB 2V4ZA 4HAVA 1QHGA 3ASYA 1FX0A 1G17A 3LX5A 1GRNA 3KQLA 3I92A 4XOIA 5FTMA 2NMVA 4JLNA 4I81A 2O8EB 3CF0A 1P9RA 4EPVA 2IEYA 2GWHA 2TMKA 3SBEA 4OKSA 2AWOA 5G53C 1P2TA 5DN6D 3MG9A 3AM1A 1G21E 5E7IA 2WWYA 1ZIPA 5FH9A 3DL0A 4OQLA 1Z63A 3SDZA 1DS6A 2BKUA 1GL9B 2MMGA 4LYFA 3PENA 4Q03A 1XJQA 2IXFA 1DO2A 2QAGA 1JR3D 3FDIA 4IJMA 4B74A 2CVHA 3RSLA 2IUUA 4E22A 4LCBA 4JLBA 3EZ2A 1S4QA 4Q7KA 3ADKA 3U7FB 1XZPA 3CR7A 4TMZA 2HT1A 2OBNA 5G40A 2J0SA 2ZRJA 4QM6A 5AJZA 2G1JA 4HDCA 1TQ6A 3K09C 2VLIA 1W49A 1CJUC 1A2BA 4JYCA 2ZRDA 3NTUA 4BLSA 3SZRA 1NVMA 4YDHB 1PV4A 3VR2A 2OCBA 5H68A 1KOFA 1SQ5A 1QRAA 4EFNA 2SHKA 2GJ9A 4PHHA 3PVSA 1G7SA 3HWSA 2J3EA 1CRQA 4DHEA 3RRYA 3K70B 4NCJA 5EXXA 3KKPA 2H16A 2OLKA 4DEXA 2V9PA 1KKLA 2AKYA 3NIBA 2CCKA 2R65A 2ZEJA 3KB2A 4OK6A 2X2EA 5EZ6B 1EWQA 1GNQA 2IEZA 1YE8A 4RFVA 4HUQA 4QBHA 4GOXA 3K70C 1XF9A 1GNPA 2IYRA 1DAMA 3OHMA 3GLHB 4G01B 3H84A 3R9WA 1WCV1 3DEFA 4W5HA 4HATA 4P4UA 4BZQA 3SE0A 4Q9LA 3SU8A 4QM7A 3FTQA 2XZOA 5C2JB 4NBSA 1UDWA 3UMFA 2GDJA 3RC3A 5B58C 2C5LA 2OV2A 2P0EA 1Q1EA 4ON9A 4IEEA 1OB2A 4E03A 3LRPA 1IOZA 4DT1A 4D80A 4IOLA 4QKQA 4RD3A 1TNDA 1HA3A 3A4NA 3QVUA 4EJSA 4KFRA 4A6PA 3B85A 3L8YA 3PEUA 1Y63A 1WF3A 3K9GA 1GKYA 2DWZB 3WP0A 2ZE7A 2EQBA 2BMFA 2GEDA 2BCGY 1YKSA 1WXQA 4BZPA 1WRBA 1CULC 2NG1A 3WYFA 4N1AA 4M1MA 4MGZR 1N6KA 4EPRA 5JZVA 3SOPA 4V0OA 2XTNA 2MSDB 5EXTA 2X2FA 3GP8A 2Q9AA 2HLDA 4MA4A
chains in the Genus database with same CATH superfamily
2EW1A 3E61A 4RPKA 2ZXEA 2G08A 4K3VA 3EC2A 5EIBD 1E1QA 3DBLA 4I6GA 1V33A 1REQB 2XMPA 1BZYA 1IBRA 4QRIA 1XPUA 2CJFA 4CIYA 5ADHA 3IEXA 1A7UA 3JW8A 3IX7A 2G5GX 1Z4IA 1L8QA 1ACJA 2HX1A 3K9NA 3IHKA 2BTQB 3SVZA 1GPDG 1RAIA 3QJGA 2UVQA 5K8VA 2K6BA 3IMCA 5JFTA 2GBCA 3L2OB 4N39A 4WDRA 2CZCA 5CLIA 3RVLA 4HNRA 1ARZA 2GRUA 2PRIA 3CO5A 3RE8A 2WWVD 1IDN1 1M7GA 4YMTA 1M2KA 1T6ZA 1LDNA 1P80A 3D6UA 3DXFA 4J7XA 5IAGA 1K5GA 2CLKB 4KQWA 2ZPAA 4NZYA 1GPH1 4RIFA 2HWXA 1BWSA 4EP1A 3VYWA 1P1KA 3KM0A 1XHEA 4Y2HA 3QLUC 1A9SA 3H4IA 4ZOEA 2FHPA 2DAGA 4HDMA 4DPKA 5IYZB 1UZLA 3L4KA 1YBMA 5EIBC 3BZUA 1P3JA 1I32A 4CISA 4MCIA 5A6VA 3AOEC 2LHCA 3OWHA 3I28A 2PUJA 4L6CA 4O2BB 3PPXA 4QBTA 4D0NA 4EKEA 1VLJA 3PDJA 4UXHA 4TZ6A 4MHTA 1XQXA 1YKFA 5LBUA 4CGZA 3PEFA 4Z8YA 1JQKA 2AZTA 4BO1A 3L82B 2JANA 2X22A 3WDLA 2O8NA 3DMTC 2WC1A 5L6LB 1VBMA 1G55A 2GZMA 2Q6OA 2FFHA 4YCSA 4ZJYA 3CN7A 5TVGA 1NXVA 2Y76A 4BEWA 3EXG1 2GCEA 4XA8A 4BQRA 4C22A 3D02A 1UMDB 1PFQA 3MNFA 3Q7QA 5MDHA 3E23A 3TAUA 5K03A 4OHFA 1MG0A 1U2GC 1AZSC 2CVFA 4BLQA 1OA1A 2CJYA 3E6AA 1CJTC 2KW5A 1ORTA 4P1ZA 1L5KA 4X6XA 3FD9A 1JHZA 1XPRA 4RMGA 2AQ8A 2VQDA 2X1LA 3PITA 4WJKB 3SFZA 1V45E 3ITEA 2J5QA 3B6MA 1XMXA 3GVPA 3PQCA 1T36A 3SC2A 1SBZA 1LWOA 3GZ4A 3W5VA 1O96A 3K30A 3L7IA 4X93A 3K0FA 5DM2A 5B7GA 4ZPJA 3DLHA 4J43A 1BIFA 3SK0A 4BO9A 1YZYA 1JFSA 2ZIXA 2NXJA 2XEPA 4Z4IA 1V39A 1XQ9A 1PT9A 2YXNA 4G5YA 4LGCA 3KCQA 3AIOA 4ZO4A 5HBRA 2EDCA 2IF2A 1OPRA 4GR5A 4LF8B 3D3EA 1CY2A 2QRGA 1GVHA 2W6CX 2CHVA 4IDPA 3K16A 4F2HA 1QCDA 2X9NA 3MLBA 2GBFA 4FKBA 5I5EA 4M54A 3QKTA 3VR6H 3MHVC 2R2GA 4AJJA 1CQIB 2HN9A 4KGXA 2QX4A 3QF4A 3FFTA 1SAYA 3WADA 4G4OA 3JAKA 3ZXXA 2UYHA 4L8LA 5AFSA 3E0QA 5CBKA 1ABFA 1CU1A 1MO6A 5LXTF 4NE7A 5BN4A 3EPPA 3R9KA 3MFQA 2IOFA 3QVWA 4WECA 5F78A 4DARA 5KPZA 2ZW9A 1A4IA 1PR1A 3N3AC 2XE6A 1GVNA 4EHKA 1WXGA 4EW6A 5DM1A 4BEVA 2CB9A 2GN0A 2HSDA 3WK8A 4EEXA 1EP2B 1E0DA 1H2AS 5DHUA 4MO2A 1VXOA 2N0SA 3EGDA 1TUIA 1ZSNA 3IJ5A 4DBVO 5CFRA 2XI4A 5FUWA 1KI8A 4PVDA 2EX4A 2OV6A 4TLEA 2WJZB 3NS7A 4Y6GB 2WU0A 1FF9A 5GM2A 1AA9A 1NU6A 2ATEA 3KV3O 4PYLA 4LJLA 4RTNA 1FDWA 1PJ8A 2FX5A 4IXMA 1KYQA 3SMQA 1BTOA 2F1KA 1HE5A 3IT2A 3L01A 3A36A 2GBLC 4JB8A 3T4UA 5B57C 1I2CA 4Y2VA 4FYKA 5DGHA 3VKUA 2JAHA 4R68A 3VSEA 4UN2B 5LP1A 1J2UA 2P6OA 3CG4A 121PA 2IIVA 4N0EA 3T4XA 4AKGA 2Q5EA 4OA8A 3JWPA 4K2AA 2QQ8A 3TZLA 4CL3A 4D8UA 4AG5A 1TRKA 1GU1A 4Y6OA 5KYYA 1V92A 1A8SA 4PLYA 5TLSA 2BGKA 1G3IA 2EP5A 3H86A 3NVMB 3KBBA 4FGSA 4X85A 1N57A 3MTAA 2A5YB 3K05A 4N3BA 2JLYA 1EFCA 3BGOS 1IBSA 3TI7A 4MKGA 1ZVKA 4HH1A 1WUTA 4WK4B 1IEQA 5GMOA 3AI7A 4MRPA 2UV8A 2WD8A 3IVGA 4LV8B 2NU8A 4DM7A 5KYUB 1NI4B 5CM9C 1ZBDA 1WTAA 3HJCA 1FMLA 1SKUA 4DYVA 4MKZA 3U60A 1JEOA 1PV1A 2HDWA 2WF7A 4WKCA 1H9CA 4RH1A 5CFOA 2ORED 4Z51A 1CUHA 3VO8A 4JLDA 4PXAA 3SHTA 2D7DA 1YMQA 1RYZA 2CGEA 2AK3A 2J4CA 4AKHA 4G2NA 1F4VA 1DKQA 3J2PB 10MHA 1USIA 4PV7A 1E6UA 3FAKA 4ZAXA 3DMFA 1KWKA 3FD8A 4ABTA 3O8QA 1P62B 1D6SA 1OXBB 3BWBA 3AIKA 4K1LA 4O2BF 4Q02A 1BX1A 2J9YB 4Y2YA 2HSJA 1UFQA 2E4AA 3KJNA 2MU1A 4L9SA 1Z26A 4OTZA 3T6KA 1VPEA 2IBTA 3EC7A 1VMEA 2OHJA 3CMMA 3MBKA 2BFDA 2BUBA 3GRPA 1IOWA 2YC2C 1BS9A 4B3JA 5KNDA 1FP4B 4EOGA 4TTRA 3ISJA 3ML1A 4DV1B 4HADA 5JCZA 3QTLA 4IX1A 2WMNB 3S1SA 1X7ZB 1YF3A 3OE5A 1JE1A 2IV7A 1E2JA 4FZJA 4ZVRA 3WB2A 3RGSA 4RHUA 4EB8A 1H4QA 1XMSA 4JV5B 1A5SB 1LCIA 2LCFA 3ZNNA 3NBXX 1YIOA 3QMMA 2CD9A 1DJMA 3M83A 1U3CA 2I33A 1N5MA 4PGAA 4ITVA 4JJ8A 4M0LA 1LPMA 1O97D 1TMOA 1CUEA 1X7DA 2P27A 1E6LA 2ZOSA 3HJNA 4KBGA 3SSMA 4X62B 4N7MA 2J3DA 3MS4A 4UVGA 4Z4FA 3OTQA 3L8FA 4CKWB 2YH2A 2F55A 1TC1A 3A42A 3IHLA 4BZXA 5HHTA 4HDNA 4R98A 2I76A 2QYSA 4V0QA 3MLAA 4AZ0B 2UZ1A 3U5ZA 5FJJA 4AQ7A 4OLBA 4QDUA 3VPXA 1GITA 3ZWMA 3C58A 2QCUA 4RE6A 1FDOA 4KGVA 2XFSA 2GBLA 3GN1A 4KJXA 3RIXA 5CVTA 5HJEA 1MLDA 2PMWB 1JYFA 1O58A 1BDJA 4MR9B 2JD1A 3A3NA 4IDGA 4Q4AA 1T5IA 1BCSA 3HU2A 2JCSA 4FWHA 2QJWA 3CU5A 3NYIA 4IG4A 4BUZA 1U8EA 8ADHA 1G3MA 1REQA 4WV3A 5FDFA 2F1IA 2VPZA 1CTQA 3SYLA 1G41A 3U3KA 1P73A 3IUMA 3WLFA 1SY7A 3UB2A 2FEXA 3L46A 1NW4A 1JIXA 3AY7A 4CHTA 1DQZA 4MKXA 3E9RA 4KQJA 2OO3A 4E4RA 2PYZA 3SAUA 3EIQA 4EJ2A 2P3OA 1JLMA 2V7TA 2XWSA 1D1PA 1M5TA 1HQCA 4RPHA 2Y92A 3BVPA 3CX6A 3NX4A 1YH3A 2I4MA 1QIGA 3LWBA 4RU1A 3RNOA 4F86A 1IHOA 2B78A 1SEVA 4D4HA 1K6EA 4F38A 1EXDA 1JU4A 3CG0A 1CUJA 3O84A 5ABPA 2Q62A 4XUGB 3B8EA 3X1WA 1YJAA 1XMOB 3KWFA 3AUFA 4PO9A 5J4HA 1QZXA 3D8RA 3U1VA 4OLAA 2Q1SA 1GAQA 1KXJA 3SX2A 4ZU6X 3VTFA 1GUAA 2GPJA 5E3HA 1F1BA 4EGJA 1IHPA 5FWAA 1D04A 4CKEB 4JB0A 4EB3A 3Q40A 3VKVA 2VF2A 2XB8A 2HQBA 1XU4A 1AGPA 1QH8A 2FPGA 2O3QA 2XNKA 3BFPA 2O2ZA 5B1SA 1G2QA 3PDHA 4P17A 2RHCA 4MVWA 3U1TA 3ZIUA 2RI1A 1E2MA 4OVZB 4MW1A 1BKSB 2WUGA 1XXLA 1QV9A 2VHXA 3AO0B 3GDGA 2R4TA 3WIDA 4L8GA 4NV3A 3G2MA 3PICA 3WIEA 3RVMA 3K5HA 4C9BA 1SCAA 3OTHA 3QKIA 4FYMA 5ADVA 3T9CA 2IZ0A 1E3MA 1S9HA 1MFZA 4YV2A 5JZBA 4MV9A 3SSAA 1IIBA 1EXMA 2WYUA 5FWNA 4LF6M 5T3UA 4ESEA 3OLVA 1Q1GA 1XYGA 4YXFA 3U7JA 1NFRA 4OJKA 5FWYA 4IZ6A 3B82A 1E6MA 2ZYVX 5THKA 3G1UA 3NH6A 4F21A 3PFIA 3NM5A 3DB2A 3HDTA 4MVJF 4IWNA 5K8JB 3IFSA 4HGYA 1BVHA 1ZMRA 3S6JA 3CBQA 2Q6IA 3RC7A 3KNZA 2AEJA 2NQ8C 1EFDN 4O2AB 3DO5A 1KETA 4OHMA 1JQ5A 1Q11A 1EDEA 4XRGA 4RY0A 5AJYA 4IHJB 1M74A 1SBIA 1UJMA 1JAXA 2IX3A 4EI8A 5HOEA 3M2TA 4PSAA 4ZJZA 4ARBA 2QP4A 3QA9A 5AVRA 1GLGA 4DB2A 3CW8X 4U7WA 1YC2A 1GPKA 1M2EA 1EGQA 3N70A 2YRWA 3W3AA 4UHHA 3FSGD 5CA0B 1WMAA 3JQRA 1U6JA 2IBMA 4YAUA 5BMOA 3HNPA 1XD8A 2XCRB 2EJWA 1P2DA 2OGZA 1QDRA 3E4DA 5JECA 1T8WA 3CNQS 4UHKA 3BQMB 1IQRA 5KQGA 1B8OA 1DGHA 3CLRC 5LP6B 3HV2A 1HLPA 1C9JA 1N5IA 1O57A 2HSZA 2Z30A 3CTMA 3GLKA 4QARA 3UJBA 4BNHA 2QTMA 2R8OA 4MGKR 5JYDA 2G8NA 2IBSA 4ER5A 3G3EA 4WCFA 1CNMA 4PSUA 1NOIA 4Y2QA 1PM5A 3RFXA 4DR2M 3JQ7A 4REQA 4N40A 4MYHA 1C30B 1UZNA 3W90A 2WYVA 4Z9XA 3NPMA 1HO3A 3CX3A 1Z5NA 1XU9A 2IJGX 3P1JA 4JBLA 4WQMA 1OOEA 3RVOA 2LV8A 1ZD4A 1D4AA 4YJFB 2GCOB 5EZYA 4FC7A 4EO4A 5JHGB 2A86A 3EAQA 5DNYA 3EF3A 5T5QA 2ID9A 1KHHA 1TVCA 1LK5A 3N2NA 3WYBA 3DCJA 4MYUA 2GETA 1QC5A 2GEBA 1YR9A 3FMOB 1B26A 1NKSA 3C8UA 3TDKA 4C06A 4ZT5A 1LFAA 2ZRNA 4WFQA 3HVHA 1WKBA 3I9FA 3RLFA 4ENQA 3C85A 3TLEA 2ZUVA 2ZBPA 3LVBA 2J6HA 3THGA 2PMBA 2H7CA 3MMNA 5SYMA 2HQSA 5A4JA 1QVAA 4MS1A 4DZRA 3KVWA 2O2IA 5K0NA 1KMCA 2VYQA 3GJ3A 2H6EA 4PGFA 3MWFA 1SKYB 3TL2A 2H52A 3B51X 3PR2B 4AZ3A 3CH7A 2F5OA 2V4UA 1XPJA 1KEEB 1C0LA 1Z0AA 4HTFA 5BWLA 3IUYA 3YASA 3FB1A 3NKLA 5I47A 5HTOA 1W0CA 3BEDA 2F59A 3A1CA 1DCKA 1W25A 4ZXPA 4YT2A 3OPMA 3W7VA 3NAZA 4ID9A 4TV8A 2BFFA 1OBCA 3HU3A 2BEUA 4UQPA 3UMSA 4AJHA 2R6ZA 4OBWA 5DK4A 5IKXA 3SJAA 4Z7OB 3BHJA 3VR6D 2AR0A 3A6JA 1Q2UA 2Y0PA 1YDMA 4LYHA 3ETNA 1WR1B 2UU9M 1ORIA 2FSVC 2V55B 3IBSA 4Q7MB 2QLMA 1P2SA 2GHQA 4WLOA 3HDQA 3TR5A 4DUPA 1T8RA 4DCCA 3MD0A 1HGXA 3L8EA 3OF2A 5BYBA 2PA0A 4D25A 2FZ4A 1H6DA 4BB6A 2YXDA 2WA2A 1DHRA 3DBOB 4UVHA 2Y0BA 4MQLA 1C7YA 1A7AA 2FMXA 1M2VA 5EERA 4QREA 4CG1A 5KNBD 3L4JA 5JU6A 2YNMC 2AFHE 4Y9RA 3DG9A 1GGNA 3NHKA 2QZ9A 4QPNA 1LLFA 2HCFA 2C97A 4Y1GA 2KBFA 4AMVA 4CLEA 1WBBA 2VJMB 3TZEA 4D6YA 4JL8A 2P6PA 1WB5A 1GSAA 3WR5A 2RKWA 1TM1E 1IB6A 3VZRA 5CVCA 2O8BA 3L04A 4DIMA 2FZWA 3MPOA 2FQYA 1GCIA 2FNAA 4UNQA 1YFLA 4IIGA 5DT9A 1Y6QA 5PNTA 1NYRA 3JQ7B 2BLNA 4REQB 3VJKA 3ZJYA 3GUCA 3NHYA 1XTVA 1T24A 1ZC4A 1RTTA 4G4JA 1KSJA 1EVEA 2HJGA 1SVSA 3LVRE 1NRWA 1TO6A 2BM1A 4HLUA 4Q37A 1KRHA 2DQZA 1KAOA 3FCCA 1Y8RA 1HETA 4G1VA 2XAUA 2O4CA 3K96A 5JDCA 3IA2A 1POXA 4AWBA 5KVAA 1T34A 4ESHA 4LYDA 1D03A 3ESAA 3KYIB 4O2LA 1DPFA 2EBHX 4A5OA 2P35A 4KCGA 3GFSA 1ZEJA 3QRWA 4R9UC 1E2PA 3LLCA 1RPJA 1WHCA 3LVFO 1YDEA 1X8LA 5A4AA 5ADUS 3STWA 3LE8A 1P4RA 2N75A 2DUWA 5JFGA 1NXTA 1Z5PA 3WXMA 1RJFA 4IQ0A 1IOLA 3CE6A 4JFAA 3N8KA 4B9AA 3OLZA 5TMPA 2XUGA 3Q5DA 1W59A 4JD5A 3LS2A 8ABPA 1A8QA 2WNIA 4BCBA 4PD2A 1U3WA 4XAQA 2XE4A 4LGMA 2QVZX 1JBEA 2IUFA 2X3YA 1FTNA 4IGKA 3NNNA 3NGMA 2OR3A 2P9FA 1ZAKA 3MPUA 3HA2A 3EISA 3GJ6A 4JGGA 4TS4A 3WHPA 4NL4H 1CUGA 4QFCA 2WM3A 4X8MA 2XQJA 4N01A 2ZDQA 1Z4PX 2RAFA 1J5EM 1ESEA 4TTAA 5DHTA 1R9JA 2GLXA 1THMA 1ORWA 1KVTA 3FPAA 1EA5A 3GRVA 2WP0A 4YP1A 3U3RA 1UBUS 2IPMA 3F7TA 2XBUA 1LDYA 4KFSA 4Y2SA 1QP7A 2LWXA 3I2FA 2OV8A 4XWYA 3V7YA 4OGLA 5KYYB 5HS6A 2DENA 2HIHA 4O4JB 4QQKA 1QYCA 1KEZA 4HPWA 4NABA 4HVAA 3MWKA 2ZRAA 3O03A 1J0AA 3IVAA 4C0BA 3USZA 1RQPA 2O3RA 1QO9A 4W9NA 4F84A 1AX9A 1F38A 1FLDA 1NBWB 5TY0A 2EDAA 1RXVA 1XP5A 4BQSA 1HDEA 4M1SA 3TQHA 5DYGA 3HXTA 1J1IA 1ZKDA 2PT9A 1XZJA 4QEDA 1ZNYA 5EZSA 3FKSA 1Q50A 1R27A 2F17A 1OKSA 3QWFA 4ZRNA 3RC2A 3E46A 1M9NA 5K01A 5DLPA 1SZDA 4OKNA 5LA6F 2GEJA 4FD2A 4HB3A 5FD8A 4BNGA 1N8NA 3P45A 2I1WA 3IILA 3PC6A 3L6CA 4Q5IA 3EZXA 1MU5A 3WRVA 2R4UA 1BCRA 4D9NA 3L49A 4PEVA 2AYZA 1H0KA 2FK7A 3D8NA 3OJXA 1P7CA 2YFHA 1UKYA 2I65A 2VJQA 4ZT3A 1JDBC 3LC7O 4HKTA 3ES9A 2XVYA 2YDYA 2ZIZA 4PGGA 4HNAA 2H54A 5BXQC 1JH9A 4OIFA 2VYFA 3RHZA 1PTKA 1BAPA 5FPHA 3CQ9A 4RFSA 4EVSA 3JQEA 1Q1NA 4FHFA 1I3MA 3M6LA 4LIPD 4XVUA 4Y2GA 2EAUA 5DFLA 3I51A 4OP1A 3IOMA 4Q6WA 2J08A 2E4YA 5LQNA 1FK8A 1ZH6A 5EHQA 1L7BA 3BGDA 3D8TA 3K2QA 2GJKA 4ZQIA 3V7FA 5JIBA 5KWVA 1ZIDA 2VXOA 3KT6A 4UHJA 4XYMA 4CPDA 1YQWA 2YXLA 4I1PA 4CLHA 3X1KA 3DTVB 4RKYA 4S0XA 1JKXA 1YZKA 2Y1XA 4NMWA 1KSHA 2PFGA 3MYRA 2XGGA 3RASA 2NP6A 4IV5A 3PZRA 1ISRA 1FUUA 2C1XA 4P3XA 5G0UA 4CM9D 4MHOA 2W83A 2BSAA 3M4JA 4W7SA 1SC1A 3SKXA 4ND8A 3TRDA 3TWKA 3OFNA 2PVPA 1NIJA 2HREA 4MEJA 2FN9A 2X23A 2W48A 2JKZA 1U63A 1RZUA 1JEDA 1K3TA 2BFBB 2FSPA 4UREA 1X13A 1DJQA 3RYIB 4C0XA 1IEXA 1SO8A 2WSIA 1N5LA 1O5TA 3R2JA 4OYRA 2FSIA 2C9MA 2Q9UA 3CMCO 4GM4A 5EIFA 3U3DA 3FOCA 4GLBA 4TWZA 5JI3E 3ROXA 3NBMA 3VSDA 3ZVNA 1CDOA 2FFQA 3LNCA 3R8CA 3WRYC 5MF6A 1U0TA 1VP3A 3EXHC 2ISQA 4NOMA 3W3AD 3KLMX 1BCSB 5IG2A 3FHLA 2WIFA 3DAGA 3PVCA 4FB4A 2X13A 2OCXA 5EI5A 5T4BA 1K7FB 1XX6A 1Z0UA 1Q83A 2XDYA 1MUUA 4R2IA 3VKWA 4EAAA 4BVBA 4MGYE 4QDOA 2JLUA 5DNEA 3IAXA 2GCGA 3J81A 3IPLA 4LGYA 3TZHA 1J4AA 2JGIA 5FTJA 2Z56A 1L1RA 1DMSA 3T95A 4MWTA 5AK4A 4QOZC 1Y4DE 2W5UA 4YFVA 4HLCA 5ALSA 3BJRA 3IAS1 1W85B 5LMNM 1OXTA 3KQQA 2BELA 4Y9UA 5DRTA 1OXXK 2IYQA 5F1PA 2ENUA 1EDBA 4WK0B 4QPCA 2JLQA 1JX6A 1Q12A 2F3UA 1UQTA 4LHWA 4PX2A 1NUTA 1WHTB 2WSYB 2NW6A 5ALEA 4B9EA 1S89A 5D2CA 1VI5A 5EQTA 3JZAA 3THRA 2CDAA 4PN3A 2PK3A 3VHLB 5LU8A 3VBCA 1MAVA 3EXAA 2OCGA 2X77A 4AKEA 3K71B 4IO0A 4ZVVA 1TPYA 1O54A 2O0KA 1U8TA 3B60A 1G5FA 1QB7A 4H35A 1NI4A 5M3BA 4BECA 4F91B 4RY2A 1B1CA 1GYPA 2A14A 1QRDA 4DR6M 2C3UA 1W87A 4KQHA 3T3IA 5HK9A 4TYMA 4O1MA 2X0FA 3L7YA 5TGTA 1QF9A 1NA5A 4GOLD 3GMIA 4M86A 1Q22A 3MT8A 4LCEA 3GEIA 1BS1A 4BYMA 1V9SA 3FMGA 1HDCA 4PFSA 1RKBA 2OSVA 4AP6A 4FJ0A 1XL0A 5AK0A 2BEWB 2WQ7A 2H4FA 1JZSA 4RULA 4J94A 3ZGOA 2Y4NA 2JAXA 1PVOA 3QIVA 3F5FA 3LMMA 3JATB 4GVLA 3V2GA 3V8RA 1DPGA 1TOAA 4QG3A 3CVVA 1YR1A 1C7RA 1L4FA 4O1IA 5LB2A 2HDNB 3B74A 3RTDA 3GT4A 1W4LA 1Z4MA 2V9ZA 1FRVA 2RGAA 4C78A 1CY1A 5KSOA 4R71A 5KQ8A 3AG5A 2N9UA 1M83A 1YK1A 3NKVA 3W5UA 3UHFA 1A5BB 1KJQA 4U6NA 4W1QA 4RD2A 3FWYA 4B84A 3DNMA 3GFBA 3HCRA 4QQRA 1A27A 4G4RA 4QHYA 1SUWA 1F6BA 4EY8A 3LBHA 3LPDA 4DKXA 1PQYA 5CB4F 1OYWA 3UGTA 3G0BA 4GI5A 2Q3DA 1AIPA 5JPCA 2F4VM 3TBFA 1D4ZA 2VDOB 4EY3A 1FDVA 5ESRA 2D0IA 4B4VA 2UXDM 2BZSA 2LXEA 5CM8B 4WXMA 3S7ZA 2HT6A 3AL2A 1ESCA 4BRUA 2ZTLA 4CEHB 4MGZE 1PJ2A 3W2FA 4RMHA 3F4KA 2FMFA 2UDPA 2H4YA 1U5BB 3B89A 3TRKA 4W5WA 4GKJM 3AYXB 4UHEA 5CLQA 3VH3A 1QIJA 4UFPA 1TA4A 3VKGA 1MOSA 1GNTA 2YWGA 3C3XA 4V2UA 4E11A 1YVRA 1ULAA 4RJLA 3MJ5A 5AMXA 1DXYA 5EQDA 1BEEA 2H1WA 1BWPA 5F77A 3GPIA 3EVNA 3BDAA 3PC8A 4L76A 1VHTA 2WWWA 4YRLA 2IWRA 2W6JD 3HJTA 1ZW1A 2AN9A 1ZGBA 1RJDA 2V6IA 3SHFA 3EZFA 4UNRA 1DO8A 1XRNA 5LLSA 3ABZA 2J4FA 3TZCA 4P34A 2C5BA 4G4IA 4OXKA 2C57A 4NDAA 3NOQA 5G4KA 4JL5A 5AIBA 3K9PA 2O59A 5L51A 5K8TA 1W5EA 1RYNA 1ADYA 3QPBA 4ZTUB 1L3CA 3H75A 2WNSA 1VBFA 2MSKA 4LXHA 3NYWA 4GP9A 1Z8DA 1RP7A 3BMQB 4ICIA 2OHHA 1CIPA 1EWVA 1YFZA 1L3BA 2DAPA 4JUCA 5IJZA 4DV6B 3I01A 4IVQA 1U7UA 5CH8A 1F3OA 5CLLA 3H9CA 4MKRA 4BP9A 3FNRA 5DYIA 3LSYA 1C9NA 1KS2A 2MYNA 5AKXA 5DNYB 3PI7A 2JDID 1G20A 1BWQA 2JS7A 3B6EA 4J2OA 1V16A 2EG9A 3VH4A 3S5UA 5KWJA 4DUYM 3Q0IA 5C34B 3UAVA 3RUDA 4J0DA 2Z5LA 3HCCA 2OP1A 3AM4A 1C7JA 4G8DA 5ITZB 3BA1A 2QRHA 3QXXA 3EAGA 1PFWA 4L07A 4MAAA 4JYAB 4LOAA 4AYTA 3DZBA 3HQ4O 3LHKA 3VM6A 4YAOA 3OETA 1XVVA 3VYRB 2YN4A 5HCNA 3WI7A 4R7ZA 3O8NA 5K2MA 2QLLA 2QZSA 2OBLA 2PZFA 5T6BA 3MB8A 1WMDA 2ECKA 3PCRB 1R0RE 1JB9A 4LTDA 3ZDBA 3ABOB 3DQZA 1ZMTA 3QYJA 3UH1A 4JXXA 3DBRA 3E2MA 3REOA 4JIMA 2IDMA 4P92A 4BS9A 3C3AA 4DIUA 1NHWA 2X0JA 1Q02A 5AI6A 2P2ZA 5D5HA 4A92A 2QORA 4WURA 2V5UA 3QU4A 2A30A 4HAYA 1U5AA 1VA5A 5DNAA 3TLGB 4KO1S 3EVAA 3Q2OA 3AKEA 4HDOB 4IIEA 1FQOA 4G25A 4NRVA 2BGIA 2YX1A 3S2GA 3TLCA 4COOA 2PO7A 1X1BA 2GVZC 1MQAA 2RGWA 3AL3A 2F3QA 3FFBA 3NTLA 3ADPA 4UUQA 3RQIA 1NYTA 4YVFA 4PYMA 1LV8A 1Y6FA 3AP2A 4F3CA 2KZUA 5JAOA 3HUEA 4IXTA 4GE0A 4RJ2A 2O3JA 1YLAA 3E1KA 4ACBA 1RVDA 3FJOA 5GJVC 2P4SA 2WHYA 2QP9X 2FEAA 2WPNA 4LK2A 4JASB 2NO9A 3CRRA 3H17A 3L93A 3PXUA 1M2HA 5DWVA 2P65A 3M5WA 1KJJA 3O4FA 2X6TA 3LMKA 3H5OA 4DYHA 4DCUA 5BORA 4HXGA 1SC3A 2QAJA 3RSGA 5D3QA 4XGKA 1C9MA 4W5RA 5F2KA 4LAFA 1LD3A 2EIHA 4L9RA 4PC3A 4TM8A 5JAHA 1T26A 5CHEA 1YZGA 3T61A 3WGTA 2OOSA 4JQSA 1E5LA 4HPJB 5ICMA 1R6BX 2MHCA 1D8AA 1XZNA 4AJEA 3IUQA 4TGLA 2IY8A 2CF5A 2GO1A 1LDBA 2P6MA 2YUTA 4FINA 5FYQA 1IHUA 4QBGB 1WAMA 5AVWA 1ECLA 3OFSA 4B4DA 4CIDA 4CR7A 4E08A 2J9FB 2X4IA 2BFBA 1FXWF 4JODA 4OY3A 5C37A 2OQVA 3M8KA 4WK6A 1ECFA 4DQLA 5C1OA 4MUFA 3DAHA 3GQVA 1Q74A 3O7MA 3QU2A 4IJVA 1Q0HA 3MWGA 3RUFA 2AK2A 2ZCUA 2IOQA 1VCIA 3UKOA 4UW9A 4JVLA 4X54A 4BVGA 1K3UB 2WAMA 2QN6A 4UNSA 4DVGA 2ZYIA 1S2IA 2H5EA 2PGXA 2QX9A 3GA0A 4UZFA 5JRZA 2DM6A 3QX7A 4UAJA 2GWRA 4HCJA 3JQ6A 4M49A 5IP5A 4X1YB 4YO8A 1QH1A 3MTIA 1T0IA 4KTTE 4B79A 1TDJA 1M54A 4K6OA 3TW8B 4DT1B 1MAWA 4LZZA 2B8NA 3PHLA 4UDOA 5KC8A 1KMIY 2AEMA 3K3PA 3AHIA 1R8YA 2DQ4A 4Y7CA 1PR4A 2R45A 2XXBA 3C6XA 1U2DA 2H2DA 4PHCA 3U6SA 3R7WB 5K45A 2XTZA 3P9PA 1U0OC 4N5HX 3OLQA 3UJ3X 1M2JA 3F92A 2YHBA 4PZ9A 3EDQA 3NT2A 2JVKA 3QLEA 4RA6B 1GGVA 1ZLYA 4GMHA 1U2DC 3BCHA 2REQA 3TMAA 1GN8A 2D5AA 3QELA 4GXTA 2ONJA 3EIHA 1GGEA 4I5IA 3RU9A 2W70A 4IIDA 1JNYA 5B37A 5BO5A 3HYCA 4B2YA 3VHXA 2CUZA 1G66A 1PU2A 5HZMA 3AR8A 4PX9A 3S2FA 1WS6A 1CUXA 1QZEA 1G5QA 3DCIA 3NVAA 5KOHB 2XDQA 2ZUEA 2NNWB 3E4RA 3ICEA 4G0OA 3N0RA 3RJ5A 1DFHA 3HMQA 3I1IA 1M6YA 4NBKA 4P22A 3TLBA 3PPYA 1LRKA 4OQXA 5CK4A 4I9FA 1PRBA 4QFMA 3X43A 3ABIA 3ZJVA 4G0QA 3R3JA 2X2PA 1V16B 1LWNA 4F2PA 1NVUQ 1EPUA 4LJKA 4EGSA 3KVNA 1ADCA 3RFUA 1YJQA 2IHVA 4H1WA 4Y2JA 2WU4A 2DZOB 1JAYA 4AW4A 5MN5A 4ZMRA 4MSUA 1NDHA 4G5QA 4GPBA 2IWHA 1Y9DA 1WCIA 2QSYA 3QFFA 1KNXA 4D6XA 1WG8A 3K53A 4XJXA 1UQUA 1BXZA 1U8XX 3SGLA 1ZHOA 3OZVA 5CG1A 3VJMA 4BPBA 2UVPB 3ZNQA 5KTMA 3UMRA 1L4BA 4HQFA 4QODA 3HB7A 3FX2A 1WA5A 3RSOA 1UJNA 1KIFA 1A82A 3FBWA 2WINI 1B7GO 4MUXA 3W4IA 4QECA 5G0SA 3C7DB 3H1TA 3QOFA 3BXWA 1XQ6A 4D26A 2K5UA 5GZ1A 2Y6UA 4LNUB 2BZ0A 3M3PA 1J1ZA 3OCZA 1XMJA 4XX1A 1R74A 4Y1EA 5IT9S 1ZH4A 5JD3A 5IC6A 4DBLC 3IRUA 1XZKA 4NF2A 1HRDA 2O7NA 2LVAA 4M7WA 5JCOA 3KOYA 4PZDA 2GJ8A 1ZK1A 2IGBA 2YKGA 2VTKA 5ICSA 2GR9A 1FE8A 4BAZA 3Q9UA 2X9GA 1PQ4A 4IIFA 3WGLA 2WJ6A 1T2CA 5A9TA 3TECE 3OMXA 4NXNM 3R74A 5F3WB 1Y9JA 2H7VA 2Y2VA 3IOEA 3LLUA 3NWOA 1E2NA 3A1NA 3CUYA 3HWWA 4CM5A 1XRRA 5JJCA 2EP8A 3TIFA 1A8UA 4AZVA 3GPXA 2AXEA 4W9NC 4WPGA 2H00A 4PN7A 5CFZA 7MDHA 1KMMA 3WLPA 5CNIA 1SVMA 3RYTC 2YHAA 4ARCA 2V7UA 1NFFA 4M46A 2CE7A 2ODNA 1KDTA 2HH9A 3ND9A 1N3LA 1ZK3A 1H0RA 1YB4A 4Z9FA 1UZMA 2YJ6A 2I6XA 3LWDA 3R3YA 3OIWA 4R2HA 1JDBB 5D00A 4AU1A 1DWQA 1JI0A 1XJ5A 2PAFA 3WWEA 4KPGA 2DHRA 3O6VA 3MFYA 3WRXA 4RY9A 3RVRA 1M33A 3FKQA 4RNDB 4OYHA 4YREA 3GLFB 3C5EA 1MR3F 4NZMA 4QO8A 4XJSA 5BUSA 1HFWA 1A4XA 2BR3A 3PU6A 3S2ZA 2QD4A 3RS0A 3U4QA 1GUYA 1R5LA 4XOUA 1NOJA 2PXHA 4UCXA 1SOWA 3CPJB 4IOJA 2LTAA 3VMFA 2XOKA 2H0RA 1YBHA 5ELLA 2GNOA 3UT6A 4EATA 1NONA 1NQAO 1CJKC 4JB2A 4KR0A 1L8AA 1YDGA 5EGNA 2AHMA 3O90A 1M72A 1GA1A 4ZQCB 1QV6A 5FBWB 4TZKA 3V2IA 1DINA 1N6IA 1VYUA 4N8SA 4N12A 3BWYA 3BD7A 4G85A 2F5NA 1PO7A 3ROZA 3O2JA 2AFRA 1T0JB 5ENDA 3RYFB 2HY7A 5FSWA 3FGZA 1X9IA 4S1VA 2R8PA 3DUWA 4F4IA 4NCAA 4EF6A 2GZSA 2B30A 4S04A 2KS6A 3DKKA 4DLLA 1CETA 5FEUA 3TQOA 4DG9A 3P32A 3UOGA 5ICGA 2RDMA 1BJTA 3UAXA 3JAWB 4FFDA 5HDBB 3PS9A 5J63A 5EXDA 3JWHA 1IVNA 3C7AA 4DQVA 2WIDA 4IBCA 4FLFA 4CZ2A 4RKEA 3BHIA 4HNSA 4P3YA 4QXPA 3FIUA 3STXA 3D0OA 1NXXA 2FUG6 4MARA 4HWTA 3TL6A 4PYRA 2C8LA 5GJCA 4I1OA 5EG5A 4OHWA 1J25A 3TAHA 4KHPB 5D7NA 4P5EA 1A98A 4C6SA 1L0BA 1U3VA 1Z6PA 2C8VA 4Z7JA 1IAVA 4XB1A 4D8TA 9LDBA 1MO2A 3NIWA 4K9DA 4DR4B 2OM2A 2X4LA 3LU1A 4NSNA 2FMHA 1Z34A 2WSBA 2BKLA 1CD5A 1DXHA 2NXEA 3ET4A 3IP8A 4RCZA 5KB3A 3ZY3A 4Y67A 4DLTA 4H16A 3DXXA 2NLOA 4H7IA 4LXQA 2YRFA 4M9RA 3ZHRA 4EPYA 2IZ7A 1SU4A 5JDIC 2NU9A 3PQ5A 1J0CA 2W6ZA 3OY2A 1XR3A 5AW5A 4QAQA 3HN7A 3ID6C 5TQVA 1I7SB 3R6DA 2RJOA 1GDHA 3NHZA 3QYAA 2XWPA 4E70A 4UU1A 3W6ZA 3WIUA 3HCWA 2ID8A 1SG0A 2QVLA 1CY7A 3C98A 3ZJ4A 4V03A 1MJGM 2JY6B 1T4CB 3DGFC 4Q4HA 4DPMA 1Q3BA 1EMDA 1IM8A 3GW8A 5E26A 4FFBA 1K8QA 5EE3A 4FHCA 1BA2A 2VDRB 4ZHSA 5HR5A 4GEGA 3MS7A 1NT4A 2H31A 3LOUA 3R5HA 4JOQA 3I9MA 1NJ5A 3AMVA 3DKVA 3E3MA 1FPQA 1WWKA 2XMBA 3B3QA 4XVRA 1GIAA 1IZ9A 2FE4A 4OFZA 4MDEA 3DHWC 3JQPA 2IPLA 3AY0A 4JT2A 2X8AA 2VRBA 4AN1A 1A9XA 2P1RA 1ULBA 2FF7A 2DXIA 3G0GA 1CUFA 3BB1A 4OL0A 5I01A 4ZT7A 3EPKA 4JI0B 1D7OA 1PCXA 2JFFA 2Q3EA 5CK5A 2VTBA 1WBDA 2ZSUA 3QTTA 4TYQA 5C5DA 1CRZA 1QFSA 3JVUA 1KQGA 3DBRB 4R9NA 5KAMA 3BAFA 2WKWA 5EP4A 1UT6A 3QU5A 3UC9A 3UHAA 3DTNA 5H59A 3RWMB 1NE7A 1QIHA 1ULZA 3BH6A 4RD1A 5FKJA 5FOUA 2CT8A 4IFIA 1C29B 1XZEA 5HW0A 4Q3CA 4LFAB 2RRUA 2XZFA 3H3XA 2QPOA 4KLAA 3MCTA 2AOUA 4V1CB 5FL7D 4GI7A 1TYEB 1ZCAA 3UKJA 1SCDA 2OK8A 3TFWA 1N33M 4LW8A 3BERA 4JYMA 4WGGA