3CF0A

Structure of d2 subdomain of p97/vcp in complex with adp
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
301
structure length
281
Chain Sequence
ALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transitional endoplasmic reticulum ATPase
publication title Improved Structures of Full-Length p97, an AAA ATPase: Implications for Mechanisms of Nucleotide-Dependent Conformational Change.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 93
structure length 281
sequence length 301
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2008-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
A PF09336 Vps4_C Vps4 C terminal oligomerisation domain
A PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3cf0A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3cf0A01
1Z5ZA 4BLQA 2B7BA 3THWA 3EIQA 3X1ZA 2WWFA 1ZC4A 2P0EA 2BIFA 2V8OA 3CB4A 1C9KA 1VDZA 3B5JA 3ETLA 2J1LA 3KQLA 2GXUA 1ZINA 2N1BA 4DDTA 4PAQA 1UKVY 2ZRAA 4JLPA 1NVVQ 2ZI6A 3O8RA 1D5CA 1GRNA 1GM5A 1HE1C 4P4SB 4R2IA 2GVZC 4Q1DA 4IDOA 3MJHA 4BGDA 2QGZA 3WBJA 2O0KA 3FHCB 1YE8A 2VP6A 1Z28A 1EFRA 2A9KA 2DFTA 5L3RA 1QF9A 3OIWA 3TR5A 1WB9A 3CRRA 1E2KA 2XOKD 1CJTC 1LB1B 2YKGA 3H1TA 2G77B 3KKOA 4UNPA 1NNEA 2XZPA 2QP3A 4DDVA 1PJRA 3KB1A 3ZDQA 2KBFA 2ORWA 4Z51A 3DKPA 2BBWA 4HEJA 1D6JA 4I1VA 4D26A 2OSBA 1HA3A 3AF1A 3NVAA 4XOIA 4IDHA 3I92A 5CK5A 2JASA 2WAYA 1NVXQ 2GVDC 1S4QA 1KI8A 2IEZA 3DO6A 5B64A 2ZJOA 4DEYA 4HI0E 2VF8A 1ZU5A 3QIAA 2AFIE 2Z4SA 1BH2A 5A0FA 1MRSA 2V54A 4QHTA 3KL4A 1TQDA 1HQCA 2ZSDA 1CTQA 1W1WA 3FMIA 2BJVA 1GUAA 3PEWA 2W2VA 4I1UA 2WM9B 2JIZD 1Z3IX 2IW3A 1ZP6A 3QF4A 4FD2A 2ZI9A 3UK6A 1LFDB 1N25A 3L0PA 4XVRA 4E03A 2Q3HA 2QBYA 1YR7A 3X1DA 1QVAA 3SC3A 4XD7D 3SBDA 2PJRA 1ANKA 1F2TB 4HUQB 4M0LA 3AKEA 4A0GA 2XGJA 5DYIA 2P65A 1NKTA 2IYWA 3RABA 5JJIA 4MA4A 1EK0A 3PXGA 1F3OA 1UBGA 4BLPA 2XAUA 4U7DA 1FOEB 2A5GA 4OJKA 1JR3E 4QOSA 1II9A 1QG2A 1CR2A 4L4UA 1NKSA 1NLFA 1P6XA 1XZPA 1Z0FA 2V55B 5DHFA 1EX6A 3D3QA 2ZI4A 1VHLA 2MMGA 4Z1MD 4IVRA 5TVKA 4D0LB 1WP9A 4JL6A 1HH4A 4GSYA 4Q1CA 4URXR 3K0CC 1KKMA 4LWZA 3DOFA 3MWLA 1W4RA 2UZIR 3IIKA 2ZS9A 4PHFA 3MJRA 3RVBA 4R98A 3BFXA 5IT5A 2ZRMA 1X3SA 1COWA 2VHJA 2ZJZA 2ZSAA 2EFHB 1Z8FA 4IJMA 2ODEA 4JLAA 2WSMA 1KO1A 5HKKD 3UWKA 2QQ0A 3K8YA 3CW2A 1F2UA 3IPYA 2RHDA 2BBOA 5EJEA 5M04A 3U2QA 5J40A 1ZD8A 4TYQA 1G6HA 1T0HB 1MABA 3U60B 1R0XA 4M9SA 1OH8A 2G0NA 3TJZA 4X8OA 2ECKA 1V43A 1NMZA 1G291 4AG6A 2AKYA 2ORIA 1ZM2A 2GAAA 5FPHA 4JL5A 3SHFA 2AWOA 3GJ0A 4XVUA 4JLMA 3HU1A 1QZXA 1SHKA 5FBQB 2BBTA 1NJGA 2PZGA 5AJWA 4Q7JB 3TUZC 2BVNA 2Q9CA 1G5PA 3LXXA 2F6RA 3BFKA 1WBDA 1SXJC 3BGWA 3OIUA 4PPQA 3RRNA 3NWJA 1NVUQ 3FKQA 1NLYA 2FOLA 1KSGA 4B43A 2ZR0A 3PV0A 4LRWA 3AGQA 2VSXA 1C1YA 4YXWD 2PL3A 3RRYA 5FPTA 5DIFA 5CDFA 2FPKA 2P6NA 2UVQA 4DIDA 1E32A 1CKEA 4RKEA 1E1QA 2ZRKA 1I4DD 5HE9A 1W0JD 3C41J 5L3SA 4C0KA 1N0UA 4FWGA 5DN6D 4HLCA 1HTWA 821PA 2C04A 1AA9A 1SVLA 1W5TA 1R4AA 5BQ5A 4CDGA 2D62A 4A3VB 1I4TD 4LJYA 2Q0HA 4ILEA 4URUR 4TMTA 3LXRA 5C46F 4Q7LA 1PUJA 2ZVQX 3T61A 421PA 1MH1A 1TADA 5FH9A 3OFND 4KO8A 2F7SA 1ZD9A 1KI2A 1GRRA 2FMXA 3KW6A 4DLTA 2GHIA 4NE2A 3CZPA 2F43B 2V3CC 1ZM3A 3BWDD 4URZR 4FW9A 1JEEA 4RD4A 3RWMB 3B9QA 4HAVA 5D3MB 5KSPA 5KNDA 3Q7PA 3IIJA 5JCZA 2VHTA 4Q9LA 4AURA 4JLBA 1QHSA 5G53C 5JJKA 4YQFA 1J90A 4LHWA 4GFDA 5HPYB 2ZETA 3L8ZA 1KK2A 5JWRA 3GLFE 3BIFA 4QJ4A 121PA 4G0NA 4JJZA 1MR3F 3KQHA 3T15A 4C0QC 2W6IA 2YC4C 3RHFA 4C7OB 3ONWA 4RCZA 3KJGA 1DELA 2VEDA 4G1UC 3U3MA 3SOPA 2ZU6A 1XEFA 3R8CA 1HT1E 4WZBE 3RS7A 1KIMA 4LJAA 2GBLA 1FUUA 2BBSA 5EE9A 4JN6A 4C0JA 1KMQA 2C98A 1SVOA 3CNOA 2WSSD 3GFOA 3EZ6A 4X8MA 3C5CA 3QY0A 1VPLA 4Q9KA 1CS4C 2I4IA 3MWYW 4LBVA 4BFZA 5AUOB 3DL0A 1KI9A 2FEOA 4JJKA 3JVUA 4JSTA 2HXYA 2UZ3A 3GJ7A 2DWZB 1YKSA 4JS0A 1OLOA 3CF6R 2GK6A 4WIAA 2LWIA 1FPMA 2P6RA 3U3KA 1DO0A 4A2QA 1DAMA 4D81A 1GWNA 1QHIA 2XB4A 3VHLB 3DMNA 2HCJB 2GZHA 1OFTA 2FU5C 3GJ5A 3BXZA 4NKRA 1AS2A 1H8EA 2IX3A 1UDXA 3GJXC 3B7GA 1U94A 2HT6A 3K1JA 2QPAA 2OXRA 4NYIR 1JJVA 4MRSA 4YMUA 1E94E 1G7CA 5C18A 1FNMA 1G3UA 1N5JA 3GEEA 3AVUA 1XD9A 3HDTA 1WDTA 2W00A 5GJVC 3TGPA 1Z2CA 2VSOA 1HT2E 2XITA 1SGWA 3LQQA 4IFBA 2NTYC 4KLNA 2DCUA 2BMEA 1LF0A 1XEWX 1OIXA 4OHWA 3B1XA 1UBEA 5L3QB 3RS5A 2AWNA 1OXSC 2JLZA 2ZRLA 4MRNA 1IN4A 1TF5A 2IA5A 1OT3A 1EFUA 1RE0A 4LC0A 4XTRA 3VU9A 4E07A 2IS1A 4QGFA 5EP3A 4CVNA 4TYYA 3KKPA 1G8FA 4RFVA 2N42A 2ODBA 4M1MA 2B6HA 2KE5A 3VR4A 2GA8A 3IHWA 4M9ZA 4Q9IA 5HCNA 1AKEA 4LY6A 1A2KC 1AM4D 2GWHA 3AP1A 4R71A 2NIPA 2H5EA 2J0VA 4DB4A 1XD8A 4LV8B 1JI0A 1XB2A 4A8JC 2ZS7A 3SQWA 5F2EA 2HYDA 3T34A 1QHXA 2ZRGA 1U90A 1S0UA 4QG7A 2DVWB 3HR7A 4D4LA 3THOA 3QE0A 3SQXA 4JVNA 3UMFA 3GLIA 1AZTA 2B21A 2XTMA 4DLSA 3AJIB 4MGZR 4RY2A 3SU8A 3VX4A 4XWOA 1G9XA 5HR5A 2CNWD 4NH0A 3A1SA 3PEVA 4GZMA 4A36A 2C5LA 4HZUB 2X1VA 5CJPA 4E09A 5AWFC 3L43A 3GQBA 4D0NA 3CH4B 3PUXA 4RZ2A 1XWIA 1JB1A 4PPFA 4MGKR 4CEHA 1OJLA 3LV8A 2VYFA 1S9HA 3QPUA 2NQ2C 5BYJA 1E3MA 3CX8A 3TE6A 2ZUCA 2NO9A 1SXJD 3AKDA 1MO4A 3IHLA 2O0JA 2FN4A 3NBYC 1KSHA 1YVDA 3IILA 1GKUB 3DPUA 2FJUA 3ADCA 3HJNA 4IKEA 4I81A 5IDVA 5JEEA 3EC2A 2FV8A 4NYMQ 1W46A 4I1SA 4LHXA 4M2LA 4QBIA 2JLRA 4JSYA 1ZMXA 3A1UA 3LA6A 4DLYA 1ONBA 1LNZA 4R9UC 1ZBDA 4P3YA 2WKPA 2ZSFA 2C77A 3AH8A 3FPAA 2OBLA 3KQNA 3CUEF 4XSHA 2RAPA 4DIEA 3GLGA 3AF2A 5KSOA 2ZJBA 3I5XA 4TZ0A 5DSZA 2QP4A 1WBBA 2FFBA 2ZRNA 3TVDA 5BWMA 1E9EA 2IXGA 4AI6A 2W2TA 5KDDA 2I3BA 4Q21A 2BMJA 3WRYC 3NG1A 4L8GA 3TKLA 4NYIQ 1ZIPA 1JALA 4FXPA 3X1XA 1YR8A 3QKRA 5E7MA 3E2IA 3AF0A 4L9WA 3AF4A 1GILA 4UXHA 4BFYA 1AZSC 3DEFA 4P31A 1U2RA 4U00A 5AUQA 4WBSA 1L4YA 1E4VA 4OHVA 3T1TA 5G41A 3AEZA 4OJQA 1KY2A 1Q1ZA 2HF9A 2QA5A 4FMDF 4DSNA 1NY6A 5B30A 1F6BA 1W47A 3Q9LA 2QG6A 4MYTA 4M1YA 1M34E 2IBMA 3K0AA 3KJIA 4HLQB 4RD1A 3P32A 1E6CA 3I61A 1N6KA 4PC6A 2FDCA 1U0HC 4PO1A 2O8FA 1JXOA 1DBSA 3QBVA 4BFTA 4RZUA 4QHSA 2NOAA 1W4AA 3AVOA 1Q1BA 3SFVA 5F3WB 5SZJA 1ZIOA 3CWQA 5EXSA 2QAGB 3S1AB 4DDWA 1E79A 2OBNA 3AB3A 3CRVA 4HAUA 3UMRA 4QM6A 3QUSA 3F0TA 4OK3A 1W7AA 5EP1A 1T8TA 3KUDA 3J81k 5DYGA 5CB8A 2V6ZM 2GXQA 4MUBA 3U3OA 4B44A 1ZW6A 4HAXA 4KFRA 2J9RA 2FSGA 4P0TA 4WXRA 3I1FA 4B74A 2HJVA 4IFEA 2QM7A 4DLWA 1G1MA 3QG5A 3MD0A 4POAA 3LW8A 2DWPA 5EUQB 1GL9B 1OFHA 4TLAA 1CR1A 4IEIA 4RD6A 2DR3A 3A6PC 4NYJQ 1WE2A 4A6PA 3AKCA 2CL6X 4GOKA 3JZMA 4B3XA 2V7QA 4KV9A 3EIEA 3PIRA 1BO6A 3DM5A 2ZUDA 1NI3A 3DMDA 2REOA 1G7TA 4Q4JA 4J0QA 3RDPA 3B13B 3FHTA 1Q3TA 2PMDA 1DAHA 3U3JA 2QPTA 2GCNA 2OESA 2RCNA 1QG4A 4WZ6A 3UKDA 1NMXA 2GZDA 2XNSA 3CWZA 2WJVA 1SKYB 2O0HA 4LYFA 2IWHA 2L0XA 3PUVA 1E0SA 3H0KA 1RYHA 2P3SA 3QJYA 1IXRC 1T5IA 4JKIA 5CIQA 3WYFA 1A5TA 1UADA 1Z07A 5JLJA 4TT3A 4QXAA 4PC3A 3W3ZB 2FPMA 1M7GA 3ASZA 2IK8A 2X2EA 3D6TB 3SR0A 3UWOA 4FWDA 3I8XA 1ZCAA 1COWD 3BRWD 3N2IA 4OQNA 4W5WA 3KQUA 3FYHA 2O8DA 3GFTA 4E22A 2FGJA 2QTVB 1K5DA 4GPTA 3MSXA 1CU1A 3D7MA 4JLOA 5IRCD 1U8AA 3GEIA 4AKHA 1HY3A 4TTQA 2VHCA 3QI2A 1RJ9B 2DYKA 2GJKA 5AJXA 1D2EA 1KJWA 1XXHE 1VYTA 3CPEA 4OQLA 2ZJAA 2GCOA 4TL6A 3K9LA 3PUWA 1KAOA 4ZCMA 2JLSA 4ON9A 3TK1A 3SBEA 4RKFA 5EQTA 1F60A 3K9HA 4LGMA 2DFKB 3EZ9A 2O8CB 3VFDA 2J3EA 1J70A 4RD2A 3LFUA 3SS8A 3SFZA 1NVVR 4B75A 3REGA 4EJSB 1ZC3A 2NPIA 3NXSA 5AJZA 2FNAA 2QNRA 5LD2B 1GNPA 1XEXA 3A36A 1E2FA 1W48A 2IYQA 2AFHE 2YWFA 3PFIA 1G7SA 4PSAA 1R6BX 1G3MA 4HB4A 1KDTA 1W4BA 3TSZA 1LS6A 3B9PA 3PG5A 4EUNA 3L0OA 1G8PA 3W3AA 1T8UA 3T1OA 4B3FX 4CEJB 4FMCB 2RB4A 2CL0X 4BLSA 2OLJA 5BN5A 2OE2A 5J5CA 1S1CA 1YRAA 1E1QD 3QF7A 1E2NA 4QHYA 4FINA 2CBZA 1UAAA 1Z2AA 4QNRA 1G41A 2IUTA 4BPBA 1W2HA 4BZXA 1W0KD 2J41A 2Q9BA 3LQRA 4HB3A 4P4SA 3WYAA 2BHRA 2W0MA 5G40A 1XRJA 2YOHA 5KSYA 2F55A 2VP9A 1VIYA 3WMEA 3B60A 3RS0A 4B3DA 4Q4JB 3O8CA 4GBMA 4TMXA 2C96A 1TU4A 2JLWA 3CF2A 1SVMA 1XMSA 4BFVA 2DBYA 1CR0A 1G3IA 4IEEA 4JVLA 3OEHA 4LUCA 2AK3A 2Q3MA 2V6IA 2JGNA 4PXAA 3FOZA 3I32A 4AD8A 1KO7A 4D0GA 3BOSA 3TVTA 1TMKA 1VCMA 2GETA 1VECA 2ZVPX 1II0A 2ZR7A 1SVSA 1XPUA 1DAKA 3E5HA 3GLHE 4C0LA 2NMVA 4F4CA 5EXXA 4Q7MB 4JIMA 1LVGA 4JT2A 2BKUA 4IW3B 4LX0A 3NEJA 2O8DB 1Z0JA 1KOFA 1XJ0A 1HURA 2BOVA 2BKEA 1HUQA 1G7RA 1OKKA 2W6ID 5EE0A 5TMPA 2B8TA 1R0ZA 1N6PA 2REBA 2ZRCA 3CO5A 2YOGA 4FN5A 4HDCA 4RZ3A 3MLEA 3OZXA 2HLDA 2ODWA 5TY0A 3Q85A 4QGHA 2GEVA 1CR4A 1GP2A 4TSFA 1LW7A 1F2TA 3C14C 4HUQA 4UNQA 4A1FA 3MGCA 2YJTD 1CBUA 4LJ5A 5EE1A 1Z6TA 3LVRE 4M4SA 4IHQA 3R9WA 2OCYC 2IF0A 4M1OA 4PFSA 2OO7A 3B1VA 1T91A 1XPOA 3AM1A 1KI3A 1DVRA 2GNOA 3P20A 1GVNB 2FH5B 4OI1A 4A82A 3B8HA 5SZKB 1X6VA 1OYYA 3KJHA 1Q57A 1N5IA 4ESVA 3QPWA 4CEIA 4LOAA 3RANA 4TMVA 2OAQ1 2BWJA 5F98A 1EESA 4DLXA 2QY9A 4KFUA 1NLZA 2CE2X 3LAWA 3KKNA 2QT1A 2F1JA 4DCNA 1NF3A 2GJ9A 3ND8A 1H8ED 3L82B 1ZNXA 3GD7A 2WJJA 2G9NA 5B57C 3NC1C 1XD2B 3EARA 2H7VA 4DT1B 2LCFA 2PZEA 1YHNA 2HT1A 1Z6YA 2ZYTX 4NTZA 2DHRA 3AVPA 3OHMA 5JBQA 3DOEA 1T5LA 3IQXA 4B76A 4G3XA 4IRUB 4JL8A 2OEPA 5D3QA 1JEDA 4H1VA 4GDFA 5FPKA 2RGEA 4IDQA 2EWVA 2ZRFA 2JLVA 4TL8A 2VA8A 2DY1A 2XTZA 4ZDKA 3I4LA 1N6IA 5GVRA 3AUXA 1ZNZA 3Q8XB 3NTUA 2AR7A 3H4MA 4QFMA 3TUJC 3EX7C 2DFNA 3LW7A 1KHTA 4DXAA 2ZU0C 4G5GA 3AP3A 1JQJC 5FI1B 1HE8B 2EFEB 1XTSA 2EFDB 4N1AA 1P61B 2REXB 2QMHA 1OE0A 1G3QA 3CNNA 3DDCA 3OF5A 1OIVA 1YZNA 4W5JA 1PLKA 1ZNWA 4DLVA 4Z8YA 1E96A 4LHYA 5KDOA 4KAXA 4DVGA 2IYTA 4GZLA 3T1VA 2AD1A 2GJSA 4B48A 2HDNB 3ZVNA 2Z6VA 1SXJE 5JI3E 1KI4A 4MKFA 2ZS8A 4ZKEA 1JQLB 2AK2A 2ZJ5A 1G17A 4LYJA 1TQ2A 2QGNA 2RGGA 1IONA 3WMGA 3TH5A 1F5NA 2FA9A 2A7QA 4MGIR 1P4SA 3KXLA 4PQRA 5FPSA 1E2DA 2XJ9A 1M6NA 3BB4A 2F9LA 2ZE7A 4R7ZA 4CEIB 3CBQA 4HZIA 1XEWY 4NBSA 1X1SA 4QL3A 1IN6A 2D7CA 3RS2A 4K8OA 4BECA 2F43A 1IN7A 1N6RA 2ZTSA 4BEBA 4LYHA 1E1RA 4GOXA 5D3MA 2IYZA 4DCUA 1WF3A 5JSZB 4Q00A 2HCBA 2OILA 4OHXA 4DKXA 3KKQA 5KNCA 3CX7A 3IO3A 5DGXA 5EP4A 5C4MA 2GXAA 1FQKA 1NSFA 1A82A 4URYR 2H18A 2YC2C 2JATA 3MAAC 1N5KA 4IVQA 3QKSB 1CF4A 1KGDA 1E2GA 4B2LA 1N6OA 5JCPA 2QPOA 4C7OA 2IT1A 4KYUA 3GLFA 5EP2A 1XCPA 1US8B 4UXIA 3U3RA 1TEVA 3GMTA 4LV6A 2D4HA 4CT5A 1E2EA 2OFOA 1IQPA 5FBVB 1IM2A 3MRSA 3WNDA 2BCJQ 1CLUA 4CIDA 2ASEA 5B58C 1S9DA 4A0FA 1W36D 1Q0UA 3VQTA 1VKJA 1ZM9A 4KYIB 4N0DA 4ZDWA 4IXMA 3HP1A 4XWAA 1XTJA 4PC1A 4D82A 3EZFA 1S3GA 4GMXA 1ZUIA 4NCJA 3KXIA 1H8HA 2FGKA 4NONA 2W6JA 2W0SA 3LRPA 2MSCB 4LI0A 2FFAA 5ELXA 2QRNA 4GT1A 3IBGA 5DLQC 2IF2A 3LY5A 4G5SA 1DOAA 1A1VA 3ICEA 1E2LA 2IYVA 1RVDA 2G1JA 4B6EA 3ZD7A 1N0VC 2GK7A 2DB3A 4B34A 4GL2A 2Z43A 1KY3A 3NHBA 1B0UA 4Y0VA 1EFHA 1XMVA 2VO1A 4WVFA 1E79D 2JDIA 1MO5A 1LS1A 3G5UA 4QGGA 2ERYA 4ITRC 3AVWA 4JMPA 2YINC 4EFMA 1CJMA 3OAAA 2CHVA 4IDNA 2OUKA 3WNBA 3EA0A 5A5GA 5UKDA 2WWIA 5KHOC 3ZVLA 1N5LA 4D80A 4ZPXA 3E1SA 4GI7A 5L3QA 2O8BB 1U99A 2Z5FA 1G5TA 1U9IA 2H57A 1DG3A 5BN3A 4WZAE 2AXPA 2E9SA 2J7KA 2FFQA 4LRTA 1RRGA 1NBMA 2BMDA 3X1YA 3EPKA 3CPJB 2A5JA 3FFBA 4UXJA 4EPWA 5CM8B 2V7QD 2TMKA 2XZOA 5F9HA 2FSIA 3U5ZB 1BMFA 4A2WA 4LV5B 2P6UA 3GLFB 4ZCLA 4O0MA 3KXKA 2C2HA 2PT5A 3VMFA 2ONKA 2CJWB 3ND9A 1TL7C 1B23P 2QORA 2ZQ5A 3C16C 1Z6GA 2G1KA 2WJGA 4H9GA 1TTTA 4Q03A 4JYCA 1M7HA 1D9XA 5DI9A 5LBIA 2PBRA 1WQ1R 2WBLC 4ARZB 1S1MA 4TT3D 3ZVRA 1FUKA 3HU2A 4HAWA 1LTQA 1IXZA 3NBZC 4HZUA 4NYMR 2VHQA 5KYKA 2LKCA 4A0HA 3IO5A 2BJWA 3VX3A 4OI0A 1RYFA 2QP9X 1IJFA 2BMFA 2DWQA 1U8YA 3P27A 2OV2A 4A8JB 1C4OA 3V4FA 2ZE8A 2PX0A 3FKSA 2PMKA 1VMAA 4QGAA 3QKTA 1XPRA 5EE5B 5AJYA 3Q72A 1Z47A 2RGBA 3ZZUA 4QJ3A 4FCVA 3W5JA 3QVUA 5BXQC 2ZR9A 1OFIA 2XSZA 1KO4A 4PC7A 3KFXA 4Q18A 1M74A 3BS4A 4N3NA 4KFSA 2IHBA 1DTSA 4Q01A 3VR1A 4HDOB 4KVAA 1E9RA 3VKWA 3EPJA 1NN1A 1R8SA 2WWGA 1DS6A 2GAOA 4P33A 2Z83A 4B3BA 3KFVA 2VP2A 3DZDA 2EFGA 1CIPA 1KMHB 3VR3A 4BASA 1EWQA 2YNMA 3EPHA 1S3SA 1J8MF 1TNDA 2QUZA 3WRXC 3HWSA 1E9AA 1GRQA 3O8DA 1NSTA 5BYKA 1QHYA 2DZNB 2PH1A 5GJWC 2B7CA 3KTAA 2XB2A 2HV8A 2FX3A 2QE7A 4NL4H 4DBLC 1ZYUA 2EYQA 3CZQA 4RVCA 5C4GB 3TRFA 4KITB 3PEYA 5AUPB 3DHWC 1T3SA 4DLRA 3FMOB 3IDQA 1P3JA 4OBEA 5CM9C 5JWOA 1JNYA 3VTKA 1KK1A 5FTLA 3MWKA 3ADKA 4MKIA 4LHZA 1KKLA 4PANA 1YRBA 3Q3JB 1FP7A 4QBHA 3WMFA 4C4PA 1ESNA 5DE3A 4OI4A 3JVVA 3OEHD 2QSZA 4LJ7A 1XBTA 2PJZA 4Q5IA 3G82C 3SHWA 3THYB 3HR8A 4GOJA 4Z54A 1ZJ6A 4Q9HA 4NP6A 2KI5A 4OK6A 3TSOA 4KLZA 1HQYE 4ZV4A 1P9NA 1IY1A 2J5XA 4C3ZA 2QAGA 2X77A 3S1AA 3FMFA 4NYJR 3T1QA 2J0UB 4D4KA 1E9DA 3SYKA 4KJZA 5J4KA 5TXGA 2JIZA 1IJEA 3RS4A 5TB5A 3FWYA 2KSQA 4D25A 2R6AA 2C78A 3GPLA 1WXQA 2PCJA 5E7IA 1DADA 1BOFA 4YMTA 5GADl 2O8EB 4XD7A 1OKKD 3T5GA 3VAAA 4B32A 4TN1A 1KK0A 5EE3A 4LZZA 1Q20A 2FWRA 2IYSA 3LH5A 1DPFA 3K70B 521PA 3W6PA 2HLDD 1BIFA 4HLUA 2J87A 2PEZA 3T12A 4TSFD 1Q1QA 1A2BA 4F4JA 2HF8A 4IOMA 1G8YA 3BJIC 2FPLA 2FSHA 2F1IA 1QHHA 5FTMA 3GJ4A 3EASA 2BM0A 1FX0B 1TUIA 3QOFA 1MV5A 1L8QA 4G5RA 4NHOA 1P5ZB 5CITA 2AN9A 1JECA 4M8NE 5FBWB 4AK9A 3K9NA 5JMTA 3LWNA 3KKMA 5KO2A 1U9IC 4P4TA 1ZNYA 4V03A 3KTAB 2CL7X 4WW0A 1W2GA 2OZEA 2VIIA 2HJGA 2IYUA 1Q44A 1EX7A 3X1WA 1II8B 4MKGA 3I73A 2RGDA 4HYYA 5EZ5A 4RD0A 1G21E 2R6GA 5GVSA 4CGZA 4M9QA 2V6JA 3FE2A 3IEUA 4Q1EA 2ATXA 2C8VA 1RPZA 1NMYA 1UF9A 3NH6A 1JBKA 2A78A 1XTKA 4KU4A 5K8TA 3W8RA 2QRZA 4W5HA 3ZLJA 4A0RA 1EFRD 1XDBA 2QMEA 1TQ6A 3RSLA 4EPXA 3U4QB 5JRZA 1ZM7A 2GBLC 1X86B 1MO6A 1T0JB 3BK7A 4C2UA 3R8FA 4PSVA 1UFQA 1P7CA 1RJ9A 4DEXA 1FTSA 2QU8A 4TLBA 4X8HA 5AR1A 2Q9AA 1P75A 1GKYA 4M22A 1ETUA 1T3HA 4O2RA 2R44A 5CYPA 2VBCA 1GNQA 2VH5R 2O8CA 3AP2A 2CHGA 1GG2A 5CB6A 4EQ6B 1KDPA 3P26A 1OSNA 4EDHA 4EJSA 3QBTA 4NCNA 1UKYA 2DWOA 2X8AA 4OHYA 4JLKA 3F8TA 1FFHA 3BH7A 1W5SA 5HTKA 5FTKA 4OYHA 3QXJA 4PZLA 3V00A 2K5UA 1P2UA 1W0JA 2JLQA 3GJ8A 2J7PA 1OB2A 4RSGA 3EPLA 1FL9A 4CEJA 1OW3B 1VYUA 5K8LA 2OLKA 1XMIA 4KHZA 4LJ9A 2FFHA 1NJFA 3Q5EA 2XXAB 3RRZA 2R2AA 3NIBA 3QEJA 1FW6A 4QJ5A 5KSZA 3RRMA 2FE4A 3CRW1 1QHHB 3CH5A 1MT0A 2VRWA 1KI7A 5ANRB 1GITA 4MRRA 2R6DA 4BUJA 5SZHB 1ZCBA 2D74A 2JJ8A 1NN5A 1GIAA 3AUYA 3SJCA 5EXTA 2JJ1A 1E9FA 5JWHA 3U44B 3OE7A 1YZUA 2J59A 1Z6XA 2ZIAA 1N2CE 3LBHA 3GP8A 4KSBA 1VCNA 1XZQA 3A4MA 1AS0A 3UXMA 4BRWA 1NN3A 2F1HA 2PCLA 4V0MA 1ZM4A 5CJ2A 1SKQA 2C03A 4TMKA 5KDLA 2OT3B 3NC0C 3QVVA 1E1RD 4IXNA 5JS7A 4KBFA 4FMDB 2KWIA 3TQCA 3GLGE 3ZJYA 2VHUA 2IEYA 2ERXA 2OM2A 1Z08A 4UNSA 2I1VB 3HU3A 1ZD1A 1RFLA 3FMPB 3GLHA 1H65A 4JLJA 4M1SA 1K8RA 3R9IA 5DO9A 4GNKA 4LC1A 2YHSA 1U0LA 3WHKA 1N6HA 4MYCA 1E69A 3FFAA 2NGRA 1WA5A 4JZKA 2EW1A 3Q5DA 5JI2E 3K53A 2XTNA 3IQWA 1RRPA 3CRMA 5KTYA 4Q7KA 1N3BA 2X19A 2RMKA 1JXMA 2I1QA 4C30A 3G0HA 3W9YA 5KPDA 1M7BA 3QNUA 4F4IA 4Z8XA 2QAGC 5TV2A 3H2YA 1XXHB 5FOXA 3SJBA 4XWKA 3T06B 1QDEA 2QM8A 1FQJA 1RC8A 1JAHA 4HLDA 4O3MA 2CCKA 2C9OA 5KPJA 1Z0IA 2QAJA 1T6NA 4W7SA 2WWWA 5CLQA 2QN6A 2W6JD 1GL6A 4N0EA 2DFLA 3MHVC 4M1WA 3LLUA 1OH5A 1SVWA 3F5FA 1PUIA 5JRJA 5C1BA 1EWRA 3W5IA 1KZGB 3U6BA 4MGYR 4F38A 2GJ8A 1KDOA 4EAQA 5DI3B 3U61B 1G6OA 3U7EB 2ZITA 3OEEA 1XJQA 2C9CA 2ZRHA 3A8TA 4XJXA 4JLDA 3A1VA 1TF7A 3ZD6A 5E7JA 3CF0A 1XD2A 1E2HA 2CVFA 4LDJA 4YLGA 4B6FA 1L4UA 4ZDIA 2AHOA 1KJYA 3HPQA 3K0SA 3ADDA 4L15A 4KCGA 4ASUA 4DT1A 4L16A 2ZRIA 3GCGA 4Q1AA 2JDID 4DLUA 3TBKA 2CLDX 1EG7A 4GMDA 2ZE6A 1XP8A 3QXSA 4DHEA 1YZQA 1E2QA 2F1RA 2OHFA 3EC1A 3H84A 1AK2A 4OI2A 3WNCA 4BE7B 3OAAD 1CJKC 1NIJA 3ZGXA 2RGNA 2W58A 3W6NA 1OHHA 3ADBA 2J45A 1MO3A 5FI0B 1W36C 2IS6A 2ZRJA 2OFXA 3LNCA 2FEMA 2NZJA 4TQ9A 5EUMA 1ESMA 1QHGA 3K0CA 4DWJA 3HPRA 2ANBA 2E1RA 3KDSE 3T35A 3IPXA 4CW7A 1W44A 4MUAA 1WCV1 4ACBA 3IUYA 1NBMD 1QVRA 5K8IA 5FUVA 3GLHB 3C5HA 4WXPA 4YMVA 5CLLA 3ZZ0A 1VG0B 1VYVA 4FCTA 1AKYA 5FUXA 4RFSB 4Q9JA 2JA1A 2GEDA 4C0AC 1U0JA 1XCGB 4C0BA 3SI7A 1OV4A 1XX6A 2AX4A 1BMFD 1G20E 4WA7A 4BZQA 2ZROA 3AVYA 2WPDA 6Q21A 1J99A 4QBGB 1W49A 1Y63A 4ZO4A 3GJ6A 4LJ4A 4GITA 3TUIC 2WWHA 3TR0A 1FMJA 3PCRB 4NZYA 4XH9B 3WBKA 3AVQA 3Q7QA 4V0OA 5FL3A 5EXPA 1D2NA 3ICQB 4EJSC 4OL0A 4Q4LA 1X8LA 3WY9A 5LD2C 4HAZA 5DHAA 5H70A 3CX6A 4I99A 3W6OA 1FZQA 5FFMA 1Q1EA 5LPNA 3R7WB 3RC3A 1G64A 1R5NA 1SXJA 3EZ2A 4D2IA 1U98A 5LB2A 4KSCA 5TDHA 2WHXA 2YV5A 5DH9A 1PLLA 3BH0A 1VG8A 3IIMA 4URVR 4TYPA 4EFLA 1Y3AA 2AD5A 1JR3A 2XNDA 2FF7A 4B3CA 4TL7A 2CE7A 1L2TA 3L0SA 4B47A 4TWZA 1OF1A 2R62A 4ZI2A 3DZ8A 3EXAA 5F9FA 1AQYA 1Z0AA 4PHHA 3CIOA 5JSZA 1KI6B 2NZ8A 1G3RA 4V0KA 1O87A 4LJ6A 2JLUA 1Z0DA 4RZXA 4YONB 3MG9A 2QTHA 4DSOA 1KO5A 4IDPA 1E9BA 1UPTA 3LBNA 4AKIA 2IWRA 3QKSA 1Q3HA 3KQKA 4M9XA 1R0WA 4JYBA 4TQAA 1VG9B 2YWGA 2IS4A 4Q1FA 1DE0A 4Q4AA 2G83A 5KUTA 1US8A 3DVLA 1NVWQ 1XTQA 3EAQA 2O52A 4QNMA 3IEVA 4G01B 1G8GA 3O47A 5FL7A 1UBCA 2R8RA 2IYXA 3TIFA 3U7HB 2RGAA 2FZ4A 5FPYA 4ZIRB 4ERNA 3IBYA 2QE7D 4XIGS 2D06A 2XEXA 3JZAA 3THXB 1G4AE 4MDEA 4I4LA 1OXVA 4BLTA 4EFNA 3EA5A 3K09A 1IHUA 2F3RA 1LY1A 1CXZA 1UEIA 2GZAA 4HUTA 4K81B 4MRVA 3CNLA 3PUZA 4U5XA 3AVXA 4MKHA 4CF7A 2ZRDA 4A6XA 3U6KA 2KJQA 2Z4RA 2WWYA 2YWHA 5FUYA 2ZYUX 721PA 2WIBA 2ZSEA 4HB2A 1JR6A 4HB0A 2KRKA 4AYXA 2Q6TA 2R6CA 3QEOA 4EPVA 3A4LA 4YMSA 2QI9C 1U8ZA 4K46A 3ZIAA 1Q21A 5E3HA 4FI3C 3EW9A 4DSTA 2GF0A 5FR1A 1J2JA 3CR8A 2GCPA 2QSYA 2ZM5A 2EQBA 1LV7A 2Y8EA 1G18A 2ZJ8A 1QBKC 2E87A 3BAFA 5J4LA 1XF9A 1N6LA 1SXJB 2A5DA 1NIPA 2F3TA 4US2R 2B8WA 4FWHA 3I3SR 4G5QA 1HV8A 4WOPA 4BWYA 1Q12A 2BM1A 4QBFA 3ZS8A 1Z06A 4Q47A 2Q21A 1L7VC 3W90A 2O8BA 2FG5A 3H86A 4V02A 3AKYA 4DUGA 5H8WA 4IOJA 1J8YF 1AGRA 3R20A 1VG1A 4A15A 4NU0A 5E95A 4B33A 1E2JA 3LLMA 2IC5A 3BC1A 5A4JA 2CHQA 4OKSA 3K0FB 2NO0A 4HAYA 3C15C 3UMSA 3B1WA 2MSEB 4D4JA 3MCAA 2GDJA 4XSGA 3L0IB 3THWB 2GTPA 2IYYA 2RGNC 3X2SA 1RKBA 4Q4AB 3W8NA 3RNLA 5GJBA 4US1R 2RKOA 4FCWA 4PSKA 4EPYA 2CJWA 4LYAA 1VTKA 2VLIA 3I62A 1ZUNB 4OQMA 2WVJA 3VR2A 4BEJA 1IXSB 3TW4A 1GAJA 4BQSA 2OBMA 3TQFA 4DRZA 3PJRA 1R0YA 3CKLA 3L8YA 3M0EA 2P2LA 3CR7A 3V9PA 2JAQA 3O8BA 4S35A 3HYRA 3TMKA 3NHAA 4HATA 3B82A 1YR9A 4ARZA 3PQCA 1OIWA 3KJEA 3UIEA 2J0QA 3LBIA 3VR6A 3A4NA 5HZKA 3EG5A 1UDWA 2GKSA 5FOVA 5BN4A 4CRWB 3RSOA 3RYTC 4LBWA 4YMWA 1TPZA 2VQSA 1I4LD 1OPXA 2IYRA 4NDZA 2A30A 5CYOA 4TMZA 4A8JA 2OCBA 1HYQA 3LX8A 4LSGA 3SZRA 5KU1A 1D9ZA 1EGAA 1OFUX 1S96A 3FDIA 2NO6A 2WWXA 4MRPA 2IS2A 4ZI3A 4PPNA 2H1LA 3BB1A 1A4RA 4AG5A 4LBYA 4A4DA 1D2MA 1SHZA 4ZKDA 5HZHA 1IAQA 4ZCIA 1M2OB 4DCTA 1Q22A 1CULC 3QF4B 2F9MA 5IK2A 1ZRHA 4ABYA 5FBRB 3TNFA 4Y0AA 2P5SA 3SN6A 2OAP1 1KMHA 4M1KA 2QBYB 1XJCA 1TQ4A 3GJ3A 2J7PD 5K8UA 5GJCA 3CLVA 4TTRA 1W0KA 1FMLA 5DNYB 2ZPTX 1QRAA 2PZFA 4EKDA 4UJ3A 4MH0R 4II7A 5JFGA 5FBLB 4M53A 4CZ2A 3M1IA 3W34A 4FWTA 3GFPA 4TQUS 3GEHA 2G0TA 2CEAA 1P2VA 4DB2A 3NBFA 2H92A 2OXCA 1QHNA 1UM8A 2VTKA 4GRAA 1R5BA 2VP4A 3VKHA 3N2EA 4KI0A 4IOKA 5JHHB 3KB2A 3OESA 2JJ1D 5JZVA 3P4XA 1IN8A 2ZYWX 3OE7D 4DLZA 1YR6A 1N6NA 2PLFA 4P32A 3THYA 3TSWA 4I1OA 4FMBB 2SHKA 3RS3A 4TLEA 3B6EA 1RRCA 2A5YB 3K09C 3K9GA 4URWR 5FTJA 2IL1A 1J7KA 4BFSA 3BERA 2EFCB 2IUSA 3A1WA 1F48A 5FOUA 1JJ7A 2WIAA 5SZIA 1NP6A 5FOTA 2J0UA 4NMMA 4BFWA 4ZDJA 5JHGB 1F2UB 1UKZA 2EWWA 1RZ3A 2MSDB 3NEYA 2CK3A 1MABB 3ZYCA 1E9CA 4V0LA 4A9AA 4C9BA 4OQXA 1D8TA 3BB3A 4OK5A 5FR2A 5JJLA 5FUWA 4PTLA 5CK4A 1EFCA 2O8EA 3NBXX 2UKDA 4KODA 2CLCX 3P4YA 4EPRA 3DM9B 1YZKA 1BYIA 2GXSA 2XZLA 3QXXA 1P2SA 1YZLA 5CIWA 1VCIA 2CMKA 3K0EA 4O25A 1BKDR 2QMOA 2ZJ2A 1RRFA 3WP1B 3EWAA 3KX2A 2JJ2A 2WV9A 3CM0A 4B3GA 1AJEA 3NKVA 1SQ5A 5CDFE 2ZAOA 2JCSA 3ZVMA 1FX0A 4PZYA 1K6MA 2D3WA 2WICA 5B2ZA 1KTVA 3UATA 2ORVA 1PVOA 3F3YA 2AKAB 4Q02A 4JBYA 3BBPA 2BV3A 4Q19A 4QRHA 1XTRA 1OXUA 5L3SB 4AWXA 5L8VA 2P5TB 1GDDA 2KBEA 4WAUA 4C2TA 2ZUBA 3NDBB 1KZ7B 2ZRBA 5JS8A 3QXCA 1EFTA 621PA 4ESHA 1DARA 1II8A 2GJAA 4JLVA 3B78A 2C95A 3OEED 2C9YA 3A58B 2XOKA 2ATVA 4NCIA 1GFIA 3CPHA 1UEJA 2CVHA 5KNBA 4QM7A 4MQBA 1VIAA 2IXFA 4B71A 2EVWX 4LHVA 3WP0A 2CCGA 1ODFA 4YDSA 2QZ4A 4ASUD 4U02A 4QKQA 4AYWA 2PT7A 5LB4A 2D2EA 3I8SA 3NH9A 1GL7A 5AJVB 4W9MC 3SEAA 221PA 1KNQA 1NBME 2FZLA 3EWSA 3LVQE 3U4QA 1I2MA 1OHHD 1CRPA 3C8UA 1G8HA 2ZSBA 5H1YA 1XNJA 1FTNA 2A2ZA 2Q3FA 4BZPA 1AS3A 1OXXK 2YZ2A 1E2IA 2G3YA 3RLFA 3BE4A 2R6FA 3SYNA 1CJUC 3D31A 3PEUA 3QQ5A 4BFUA 1R8QA 4QC2A 4EQ6A 3PVSA 1XTIA 4AKGA 1Z29A 1PLJA 2KB0A 2GILA 1NG9A 4US0R 4HSEA 4JKYA 1BYUA 3WXMA 1DEKA 2IYLD 1JAIA 3UG7A 2QENA 1E4YA 1HEIA 2WPDD 3LDAA 3REFA 4D6PA 1TF2A 1BS1A 2O5VA 4MYHA 1YZGA 3B2EA 2NO1A 4AIIA 4KVGA 1IN5A 2WMOB 4OHZA 3SYLA 2JEOA 5C2JB 2WTUA 2JLYA 2J0SA 1AQUA 2XXAA 2BCGY 2CDNA 2OFWA 4Q4HA 1VCOA 4GP6A 4PQYA 2RH5A 5HE8A 4UNRA 4TMWA 4LPKA 8OHMA 3ZH9B 2V4ZA 4V0NA 1SZPA 3IKJA 3SJZA 1R10A 4GP7A 4Z1MA 2XX3A 1ELOA 4LBZA 2V9PA 2AL7A 1E0KA 3U44A 4R2HA 1JR3D 1JPJA 2XNDD 2G6BA 2WJHA 2GEUA 3IGFA 1DAIA 1RW4A 4AY2A 2WOJA 4F92B 2JLXA 3VR5A 5BW8A 1TX4B 3EIHA 2YYZA 2CXXA 4F7WA 1SVKA 4FWIB 4PQFA 2ANCA 1T9HA 5HKKA 1KDRA 5DISB 2B92A 2YOFA 2ZAMA 1P73A 3ZQJA 1KJZA 3OIVA 1MOZA 2NO7A 3KUCA 4JBXA 4KBGA 4NCKA 1A7JA 3QKUA 2PEYA 4ACAA 4LK2A 2ZREA 1ZVQA 4DCSA 4H1UA 2ZYVX 2A3RA 2YVUA 1KO8A 3MUFA 1K5GA 4UQOA 3QG1A 2W83A 1NRJB 2QT0A 1IY0A 4F91B 4CYMA 1E2PA 2VP0A 3VU9B 3NDPA 1N0WA 2ZEJA 3ZZTA 5FL7D 3L2OB 2MMCA 5HCIA 1YZTA 4JBWA 5G3ZA 1YJ5A 4TTPA 1QZMA 5AK0A 4D4MA 4PAMA 5IF9A 1XXHA 2J46A 3LX5A 3N70A 4KFTA 1OH6A 3V4RA 2ZI3A 3CONA 2QMUA 3AF3A 4NPHA 3RAPR 1NL3A 4YXWA 1Z22A 3RC8A 2H8KA 1E98A 3QXHA 4A2PA 4A92A 3LD9A 1P9RA 1GOTA 3FGNA 3GLIE 1T4GA 2QQEA 5IHPA 4BLOA 5L3VA 2OG2A 5FOSA 1NN0A 3K70C 4PO9A 5DN6A 3GLIB 1X37A 3ECCA 3ZQ6A 1E0JA 5JEDA 3D8BA 1AN0A 4TLCA 4YC7A 3ZIAD 3A37A 4CT4B 5DI3A 3ASYA 1E0AA 5J4YA 3PR1A 4HDQB 1AIPA 2QL6A 4Q4HB 2IUUA 3VHXA 4PX9A 4NCHA 4TLDA 4CEHB 3OFNA 1X1RA 2X2FA 2V1UA 2ODNA 3TAHA 4C0SA 1OXTA 1KK3A 4EIWA 3HYTA 4LRSA 4YDHB 4TL9A 4PAOA 1MRNA 1PZNA 1C1KA 1X8JA 3B85A 4B35A 3AVVA 3BORA 2BEKA 1S8FA 4TYNA 4FIDA 1E99A 5LDDC 2D2FA 2G88A 2WAXA 3FTQA 4DUGD 2W2XA 4RD3A 4FMCF 4DDUA 2ZXUA 1DG1G 1GSIA 3BD9A 3KZ1E 2ZANA 2IXEA 3QPVA 3U7GA 2ZI5A 4MYUA 1MKYA 4UKDA 3GLGB 1P62B 1EXMA 4X8LA 1SKYE 4AKEA 5FTNA 4RFSA 4L9SA 1CEEA 2ZRPA 1ZUHA 1XCMA 2VSFA 1LF5A 2ZE5A 3PENA 1OH7A 1P60A 1R7RA 2QTFA 4UNNA 1W36B 3QSYA 4Q1BA 2H17A 2WSSA 3AV0B 3T5DA 2ZI7A 2HYIC 1R5OA 1CRQA 1KI1A 4RJLA 5E4FA 2GRJA 5J4HA 2BDTA 1KYIA 3QKRB 3VKGA 2PLRA 3PUYA 1FNNA 3CRQA 2P67A 2WJIA 1UBFA 2H16A 1P2TA 1KAGA 2VP5A 2DPXA 4XTCS 1FP6A 2NPFA 2A5FA 1VHTA 4LPSA 2ZJYA 4LJ8A 1AGPA 1CJVC 3FB4A 4PZZA 3BH6A 3R7WA 1UJ2A 2CLSA 3K0AB 1E2MA 1H8HD 1WMSA 3SJAA 2R9VA 3U7FB 3VNUA 4MDFA 1GKIA 4JVSB 4PC2A 2GESA 1O3YA 3B1YA 2O8FB 4HLUC 3SE0A 1Z63A 2EU8A 2IHYA 4TYWA 4DCVA 2HEIA 1GZSA 1DAGA 1TU3A 2D7DA 4TZ6A 4AC9A 4P4UA 2BEJA 1DO2A 1I2DA 2QEQA 1KI6A 1NY5A 2Z0MA 3FHOA 1KSFX 3A1TA 1WRBA 1X8KA 1CP2A 4PO8A 4AYTA 3TLXA 2EYUA 2N46A 2RGCA 3LO5A 4Q66C 2AXNA 1NVMA 3EZ7A 5P21A 3TAUA 4DC9A 4RCYA 3SNHA 3FVQA 4PHGA 4B2IA 3UANA 1P9WA 1R2QA 1TUEA 4DSUA 1YQTA 2LKDA 3C7KA 3ZS9A 2OCPA 4DJTA 5IK2D 4DZZA 5AUNB 1P72A 4IOLA 1KNXA 1XFAA 3AQ4A 4S2EA 3B1ZA 3UPUA 3WHLA 1GTVA 2V1XA 4XVQA 1Z83A 4ZIRA 1T3LA 3M6AA 3E70C 3AGPA 4L5BA 2WMNB 1GNRA 1M1YE 1G4UR 4JT4A 5FOWA 1OYWA 4B2PA 2XJ4A 3OIYA 3M4YA 3THXA 2VL7A 1RIFA 1TAGA 4M21A 4Q48A 1DAFA 2RHMA 3DKVA 2QROA 1XU4A 4JLNA 3MMPA 4V0ME 4EPTA 4IVPA 2YWEA 1UKEA 4C0HA 1G16A 3PITA 1NG1A 2RGXA 3UG6A 2PX3A 1SVIA 4PR0A 1IOZA 1G5RA 1PV4A 4G5OA 2OCAA 4BLRA 3N5CA 2CNWA 1V5WA 3BFVA 3VNVA 2C99A 1JPNA 2WZQA 5KOYA 2HUPA 3P1JA 2FSFA 3I72A 1G19A 4PPGA 3MWJA 3I5YA 2WKRA 5G3YA 4OQFA 1YU9A 4F93B 1TEXA 3RWOA 1XMJA 1IY2A 1W4CA 2CCJA 3WYGA 2DZOB 2VF7A 3QENA 3R9XA 3AVTA 4LCBA 2CK3D 4O2LA 2WOOA 5EZ6B 1KSJA 4B73A 1DAEA 4MITA 5H68A 1U81A 2GCOB 1M8PA 3C4JA 3SDZA 1ZAKA 3FKSD 1SULA 1Z0KA 3MFYA 4BRUA 2WJYA 4BFXA 4M1TA 2HXSA 3VLFB 2NG1A 2WKQA 3K70D 5JECA 4PHTA 1IBRA 4UJ5A 5J4VA 4KXFB 2BC9A 2GF9A 2XSZD 1XEXB 2VPPA 3TW8B 1E9SA 2R65A 4E5UA 3K0FA 5J47A 1ZU4A 4JVMA 1S2MA 5TARA 1OB5A 1Z6AA 2JJ2D 2ONJA
chains in the Genus database with same CATH superfamily
4X9XA 4EG3A 3H1FA 4H1TA 1IMOA 5KOHB 1PS0A 4KQ6A 3MAJA 4DDTA 4QOHA 4J0KA 4BNKA 2ZSJA 3UJ7A 1MVOA 2QGZA 1Y37A 4R8SA 3KRTA 3TWLA 4G09A 3IL2A 2PGOA 2A0XA 4F8JA 2LUOA 3KB1A 5FFNA 1JG2A 1U65A 2ZJ6A 4BNVA 4D26A 4MR9B 2ZAYA 2WAYA 4HAOA 1C30B 3QIAA 4QDTA 1PP4A 4HEHA 3ICOA 3PEWA 2VSNA 4ZK2A 2ZI9A 4IH4A 3RRFA 2W7TA 3ENQA 1EJ0A 1V1MA 5FLEX 4HUQB 4CPDA 1A1SA 1KEKA 3RJTA 4BLPA 4U7DA 3L4EA 1V7ZA 3Q15C 3E9CA 1O5TA 1CR2A 3PT9A 3K96A 3BJZA 1XR3A 5DYYA 4D0LB 4JL6A 3A25A 2LDBA 1HDCA 4I3GA 3TDKA 4EYQA 4YQEA 2A0YA 1RM3A 1AUOA 1EEXB 1WXXA 3MVEA 4GHWA 3K8YA 3CW2A 2RHDA 3KD3A 3U2QA 2YYSA 2QDXA 2VYND 5C3MA 2ZSUA 3QWHA 4O2AB 1OTRA 4DIKA 3O9VA 5IH3A 1NJGA 1WBDA 2PBZA 1C9EA 4PPQA 4LRWA 5FPTA 5CDFA 1E1QA 3CUTA 821PA 2E48A 3V4VB 1E77A 4BJ6A 4QRDA 3NHLA 5LBUA 3HHYA 5IDXA 3W0LB 1CUDA 4E31A 5T4EA 3WL4A 3AUTA 2YWXA 3M6LA 4G0NA 1IK4A 1TYAE 3ONWA 3RHZA 3W68A 4GGPA 4KJXA 3R8CA 4WXYB 3PSHA 1KIMA 3WK8A 1P1IA 4REMA 3W7AA 2C98A 3CNOA 1BXKA 3C5CA 1R3UA 4MKZA 4R1QA 4A0QA 3DFUA 4QE3A 3GJ7A 2I65A 2FX5A 3ZZ1A 5B6PA 3OQ6A 3M83A 2PPVA 1KFKB 3K2IA 1Z4IA 1X1BA 2VZLA 3B7GA 2HT6A 3RT7A 1XD9A 4M54A 2VQEB 2NTYC 3SLKA 3D1LA 1LF0A 4XM0A 3MC1A 1MJFA 2ZRLA 4GC5A 3MWEA 1K7SN 1IZZA 3WYBA 2GA8A 5HCNA 1JZTA 4IJKA 5ESRA 3F98A 4D0RA 4DCJA 4A23A 3IDOA 1LI4A 2KYRA 1ETHA 1SUDA 2OZLB 5TEWA 4CN9A 1PJTA 4NH0A 4NC6A 1ND6A 1UMCA 2B3TA 2ZIFA 4XRGA 2UU9B 2HNBA 1X7YA 3CY6A 1FK8A 4CKCA 1HNXB 2NXNA 1UDBA 3DPUA 3MGKA 1VKZA 5IDVA 1EUCB 3F73A 2BFCB 2QE6A 3ECSA 4BXOA 3TD6A 4PLPA 5CCXA 3GLGA 3AF2A 2XA1A 2ZJBA 2QP4A 3KC2A 1XRSB 5BWMA 3WQRA 1FRFS 5KPRA 3AV0A 1RWOA 4JI1M 1FUIA 1ZIPA 3Q7SA 3AF4A 1TUBA 3T3IA 2X22A 3G9ZA 4EQZA 3DXZA 3VYRB 4MYTA 4HLQB 3IMGA 2AOWA 4WY2A 1U0HC 3EXEB 2ODPA 4ZCSA 4AQYM 5JTUA 4HAUA 1UMCB 5GPBA 1AKWA 5HTOA 4HAXA 3S55A 3MD0A 3JQFA 3LW8A 5JROA 1JA0A 4FYMA 3EIEA 3UAZA 1QF7A 2G4LA 2V5AA 3ZZNA 1P1HA 3U7IA 2RCNA 2V5VA 1Z7EA 1GUYA 5CIQA 1Z07A 4O4IB 3ASZA 2H54A 3ESCA 2RJNA 4INJA 3H5WA 5F5XA 4RHFA 3KOOA 2PSSA 2YW9A 1W19A 2BEVA 2H1FA 4D6YA 3ILXA 1O9GA 2JLSA 4OGLA 3EZ9A 2Z5VA 5HGXA 2F62A 3CMMA 2ZZNA 3GG9A 3UY4A 4EB6A 1VJ5A 1MQ9A 3KPVA 3ON5A 1EXDA 4FMCB 4BLSA 4NFSA 1S1CA 1ADBA 3QOYA 4XGKA 3WYAA 2RHGB 1J42A 3PNKA 4GBMA 3LZDA 4ARBA 2V6BA 1PL0A 4S1WA 3DLTA 4M6WB 3DOJA 3G5TA 3ENZA 4NSNA 5FAKA 2ZVPX 3V8RA 1B3RA 3L1VA 3UOAB 4D74A 1U9ZA 2VJKA 5DW0A 4IW3B 1Z0JA 1KOFA 3L46A 3G13A 2BKEA 5CP8A 3WIVA 1APBA 4EEZA 1QIDA 4JXJA 3GJTA 5G4KB 3F2VA 4CV2A 3AZOA 2ODWA 2DWLA 2HR1A 2IELA 4YAUA 5DNAA 2ILVA 4GO1A 4Y1RA 3EG9B 4CLXA 1YRLA 2PRYA 2LNDA 4M7WA 1GVNB 4QXRA 3TW6A 3DPSA 1Z12A 2I4OA 2BUCA 4DLXA 5CTJA 4C3VA 4M36A 2JHAA 1DFHA 3NC1C 4LF8M 4ZOLB 1CIJA 3WWZA 2AJCA 3D6FA 3IJRA 3Q0TA 3IT0A 3HRHA 2RGEA 2ISSD 5GVRA 3EX7C 1ONNA 1GAWA 4FBMA 1YSYA 9ATCA 2GD2A 1A9PA 4IQ0A 2Z7JA 3AL3A 2AD1A 4WT7A 4FYKA 2X3FA 1SBZA 1ZHHA 3BPSA 3BCSA 3VUFA 2ZBPA 4LMPA 1YB2A 1UQUA 2R1UA 3SZGA 1L7MA 4P3XA 2Q1XA 4JI3M 2CHEA 1JV2B 2YC2C 3A0UA 3PGMA 1CD5A 5IT9S 2VBFA 5JY1A 4MLCA 3ETHA 3VQTA 4IBIA 3ZWVA 5EKXA 4ZGGA 2FGKA 2YH2A 2Y9MB 3TOXA 3IT2A 2FG7C 2DB3A 3KYJB 4RF3A 3MWFA 4O08A 1JVNA 2WM2A 1LS1A 3HHWA 5EGSA 1K88A 1FSSA 5UKDA 1Q83A 3U62A 4EEXA 3REQB 4HFMA 1DG3A 2KZSA 3KS8A 3BDVA 2CWBA 2J7KA 3EPKA 3EH1A 3DW3X 5U4QA 3RUHA 2KHZA 4X45A 5EJGA 4UM9B 3ZDBA 3VMFA 2XOEA 4EJ0A 1ZMVA 1IBMM 2WABA 4JQZA 3GZTB 4KIWA 1JWLA 1HZZA 1LTQA 4LDPA 5IDQA 5KYKA 4A0HA 1PWHA 1JG3A 2BJWA 1ECJA 2QP9X 4MZDA 5JYBA 3VJRA 1VMAA 3KYCA 4ROTA 1SO8A 4LGVA 5AJYA 3ZZUA 3QVUA 3B1JA 4LXIA 3I2KA 3KBOA 3PTZA 1HSOA 4FFNA 2IHBA 3VR1A 3VKWA 4HDAA 4AO7A 3B7NA 4CM7A 3NYQA 2VP2A 1J8MF 1U6IA 2O5RA 4YP9A 4EX6A 3EY4A 5ALMA 4KQFA 3DHWC 3LT0A 1CYEA 2NZWA 4DBZA 2DAMA 4NBRA 1ESNA 5DE3A 4OI4A 3C5WP 3A9TA 3K9PA 1NOIA 5HIKA 4I3HA 1M6EX 1D2GA 1YBVA 1P1BA 4FX5A 3AERA 4BU1A 5EPEA 1QQBA 5BR7A 3ONEA 2IY7A 2VQFB 1QO7A 2O8EB 1U1GA 2JLBA 4Y9RA 3LH5A 1U0OC 2YS7A 3WIEA 3ZGVA 1S8OA 1JTVA 3ZUGA 2H1SA 4W5NA 1NUAA 1PTJC 1ZCJA 3KB6A 4IOMA 3N2KB 2F1IA 1QHHA 3WOVA 1MV5A 4JASB 4DV5B 1P5ZB 1MQAA 2ZKIA 4WESB 1SD2A 2G80A 1FUEA 4KT0F 5IC4A 2R1VA 4YRZA 1BZYA 1Q7RA 4UVHA 4Q9AA 3HABA 1YZVA 3SG0A 3I73A 5CDGA 5I7OA 3QV2A 1NMYA 2RJOA 4ZODA 2A78A 4H6PA 2BWEA 4KU4A 4RIGA 1T29A 2A9PA 3ZLJA 1I3NA 4KHPM 1HE4A 5I7FA 3RSLA 3FNFA 1Z82A 3JZDA 1TECE 2Q9AA 2EG5A 1Z5CA 1OZAA 2VHWA 3AERB 1KDPA 2K7ZA 3QBTA 5CGZA 3BH7A 5HTKA 4PINA 3ZQ4A 2WE8A 1RWPA 4KPUB 1N0IA 3N1UA 3L41A 3RROA 4MRAA 3RUFA 4Q9NA 1QHHB 1Z0UA 4JP2A 4RHXA 4KR7A 3T4XA 3RFUA 3C3AA 2R1VB 1VCNA 5IMSA 5DTRA 4R2KA 2WUGA 2C03A 4FYHA 2X0JA 4HWRA 4MGYE 3OPXA 5HF6A 3JQAD 1CQWA 3KZOA 2OC4A 3O9MA 3R9IA 3AHHA 1QFYA 3FFAA 4PRKA 1RRPA 1M7BA 1J21A 4CI0B 3HKCA 2HWJA 1QJCA 1SCKA 4OM8A 2IYAA 4DR3B 1VL1A 1N75A 4ZEXA 2GM5A 3W5IA 1QQTA 2GJ8A 1MTZA 2XVMA 5DI3B 3AW8A 3K0SA 4L15A 4YDQA 2GVNA 3GCGA 3A46A 3TBKA 3PNLA 3VTAA 3EC1A 2OHFA 4KIGA 2W58A 3N74A 2JWSA 2ZRJA 2YUIA 2NZJA 3QMMA 4YT2A 1UXIA 1V7PC 5AOAA 2NM0A 1YFZA 2E85A 3T7RA 4BP9A 2GWRA 4FZRA 3NVKI 1FMJA 3R75A 1V47A 5FL3A 3ZEAA 4EJSC 5BRJA 4P6VF 3WB2A 5I4BA 2Q9UA 4E3ZA 2HC9A 2PTHA 3WTCA 1JR3A 2FF7A 5CUQA 3C3WA 4KK3A 4LY9A 4IDPA 1I7QB 3ZKAA 4QATA 2YWGA 3WRVA 1L4MA 4XQ0A 1DJNA 3HM2A 1JVBA 2R8YA 7GPBA 4ERNA 2HIAA 3TXXA 2GYYA 2D06A 5FRDA 3U4DA 3EAFA 1DUIA 4H35A 4U5XA 4R5HA 1E63A 4I08A 1W59A 2R6CA 1Q3KA 4EPVA 5FOQA 2VOEA 3UKJA 3GUUA 1T9GS 4Y2YA 3M5PA 4IL5A 2B4RO 1CNMA 2QSYA 3FYUC 1HETA 2Y8EA 3A9WA 3OPVA 1DIRA 3DMPA 4E11A 5HM6A 4RE5A 4DMRA 5J58A 4AMYA 2LCIA 3MXOA 4Q47A 5DSXA 5BSTA 3L8DA 3WK9A 4OY3A 2YRFA 5I4KA 3NTLA 2GDJA 4QXOA 2OHIA 2RGNC 2IYYA 5GJBA 3RNLA 1OLSA 2OV4A 2G5PA 4WECA 3UOGA 2WVJA 3SASA 4HS4A 3JPWA 1P74A 1NVAA 2TECE 3GWZA 3LT1A 3VZCA 3QE4A 5AW9A 3BE5A 1VBFA 1I4LD 3U1BA 3TRKA 2O6HA 4WN9A 5FUMA 1X2BA 4EY8A 1RHMA 1Y8AA 2XMRA 3P2JA 3DMYA 1WABA 2ZB3A 1DXHA 4ZCTA 1IAQA 4IZIA 1GPJA 1YRYE 3M9LA 4Y0AA 2L42A 5K8UA 4BRZA 2D00A 5DNYB 1IBCA 2GBIA 3HJBA 4P2BA 1K3WA 4JGGA 4N6OA 5FBLB 3ZHQA 5IAOA 4OX9B 1I33A 3ASUA 2OCIA 2HAKA 4DLZA 2DFVA 2NADA 5BR4A 4B9EA 2J3QA 4BU0A 4IWYA 5COAA 1G5HA 3USCS 2H2WA 4NMMA 2L18A 2W6MA 1EP3B 3NXKA 3AUFA 4PTLA 2QX6A 4KK4A 3Q2KA 2E2WA 4BC0A 1VJ0A 4XYBA 2CXOA 5K6AA 2O59A 5IARA 1XNQM 1RBZA 3HJCA 2FY8A 2JJ2A 3O1IC 1Z6PA 2ZAOA 4R51A 2Q45A 1U0BB 1P1JA 2F5OA 3HDGA 2BD0A 5HF5A 4Q02A 2QU7A 3GUCA 1OXUA 2RONA 4G1FA 1B7GO 1Y1TA 2QYSA 4CU2A 1W96A 4YA6A 4ALJA 1H4SA 3M6XA 2FZLA 1QB8A 1H3EA 2Z58A 4RPHA 4B79A 2Q3FA 1SBHA 3TZ6A 4UTPA 2M60A 5HFNA 4NBWA 4EQ6A 3OX3A 4ARVA 3RK1A 1Z29A 2E18A 5TQ2A 5ER9A 2H0AA 2Q2QA 3C24A 4MV5A 1RMQA 4HP8A 1E4YA 3I34X 4MGHA 4OHZA 4EY4A 3NLLA 4UNRA 2HLHA 1JDUA 2V9PA 2AG0A 3D1JA 1MOQA 4R2HA 4AY3A 1SKMA 4L0QA 1W76A 3KLPX 3PHBE 3OZRA 1AT1A 1SVKA 1FNBA 1P4JA 2B92A 3ZQJA 3OIVA 1KMMA 2NO7A 3KS4A 3H5LA 5A2QA 3JAWB 1XCLA 1K5GA 3LUCA 4UQOA 4TTSA 3JQ9C 3L6BA 3HVKA 1N0WA 2TRSB 3KXPA 3T38A 4RQBA 5AK0A 3EQ8A 1OUMA 2VYCA 3NWPA 3IA7A 1NJ2A 4IIBA 4EJ6A 5FJIA 1NL3A 2EF0A 1E98A 4XLTA 3G68A 4CMEC 3VH4A 2PANA 3FTDA 3OVMA 2G63A 2FS1A 2GPBA 1KJQA 3AU8A 3HC7A 3OQ1A 5JEDA 2XDAA 4LIPD 2G72A 4MJ7A 5JMPA 3ZZMA 3O94A 4RMGA 1AIPA 3TOCA 3IAHA 1XCBA 4MW0A 5AVXA 4LRSA 4FGWA 5K0ZA 3C1AA 2IH4A 4K86A 4FIDA 2VAWA 5CJJA 4MB6A 2J08A 1COZA 1YNOA 3AB7A 4DV1M 4O5OA 4UKDA 5D5PA 3CCBA 2JFGA 1VSQA 4G4SO 1Y4DE 3N58A 2GRJA 3GAFA 1SU7A 2RK4A 1UK9A 4YP0A 3WWYA 4RMNA 5H59A 4XUDA 1CJVC 3BH6A 4GGMX 3R7WA 1UJ2A 5ELMA 2F67A 4ALIA 2DUNA 1JR4A 3RIYA 3IBSA 5IN5A 3W1WA 1E7MA 1PBNA 3EBLA 2FYTA 4BZWA 4TZ6A 4BNWA 3EUEA 1DO2A 1KAQA 1KSFX 3A1TA 1CP2A 1T8RA 4MV7A 1Q1NA 4IIDA 5SY4A 4RCYA 3SNHA 4DLBA 3EUFA 3ZV5A 2BGUA 4LRSB 5ALLA 5LQMA 3BEDA 1PVDA 1GTVA 4G4NA 3VC3A 3THXA 2J6IA 3LLCA 2V7TA 4JLNA 3BE6A 4EI9A 2CVQA 4Q39A 3M34A 3COPA 1NG1A 2Q8NA 3IUMA 3SAUA 3IPCA 2VJDA 1V5WA 3BFVA 4GLOA 3N2GA 4NAUA 1OR8A 1ZAEA 1T8SA 5JR3A 2PTGA 1YWGO 4RVOA 4V1CI 3B20A 4Y18A 4LVNA 1JEYA 4WPGA 5J4VA 2GF9A 4J7CA 4P7JA 1IWBB 2R65A 5ECYA 1KYZA 1JPVA 1JDBB 2I4RA 5D1NA 2WNHA 1GG8A 2X3YA 1Z4KA 4DV7M 1RQGA 4PAQA 4OSPA 2NSYA 1G9TA 4LQ4A 2AF4C 4LF9M 2VP6A 3CNBA 3TCKA 3CRRA 2I1WA 4UCXA 1EUQA 4OXYA 4IDGA 4C4YA 3EHDA 2HHHB 2I2BA 4I7EA 3S2ZA 1E6WA 2WP8J 1NJSA 3LY9A 1TC2A 2H0QA 2IW3A 1UUFA 1CZKA 2KRUA 4D79A 4WLUA 2QLLA 2G08A 2ZBUA 5ALUA 4C6TA 4F96A 1ST2A 1EK0A 1BN6A 2G8LA 4BP1A 1X8XA 2RHHA 1M1NA 4I3FA 2QN7A 4HF7A 3RVSA 3SIPA 2XGGA 3ZLUA 3I23A 5K0CA 2G76A 1FDTA 1WPQA 1HNWB 2TYSB 1Z39A 3QMVA 4CKEA 3E53A 4MW9A 4F5ZA 2CBXA 3BF8A 2QQ0A 4AJ1A 4TUYB 5EJEA 2QYOA 1D4OA 1UMDB 4YP5A 2Z6QA 3PLNA 4EJMA 1YS4A 3P8ZA 1OTYA 1T10A 5AM4A 4MNTA 2C2OA 4ZQEA 2FOLA 3OTHA 2GDZA 1O8CA 2Z8ZA 1D0KA 4W9NA 1Y4ZA 1E32A 1NURA 5DU2A 2X7XA 3MK31 4FWGA 2QM3A 4HLCA 3VGPA 1TYDE 4OVZA 4YPOA 4LYYA 4LF7M 1FQWA 3LXRA 4D5GA 1M5RA 2IEDA 3OT1A 4OV6B 1WHCA 1M1NB 2FZ5A 3A0RB 2VTBB 4HAVA 5A0TA 1POXA 1PJCA 2XMSA 4AURA 5L7TA 4LHWA 2I7DA 2R8EA 1MB3A 1RAHA 5BPHA 1PRYA 4BNDA 3KV3O 2AN3A 4I9NA 4C7OB 4UHDA 1DGQA 4WZBE 3BD7A 1LW6E 1S2LA 3RAEC 4UE2A 4H7KA 4X8MA 1YA6A 4KXWA 2KS6A 4MW4A 1L7DA 3K15A 4Y2PA 2ONCA 2GK6A 2X4GA 1ZS9A 1JLMA 4JAVC 4R16A 1RC1A 3CZ9A 5HGJA 1EFPB 1Q6YA 1ZL2A 1EFVB 4ILKA 2UZAA 4OVZB 3RFWA 1JJVA 1KJ8A 3C3BA 1Z2CA 3L06A 2L09A 1SGWA 2HU5A 3HO8A 1AQJA 3F5MA 1A5BB 2DQZA 4UD2A 2O3TA 3VU9A 9LDTA 2W5UA 4M1MA 2GERA 3FMGA 3EQ6A 1RZRD 3PXUA 2JGRA 3Q3EA 4BNDB 1GRVA 5L95A 1AM4D 2F8MA 4UBKA 1ODTC 3UJAA 1PF7E 2OC9A 3GLIA 1HDYA 4MGZR 2ECPA 4LF4B 5AOVA 4UUNA 4HZUB 1EM8A 4E09A 3GQBA 2PJDA 2D7EA 3FR7A 3V1YA 2GX6A 4UM7A 1SCBA 1S5PA 2P69A 1FFWA 3IILA 2DUWA 5AW8A 2AB0A 2NP6A 1SD5A 4JSYA 1ZMXA 2JD0A 2ST1A 1ONBA 3KU4A 2ID8A 3TSAA 1KBZA 2R1TA 3ZWYA 2XOXA 1LBIA 4K6CA 5LLTA 1SG0A 1ZD3A 4NHEA 4HNHA 1GZUA 2CYBA 3ZDFA 1CVIA 4NATA 4MUJA 2JFFA 1JALA 1V48A 3AF0A 4UXHA 1GILA 2PT6A 4AZFA 4OHVA 1XZEA 4BE4A 1NY6A 3B1FA 4I6EA 1UOPA 4RD1A 1DBSA 2XNKA 3QBVA 2NOAA 1G0OA 3BDAA 2OBNA 1EM8B 2HNKA 2Y68A 4CKWB 1QDTA 3QVSA 3DUFB 2WYOA 3K8OE 2OYRA 2YDXA 3KBBA 1ZHOA 3Q7EA 3TTVA 3GLSA 2VOJA 2J9FA 4B3XA 2V7QA 4MUGA 3WISA 4G85A 1BO6A 1PR4A 4P7FA 3G0DA 2QPTA 2PX5A 2IWHA 2L0XA 3ONFA 4UBIA 1DTEA 3M6MD 5KYTA 2E1PA 4KI7A 3RYHA 1QUEA 2VSYA 2IK8A 5K0GA 5CLJA 2A0WA 1CHDA 2O4CA 3D7MA 2VHCA 3BZBA 5H7XA 5TJ9A 2EBHX 1FNSA 3ZWNA 2HSDA 3SBEA 4KX5A 3OPNA 2PX8A 3L5KA 3REGA 3H8SA 2FNAA 2WT8A 4ONEA 1E2FA 1Z7GA 3MUNA 2RDMA 2PGIA 2HMSA 4EM6A 1VHJA 1BN7A 2RKBA 1M0SA 3HVHA 3F78A 1KQFA 1Z74A 5G40A 3GCDA 3ND5A 5ALJA 3CF2A 2Y1DA 4UW9A 2Q3MA 4PXAA 1IHXA 4ZOEA 5JVDB 1SVSA 2DF8A 2FI1A 5GOTA 2WD7A 3E5MA 4KO1S 3IDFA 4DZRA 1XWWA 4TKZA 5K01A 1XRLA 4X1OA 1HDZA 4FN5A 3JVDA 1XZDA 2DBQA 3GIDA 3DGFC 2VNKA 2GEVA 3I9OA 1WZEA 4TSFA 2R6HA 4UNQA 3LVRE 2K47A 2EJSA 1YMVA 3F3SA 3UV3A 3FCXA 2VF5X 1U7PA 5C0OE 2GJ9A 3L82B 5TMBA 1PGQA 5B57C 2H08A 4N3BA 4GX5A 2LCFA 3RW9A 1WXFA 3QPBA 3WGNA 1Z6YA 3KSAC 4F6CA 2CD7A 3R44A 1P5RA 5EWLB 3M81A 3IOYA 5C1IA 1XN1A 2EWVA 4HGRA 4ZDKA 4Q82A 4PXYA 1AU9A 4RVUA 3T6KA 1EGVB 3NTUA 3MJSA 3TUJC 4IYJA 1C3OA 1PSWA 5FI1B 3TE7A 1XTSA 4ME6A 4BV9A 3KZMA 2CMHA 2J0EA 3DDCA 1YI0A 4W5JA 1QH1A 1ZNWA 3DDSA 1U2GC 3LHDA 3D43A 1BE6A 4DY6A 3TLGA 1Y6FA 3HYCA 3TIXB 3DR5A 4RL6A 3BM5A 5T3UA 1P4SA 2JAOA 5HHTA 5CCBA 4WOKA 3WE7A 4Y2QA 2Q6KA 1UBLS 5C4MA 2DAEA 4FDAA 3FROA 1YS6A 2OGUA 4R84A 1JT9A 2XHZA 3A7DA 1K08A 1T5TA 1US8B 4YUXA 1FS6A 2XE7A 4DW8A 2PHZA 5B58C 2UUCB 4R2WA 4JHXA 3HP1A 4PC1A 3KSUA 5KJEA 2Q4DA 2HA7A 4TRRA 2DQKA 3I28A 3E3MA 4K9LA 2QD3A 3HJSA 1UM9B 2P41A 1RVDA 3QHPA 1GG5A 3GDWA 4B34A 4YXFA 1DBWA 1E79D 4FNGA 3JD0A 4OVKA 1JHPA 3W5UA 4HBZA 1RSZA 3MBIA 2WWIA 2WG0A 4TGLA 3QELB 2BHTA 4OO3A 1ORIA 4CM6A 4UBLA 4LRTA 3FVVA 2PBFA 5HDQA 5F77A 2A5JA 1GZ5A 3FFBA 1UC5B 5CM8B 9MHTA 1YQUA 1QXSA 4ZTUB 3LLVA 1OIZA 4RE6A 3RG8A 1XLVA 3OZSA 5CAEA 3DTVD 4M8LA 4S12A 4Q03A 2VHZA 5LBIA 3T3HA 4LVOA 4AP6A 2VHQA 3RVLA 3OTGA 1GZHB 5JDCC 4WDQA 1Z47A 1MHPA 1B2LA 1G0NA 4PM4A 2AW5A 1S3IA 3EVGA 3DNPA 1I2BA 2JZCA 1A50B 3NUQA 2HJ9A 3R09A 2HO5A 4FFDA 1QIHA 1EUDA 4MV9A 1N4AA 1QCCA 1UQTA 3D6MA 4X85A 4S05A 3HXQA 4KRYA 2OV8A 4HEA6 1P3JA 3I6ZA 5EGNA 1GTMA 2ATEA 1XKXA 4DIFA 3MWKA 1QGZA 3LOPA 2OQIA 1YJBA 1XTBA 4KOAA 3WMFA 2QSZA 3ROFA 3LYHA 1NNUC 1ZOOA 3AUUA 2PVCA 3H5TA 1O08A 5DX0A 2LPMA 3HYNA 3PCXA 3U5TA 1SC1A 4U1RA 1EP9A 1TMOA 3C97A 3GPLA 4CIBA 4B32A 2PGJA 4LZZA 2ROQA 1DPFA 2YCBA 5B7GA 2GFHA 3S68A 2FEXA 4BGIA 2QVZX 2IHUA 3RHSA 1NOKA 2FPLA 5D8DA 4OD0A 4PICA 1TUIA 3DTYA 1L8QA 4HN9A 4ZZ1A 3PK0A 3K9NA 3MJDA 4MVXA 3QX7A 4KPGA 4ED9A 4YV1A 3HY4A 2OZEA 4KO2S 3C39A 5DM4A 3A6ZA 4JYMA 2FW7A 1II8B 2GPTA 1JJAA 1EK5A 1JBKA 2BM8A 1Z36A 5B2FA 3GJRA 3ZWPA 2H3EA 1NP3A 3OMWA 1WXEA 2IHNA 2J67A 4L50A 2XCTB 1I4EB 1R12A 2VBCA 2CHGA 5CB6A 1PGNA 4BBZA 2Y1GA 2QRGA 1K1EA 4BKUA 4X6YA 5LMNB 3VOBA 1VYUA 4MIOA 2OLKA 2VTEA 2WZJA 2JANA 3L8MA 1PSDA 4EHBA 4Y2VA 3C6XA 1NN5A 4KGVA 4PYIA 5CGQB 3D4OA 3OE7A 1TT7A 4KSBA 1I3LA 3RTEA 2JGDB 5CT6A 5ITSA 3RRXA 2NTNA 2ERXA 2I1VB 1ZD1A 3FCAA 4CM4B 2FAXA 3K05A 5G0VA 4O2BB 2QDKA 1CDZA 6PFKA 4KKXB 1E18A 5JI2E 4N65A 5ALGA 2I7NA 4RXUA 1DRWA 1U5BB 3FFWA 2I3AA 2QAGC 4RDCA 4E5PA 4O3MA 3S4YA 2C9OA 3AM5A 3E35A 1NW9B 4RAOA 4UN2B 2W6JD 1E6MA 3LLUA 4YBRA 3F5FA 5ED0A 3RQSA 2QX9A 1LK7A 4BKMA 2CXQA 1BRTA 5B4UA 4MQMA 1G6OA 1LSUA 1PFWA 1QYXA 1TJYA 1XDZA 3A1VA 2AEFA 4YUYA 1XD2A 4BNJA 2CXNA 3LYAA 1V7CA 1CUFA 1KP9A 4O5AA 3H84A 4MUEA 4KWIA 3W6NA 2ZT5A 2J45A 4OHMA 1JWBB 2BEUB 2E1RA 3KDSE 1ARZA 3BAZA 2VCHA 3D7KA 1T13A 4KIJA 2YWBA 1VG0B 1VYVA 2K87A 1XCGB 1AUQA 2OXFA 5GZ3A 2JFPA 4YHHB 1DSSG 3FUWA 4UOEA 1D2NA 4HAZA 5A4MS 5H70A 4I99A 2H4ZA 5AO9A 5LLSA 2DAKA 2QRHA 4P84A 4C6HA 1XU9A 1NM5C 3RC3A 3WVNA 3T7AA 3AM3A 1UFKA 5AT1A 3PD7A 2QZZA 2VF2A 1G3RA 2BZ1A 2DHYA 1DXOA 1AHIA 2B1JA 4AJIA 3L7DA 4M0UA 3K16A 2O52A 4FYXA 2OSVA 3L8EA 4W7HA 1P19A 3KPWA 4XUCA 4JEMA 3EA5A 3FSGD 4CTNA 4TZKA 4NXNM 3ORFA 3LKZA 3HJRA 2ZJ1A 5BSVA 1PFYA 4JC5A 1QVVA 4ZJUA 1J2JA 3KLBA 3LQ2A 4B4VA 1JX6A 1IEQA 4Q3LA 1YZYA 1C4WA 3ZGYA 4MUYA 4PNEA 3GUHA 4IBCA 2F3UA 3RIHA 4RF5A 5I4CA 3MNFA 3R76A 3CX4A 3W4JA 4ZP1A 2O5EA 4UBNA 4JB2A 4HH4A 1XHEA 4OCZA 1AF7A 2PL9A 2CJWA 4OQMA 3VR2A 1U1EA 3MEQA 4HATA 3KSRA 1MC4A 3AYXB 1AH2A 5HZKA 1ZPDA 4DV6M 1EE8A 3EG5A 2GKSA 5FOVA 2BL4A 1U0NA 1PFQA 3PFFA 2NAFA 3DP7A 3CVWA 1L2DA 3LX8A 5DX8A 2WJPA 1YDHA 2LBCA 4MRPA 1YCHA 4QA9A 4JDPA 4L0MA 3LC1O 2GUWA 2VAMA 3P45A 1VLVA 3VTFA 1D2MA 3I0ZA 4P35A 3U13A 1ZRHA 4DAEA 4M1KA 1T9BA 3NOXA 1V1MB 4KEAA 4AMVA 4TTRA 2FMFA 2XCLA 2FW6A 2OAGA 5E8RA 1PR2A 3L8GA 2CEAA 2OXCA 3IALA 2JJ1D 4TWBA 1W8IA 5ILGA 2NQTA 4D56A 2I91A 3K9GA 5DP1A 5JY6A 2X9GA 1U3TA 4DPLA 1EA7A 2YCLA 1D8TA 3ABOB 4TKLA 1PFGA 1NBWB 2L7HA 4RNAA 3AR4A 3A6JA 4BOYA 4O25A 1BKDR 4ZYUA 3R3WA 4KPEC 4QRIA 3A9CA 3LQ4A 4O02B 2UYOA 1EUZA 4GICA 4ITUA 4UVGA 1CP3A 4KUEA 3VC1A 1FC0A 2VAXA 1I5RA 2IBTA 3F1LA 4AWXA 1N1DA 4UPVA 5ISMA 5DHPA 621PA 2JFXA 5WRFA 1VIAA 2EVWX 3FPJA 4G5XA 2N35A 1NXPA 4U02A 3E27A 2ZPAA 3G79A 5JXJA 2OQ4A 1NBME 3A3PA 5H1YA 2A2ZA 4RABA 3OZTA 1EVKA 3PF9A 2YZ2A 4PLZA 2R00C 1O0SA 3WOHA 2HPZA 1P0FA 1KE2A 5JAUA 2Q4OA 3V4ZA 1HEIA 2RG1A 4MYHA 2OMEA 4KVGA 2BW0A 1EH5A 5EIOA 1R9MA 3ZXYA 4GM1A 5J23A 4PQYA 2RH5A 1L9XA 1JIKA 3BQ9A 3PPWA 4PIVA 2RSLA 1ISGA 3G89A 4QGSA 2HCFA 5HF9A 4L5IA 1GU7A 3VVCA 2WOJA 2ES4A 5LA6F 2HMTA 4DOMA 1K8ZB 1V71A 5I47A 4KBGA 2PEYA 5DDIP 1XNRB 5IVKA 1X80A 3EEYA 4EDFA 5I51A 1AGXA 1USGA 5JSFA 2W83A 3MWEB 2ZT7A 2VP0A 1TO1E 1OWMA 1KPGA 1JYSA 3H7AA 4PAMA 2YXDA 3N70A 3PFWO 2XH9A 2HRQA 3EEQA 2FJPA 2VZ9A 2Q3CA 4R0MA 1NN0A 4KQ2A 4PNZA 1PZXA 1E0JA 2XMQA 2INGX 3EE6A 4XWYA 3MJCA 1M2KA 1XDGA 1WUIS 3ASYA 4C01A 1X7YB 1D0SA 2X2FA 1L1FA 4CKCB 3EA4A 3UNXA 4KN5A 2WZCA 1Z7WA 3O92A 2FQXA 4C88A 1C1KA 3SSOA 4B35A 5H80A 3ORRA 4INZA 4TYNA 1KTIA 4C04A 3A9RA 4BVLA 1CUUA 4BXOB 1K92A 1KBQA 5GIOE 3BD9A 3KZ1E 2ZT6A 1YUMA 2XNHA 4R40A 2PSJA 1MKYA 5L45A 3GLGB 1EXMA 4G8BA 3UEOA 2C0QA 1G98A 2VPZA 1YGYA 1KY4A 3QSYA 3U6LA 1GA1A 3AV0B 3PGA1 2ZI7A 4J3NA 3SX0A 3DQQA 1TUBB 1YJCA 3KKKA 2YR0A 2DPXA 2AR9A 3VU8A 1VHTA 2CXTA 2UZ0A 4YRQA 3HNRA 2A3NA 1Q7CA 1MDFA 4IZHA 3NNSA 2D7DA 1RHUA 2AYYA 1NRXA 1NY5A 4QQ8A 2A6PA 1X3LA 4FI3F 1NVKA 3QLTA 1YQTA 3GQ3A 5IK2D 1V0JA 4ENVA 5AUNB 1KNXA 1USVA 1H4QA 2WW8A 3OBIA 3QKWA 1IWPB 1SAYA 2HHLA 4WUVA 4R0NA 1DAFA 1KZ6A 1UC8A 1G16A 2RGXA 3U7RA 4OLHA 5KB3A 3FWKA 3AFGA 1JPNA 4GKVA 2QJRA 1YU9A 3BDIA 1XMJA 4UDOA 1W6UA 3RK4A 4LFCM 1J1ZA 4FYWA 2BEVB 2B82A 2HY7A 3TLMA 4R3DA 3BHIA 3SDZA 3A2NA 1ADFA 1CF2O 4BFXA 2GQ0A 4U2FA 3O8LA 4L57A 3I58A 3RTDA 3W8EA 3UTCA 4EB6B 5I3CA 4K88A 1U7UA 3U9LA 4G0UA 3FXAA 2O2CA 2QJTA 1FDRA 3ETLA 1U0FA 5FA6A 1ZINA 5ER6A 2GVZC 4KYVA 5E3IA 4DF3A 3M6VA 1AGYA 4YIKA 3KOYA 1LB1B 3KKOA 2CY0A 3QA9A 3FDXA 4URFA 3FNQA 1ZESA 2OM6A 4WK6A 1NVXQ 3N8HA 2UDPA 1KI8A 4FOLA 3RSCA 5BXYA 4ZQBA 5M5BA 4BVKA 3NKFA 3E05A 2PZAA 2LVPC 1BJTA 3FRJA 3FPEA 1NA5A 3ACBA 4Y1RB 4GRIA 1QK5A 3ZJUA 2P9CA 1ZGAA 4CODB 3KJNA 4WZAA 4FFBA 1BMTA 4W99A 4F21A 1SK9A 1NLFA 3TLKA 3MCVA 5F3RA 1USUA 1HH4A 1YMQA 1UBNA 4XCQA 4M38A 4W5OA 4J2OA 4TKUA 2VHJA 4TZTA 1QONA 3VYWA 1NAHA 2WSMA 2E37A 4J1QA 3L6EA 4M9SA 3TJZA 1L1QA 4PGMA 2YHBA 4IDAA 4WY8A 5E4YA 2ORIA 1YF3A 1OU4A 4JLMA 1U7OA 4Z3OA 2ZIWB 2XRFA 1PWYE 3NWJA 2HMAA 1SXQA 2RBKA 3VBCA 3CXUA 3T3MB 3KR0A 2P6NA 5AI5A 5KJ6A 1SKAA 5AOCA 1JI3A 4EKYA 2Q0HA 4URUR 3H2IA 4KDFA 4CI9A 3SC2A 2E5FA 1NUPA 1WMAA 4FFBB 1X13A 4RHTA 1SBIA 2F7SA 4ZT5A 1KI2A 5FWYA 4N76A 3JQ7A 5JV5A 5JG7A 3WYEA 4ZZ0A 3IR6A 2VHTA 3NR2A 4Q9LA 5JZMA 2GZ3A 4H7FA 5HPYB 1GGNA 3L8ZA 3BRSA 4NCAA 3HGTA 4C0QC 1WGLA 2FEKA 1H5UA 4F8YA 1DELA 3U3MA 3VK7A 5IJWA 3JPYA 3WBBA 1UBUS 1NHGA 3NBAA 4LISA 3ZXXA 2XB9A 1KI9A 1OWNA 3DOCA 4ZEVA 2NU6A 2RI6A 1JAZA 4W8OA 4M55A 3U3KA 1XGKA 5FORA 3NOQA 2FU5C 3PC8A 4KACA 4YR9A 1IN1A 3GJXC 4LZLA 2QPAA 4MRSA 4C7VA 1E94E 2W00A 1HT2E 1DOHA 5A7FA 2HBQA 2BMEA 1BU5A 4OHWA 4BB5A 3RJMA 1Q0LA 1FXWA 1JDNA 2POCA 3NASA 4L1KA 4PQGA 3K7EA 2KE5A 2G6TA 4R71A 4M0PA 1XA4A 2NIPA 3W8FA 4DB4A 1AKRA 4P3KA 2DT8A 3BBZA 1QHXA 2ZRGA 2W90A 2RB5A 1YVRA 4Q3AA