3CF0A

Structure of d2 subdomain of p97/vcp in complex with adp
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
301
structure length
281
Chain Sequence
b'ALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transitional endoplasmic reticulum ATPase
publication title Improved Structures of Full-Length p97, an AAA ATPase: Implications for Mechanisms of Nucleotide-Dependent Conformational Change.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 93
structure length 281
sequence length 301
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2008-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
A PF09336 Vps4_C Vps4 C terminal oligomerisation domain
A PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3cf0A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3cf0A01
1SULA 5FPTA 2CNWD 4LJ8A 1G9XA 1COWD 3AVPA 2NQ2C 1FNMA 4TMKA 1FW6A 4DC9A 1T0JB 3DOEA 3Q7PA 1VECA 2GEVA 2DY1A 1KI6B 2XNSA 1Q22A 4NU0A 2DZOB 1WXQA 2FZ4A 4LI0A 3CPJB 1OXUA 5DYIA 1T4GA 1T5LA 4GT1A 4OK5A 2R62A 1WDTA 5LB4A 3D6TB 4XTCS 1NIPA 5KSPA 2FA9A 3M4YA 2IX3A 3GQBA 3B13B 4JLJA 2XEXA 2G9NA 1XCMA 4DLZA 4JLOA 1Y63A 2ZI3A 1B23P 5DIFA 4EPXA 3CRW1 2Q3FA 2C9YA 4TQ9A 4HAVA 2ZROA 3T06B 1A2BA 1E9FA 4BWYA 4DVGA 4IRUB 2J87A 4PPFA 1M34E 1AS3A 1GNRA 1XRJA 3AP1A 4RSGA 4JBYA 3UG6A 2VBCA 2GAAA 1Z29A 2CL0X 3K09C 4GZLA 4JVLA 4F4CA 1OYYA 1E2KA 1YKSA 2VIIA 3G0HA 4D4MA 1X1RA 5EE9A 2FE4A 1U90A 3GLHB 4OHWA 4IVRA 2GEUA 2BMDA 1LTQA 2B8TA 2PH1A 2HCJB 2VL7A 1E94E 3TSOA 2W2VA 4TLDA 2BIFA 4LPSA 1KO7A 3I32A 2XXAA 4HAWA 1ZINA 3OAAD 2L0XA 4NYMR 1V5WA 2G3YA 3GJ0A 3P1JA 2IT1A 5HPYB 3IKJA 4F4IA 3AF4A 1U9IA 2J0VA 3VAAA 2JDIA 1GITA 3NC0C 2BEKA 4EFMA 2PZGA 4H1VA 2CLCX 2IW3A 2QE7A 4RZXA 1QHSA 1WBBA 4MYTA 1J7KA 2WWYA 5G53C 2FX3A 3AV0B 3L0PA 1G4UR 2IYVA 3SJAA 4LJ4A 3AVQA 3AM1A 2CK3D 5EP2A 3NXSA 4JLNA 2J45A 1GL9B 4YDSA 5CB6A 2QROA 4L8GA 3WBJA 4TYNA 2W6JA 4GMDA 2C9OA 4GMXA 1KAOA 5L3QA 5GJVC 4LHVA 3U5ZB 3KXKA 3MRSA 2BBWA 5G3ZA 2A5JA 4GP7A 1G7CA 1E2IA 1LS1A 5GJWC 5K8IA 1NY5A 1BMFA 4LJYA 3WYFA 1PLJA 4IFEA 2ASEA 2VF8A 4TL7A 4NYIQ 2OEPA 4US0R 4FW9A 3KQHA 4BECA 1AS2A 1HY3A 1R5NA 3FHOA 2VHCA 2JEOA 3BB4A 4Q1CA 2WWWA 3A37A 2OCYC 4B44A 5CM8B 2YOHA 2JIZD 3R9XA 2ZVPX 2DWPA 1GKYA 1XFAA 1NY6A 4HUTA 5FBVB 2P6RA 1I4DD 2DBYA 4M1OA 4AKHA 5J40A 4QOSA 3SJBA 1PUIA 1GSIA 3MFYA 1CJTC 1MOZA 1VMAA 3QJYA 4K8OA 4NE2A 2F1RA 2X2FA 2NGRA 1IHUA 1ZMXA 3GLFB 1OF1A 1EX7A 4GOKA 1S9HA 2NO9A 4FWHA 1WRBA 3K70B 2PLFA 4TYWA 3OAAA 4NKRA 1E3MA 4AKGA 4OHVA 1W4BA 5FR2A 3TRFA 5CDFE 5L3SA 1RIFA 3TGPA 2GXAA 2ZRBA 5AJYA 1D2NA 5L3VA 1Z3IX 2IYQA 2R6GA 1W0JA 3PUXA 2G0NA 2FH5B 4JVNA 4BFUA 4BEBA 2QG6A 1HTWA 1N25A 1W4RA 4RD0A 2ZR9A 4LJ9A 2VO1A 3AVOA 2F6RA 1SQ5A 5JHGB 3U4QA 1E99A 2D4HA 2GCPA 4E03A 1ZAKA 5HZKA 1VCIA 4FWGA 2QY9A 4BLQA 2DFNA 1Z6XA 4WXRA 3T1OA 5BXQC 1HYQA 2HYDA 2WWHA 1CP2A 4ERNA 4AKIA 1OXSC 4QJ4A 4XWOA 5FBLB 2QAGB 2BKUA 3RANA 1FX0A 1N6HA 2F43A 4YLGA 1N6NA 2VPPA 2F1JA 3ASYA 1S8FA 4RZ2A 4OQFA 1YR6A 5AUNB 3D3QA 2XB2A 3N5CA 1QG2A 1IN7A 1TQDA 1XP8A 2GTPA 4FIDA 4LX0A 1BIFA 5KHOC 1E2EA 1M1YE 2V7QD 721PA 3ICEA 1SZPA 5E95A 4C0SA 5EXTA 4B34A 5EQTA 3GFOA 1RRGA 3KTAA 4IVQA 4HAUA 1VDZA 4US2R 4HATA 1VCNA 4ESHA 1IN6A 1F48A 2ZRKA 4M9SA 4ASUA 4TQUS 1OV4A 3GLIB 1NBMA 2OZEA 3MJHA 1JB1A 3QKTA 3T15A 2O8DA 2GF0A 3B9PA 1KY2A 4HLUA 2EWWA 4PC7A 1HUQA 2GZHA 1ZBDA 2QPOA 3PJRA 3Q9LA 5C4GB 1JJVA 5DSZA 2FGKA 4OBEA 3KXIA 4DB2A 1E2FA 5CJPA 1EFRD 4MKFA 1RRPA 3SS8A 1KO8A 3K53A 5KOYA 4CEJB 3I92A 1DG1G 1NSFA 2A5YB 4E09A 1OXVA 5HZHA 1AZTA 4C9BA 5KU1A 3H4MA 2ZE6A 2JLWA 5FOSA 5JZVA 2OAP1 2G6BA 4U02A 1KJZA 5EUMA 3P32A 1G7SA 2ODBA 3KXLA 4TL8A 5AJVB 3TAUA 1IQPA 2ZIAA 4Q66C 4V0KA 2QRNA 1M8PA 1M2OB 1E9SA 4FMCB 1FP7A 3GCGA 4DLYA 4A36A 2AKAB 1ZYUA 4WOPA 4C7OA 1XTSA 4J0QA 1NSTA 4KITB 2GNOA 4IW3B 3NDBB 1DAEA 1KI1A 2WMOB 2XNDD 4BFSA 1EWQA 1U8AA 5LPNA 2I1QA 4D82A 4WA7A 1X8JA 5AJXA 1ZD9A 1W36C 4NL4H 1IJFA 1JJ7A 4XD7D 4EFNA 2EFCB 4PQRA 4MRRA 3IBGA 4Q1EA 1DAKA 1YU9A 1TQ2A 4US1R 2GESA 5E4FA 3EWAA 1XZQA 2QPAA 1SXJE 4FD2A 4IOJA 2MSDB 2WOOA 5TV2A 3GJ6A 3KUDA 1P2UA 2IK8A 3BH0A 2Z83A 3HP1A 1CLUA 4C4PA 3MG9A 3BC1A 5JCPA 1OH7A 5E3HA 2GCOA 2P67A 3IQWA 4N0EA 4O25A 2QA5A 4QGHA 2BKEA 3W6OA 4B33A 3M1IA 5H8WA 4JJKA 2ZU6A 2NPIA 2QGZA 2VSXA 4WW0A 5B58C 2WSSD 3K0CC 3MWKA 4CEIA 6Q21A 5AWFC 3PCRB 3TH5A 2RGEA 1IN5A 3ND9A 3LH5A 5KNDA 1KI7A 1NKTA 4HYYA 2ZS9A 1KSJA 5H1YA 3I3SR 3S1AA 3U7HB 4ZCLA 1KI3A 3EIEA 1SVLA 3ZVRA 1U81A 1NJFA 3B1VA 2OCBA 1LF0A 3BE4A 1E2PA 4JBXA 1E98A 1II8B 4MKIA 2FPLA 3CF2A 2NO7A 3KFXA 1VKJA 3A36A 4DWJA 3NEYA 3DEFA 1AGPA 1N0WA 4YDHB 3UATA 3EC1A 2GJAA 4PAQA 1MT0A 3I8XA 4B6EA 3SI7A 2ZREA 2ONKA 5FBQB 1KNQA 3IIMA 5CDFA 2LCFA 4G5RA 2O5VA 5E7JA 1D6JA 1JALA 3O8BA 4A2QA 4IXNA 2R44A 4OI4A 1PVOA 4PSVA 1ZNWA 4TSFD 2V1UA 2XNDA 2QQ0A 4B3BA 4DLSA 1Z0AA 2J0SA 1JAIA 1EX6A 1R0WA 2FOLA 3QXJA 4FN5A 4PQYA 5L3QB 1P62B 4KVGA 3AGPA 4G5OA 2PBRA 4MGKR 4PQFA 5TARA 5GJBA 3TMKA 3NBFA 3LY5A 4LDJA 4AWXA 2Q3MA 5AUPB 3BBPA 5TB5A 1U0LA 3EPJA 3KKQA 2CVFA 3TVTA 4Q9JA 2GILA 4B2PA 2HF8A 1AA9A 3F5FA 3E70C 1E9AA 2ZETA 3NH9A 4DLTA 4O2LA 3RWOA 4DUGA 3LQRA 2JLZA 2WKRA 4AYXA 4DDVA 2XX3A 5HKKD 5F2EA 4NYIR 3TR0A 1KZ7B 5A4JA 1T8UA 2J7PD 1WE2A 1CXZA 2OLKA 2ZE5A 3QXSA 1TQ6A 2WOJA 4PO9A 1E0AA 3IEVA 3BK7A 2QMOA 3H86A 3THWA 1K5GA 4NHOA 1Q20A 3IUYA 2EFEB 2H5EA 3X1YA 1H8ED 2GZDA 1A5TA 4HAXA 2BHRA 3N2EA 3GLHA 4EJSB 4D4JA 5IHPA 4KHZA 2XGJA 5JWHA 3OHMA 4JT2A 1F60A 2B7CA 3UXMA 4YC7A 4LJAA 4BFXA 1U94A 4MYUA 5FBWB 4CRWB 1QZXA 4I1OA 1M7HA 1TF5A 4LBZA 5L3SB 1R5OA 2ZYTX 4Q4HA 1BO6A 4B3DA 3KQUA 3K70D 3F3YA 2P3SA 4KSCA 1OE0A 1JXOA 1Z83A 5KSYA 4PZYA 1E4YA 1P2VA 4DJTA 2ZSBA 3RRYA 3ND8A 4F38A 3SOPA 1W36B 3PXGA 3W3ZB 3U4QB 4W5HA 4DSTA 4D0GA 2XITA 3RS0A 1NVXQ 1IXSB 3NWJA 2JLRA 1LF5A 5FTJA 2BEJA 4F93B 2NZ8A 3MCAA 4JS0A 3FE2A 4M9QA 5IDVA 2R65A 3ZH9B 1ZVQA 4IOKA 1P73A 1CEEA 4JLBA 1XTRA 1FX0B 2F43B 2ZRHA 3SE0A 2FDCA 4AYWA 4ABYA 2QTFA 4TL9A 3RNLA 3A1WA 1JR3D 2V6ZM 3QXCA 4R9UC 3WP0A 1Z6TA 3LBIA 3QPUA 1BH2A 1CR2A 3EW9A 4LHWA 5KDOA 1AQUA 1NL3A 1YR9A 4WZ6A 3RAPR 5JCZA 1MR3F 3KDSE 2WPDA 5DISB 3BRWD 2F1HA 5EE0A 4DHEA 2NZJA 1GOTA 3LO5A 2JLXA 1AN0A 4RCYA 421PA 2O8BA 3CRRA 2BJVA 1EFTA 1DAFA 1CJUC 3CH5A 1UAAA 1KY3A 5HKKA 3FDIA 4XSHA 3P27A 1L7VC 3QPWA 4XSGA 2ZR0A 2J7PA 1X8KA 1XJQA 2EFHB 2C95A 1Z0KA 3KTAB 5JWRA 1TUEA 4A2WA 5AK0A 3LW8A 1N5LA 3A1SA 5CIWA 1NIJA 4GNKA 2GBLA 4WZBE 2IF0A 1Q1ZA 1T3LA 2BDTA 3L2OB 4V0LA 5CJ2A 2IHBA 4L9SA 2OUKA 1Z0IA 3B9QA 2QTHA 2BM0A 1SVOA 2RGNC 4X8LA 4TLAA 2H18A 1G64A 3ADBA 4AD8A 3LQQA 2XOKD 1H65A 4BGDA 2WJVA 3I4LA 2GK6A 4K81B 4EPRA 5L8VA 2JJ2D 4Q48A 1Z0DA 1XD2A 3WMFA 2W83A 5LB2A 1ZC4A 1UKEA 1F6BA 1D2MA 2REXB 1Q44A 4LOAA 3U60B 4Q7KA 3EPKA 1YRAA 3ZVMA 2ZYVX 3RSOA 1VIAA 1Z6YA 2V4ZA 2YYZA 2G1KA 2ZRPA 5C18A 3ZLJA 1OFUX 2QL6A 2W0MA 3FKQA 1E2QA 3KQKA 5EP3A 4HI0E 3X2SA 1ZJ6A 1VTKA 2ZRLA 3IPXA 4TLBA 4MDEA 2ZRJA 2C03A 1OXXK 4ZV4A 1Q0UA 5F9FA 5EZ5A 1MH1A 2WJHA 3EPHA 4C7OB 1W47A 3LFUA 4LHYA 3BB1A 1GFIA 4ZI2A 1Q3HA 4O0MA 1MV5A 1E2GA 3UMFA 1X86B 1TNDA 1TL7C 4OQMA 4IEIA 4BFZA 1Q21A 2Z0MA 3WHLA 4QG7A 4Z8XA 1GVNB 3NG1A 3QVVA 1XWIA 2ZANA 3IHLA 2H92A 1B0UA 1R10A 3CNLA 4HDQB 2QM7A 4NCHA 2WVJA 2FU5C 3B82A 4JYCA 3RRMA 1WF3A 3BGWA 1R7RA 3K0FA 4BQSA 3IGFA 2ZJ8A 4DSUA 3GLGE 2AK2A 1Z63A 5L3RA 1E2MA 1MO3A 1KGDA 3W34A 3V00A 521PA 5KPJA 4B32A 1OB2A 1PLLA 4KFSA 3T61A 3KW6A 3SYNA 3VQTA 4MRSA 4U7DA 4C0LA 5GJCA 1VHTA 3QF7A 4D4LA 1R0ZA 1P9RA 4GPTA 4OQLA 4TZ6A 4P4TA 4CEIB 2WIBA 2NO1A 3DVLA 5JECA 2PT7A 1XPRA 2ZJAA 2OXCA 3RS7A 4A82A 4GL2A 1G5PA 2IUSA 4UKDA 3CX8A 2SHKA 4NCJA 3S1AB 2GBLC 1WMSA 4CEJA 4LBVA 2G77B 3AQ4A 1TTTA 2DPXA 4HB0A 4F4JA 4LRWA 4RD3A 1GNPA 3CH4B 2ZRNA 1W2GA 4C0QC 1TF7A 2DCUA 1JI0A 2RAPA 1DELA 1E2NA 1Z5ZA 4LGMA 1E6CA 2AX4A 2JDID 3OFNA 1F3OA 2QUZA 4D6PA 1T6NA 2QE7D 1YZKA 3K9NA 5J5CA 2VYFA 3K70C 2IS6A 2C78A 2ZI5A 2J3EA 3IBYA 3OIUA 1TF2A 2VTKA 3K9HA 4NCIA 5SZJA 1W0KD 2AWNA 3LRPA 4AG6A 1YZLA 3QPVA 3VFDA 1ZM4A 4MKHA 4U00A 4CEHB 1R2QA 3T34A 2DWZB 2RHMA 4PC1A 3QG5A 3B78A 4IEEA 4O2RA 5KPDA 4A4DA 2W6JD 4ZPXA 3ADCA 1NN1A 3W9YA 2X1VA 2OG2A 4BRUA 4PFSA 2VHTA 3CF0A 2QNRA 4HZUA 3W6PA 5CK4A 1BMFD 4QXAA 1D9ZA 2J1LA 2OV2A 2D62A 4TMZA 4L16A 2F3RA 1DBSA 4WXPA 2Q9BA 1OFHA 3LXRA 1YHNA 2CJWA 2C98A 3PUWA 2EFGA 2QAGC 1LVGA 2YHSA 5JHHB 2HF9A 2RMKA 3LBHA 5FOUA 4RVCA 2REBA 3THWB 4QJ5A 2VHJA 4KODA 2J9RA 4P3YA 3I1FA 3FOZA 3QF4B 1R0XA 3EPLA 2XSZA 1NN0A 4QKQA 2EWVA 1IY0A 4P4UA 4RD2A 1U2RA 2OO7A 3SYKA 4D25A 2CBZA 4JN6A 4KLZA 4C2UA 2O0JA 3G5UA 3ZIAA 1FZQA 5CLQA 4ZDIA 4Q4HB 3MAAC 4C30A 4HEJA 3C16C 3JZAA 1NF3A 5IK2A 2ZITA 3RS5A 3M0EA 2VP9A 4RZUA 4NH0A 4Y0VA 4DLRA 1E79D 1W0JD 1VG9B 1DAMA 1II8A 3LVRE 2UKDA 5JSZA 4LK2A 4Q47A 1M6NA 2P65A 1Y3AA 2WM9B 2IBMA 3REFA 5A0FA 4TYPA 4KO8A 1EK0A 1SHKA 2MMCA 1W36D 3T1VA 1XZPA 2D7DA 5AJWA 1ZD8A 2ANCA 1W0KA 2IYTA 5KNBA 3D7MA 1S3SA 3ZYCA 1U0JA 2G88A 1JBKA 3PFIA 2W6IA 5EE5B 3AP3A 2P2LA 2ZSEA 1KKLA 3MMPA 5FTLA 1EWRA 3LBNA 5JJLA 2HUPA 1TEXA 1Z6GA 2YWFA 4A6PA 2MSCB 3GJ5A 4DSOA 3GJXC 3U61B 4ZCIA 1II9A 3RS4A 1Q1QA 1HE8B 3K0EA 4JLDA 3UMRA 1ESMA 3QOFA 3AVVA 4JLAA 2BMEA 3W8RA 4PC2A 2O8BB 2BBTA 2W58A 1G41A 3A6PC 1KMHA 3H2YA 4HAYA 2ZSAA 1OKKA 1GG2A 4OL0A 5FOXA 1CJKC 3RHFA 3ADDA 3KQLA 3CF6R 1LFDB 3BAFA 3SQXA 1H8HA 1ZM2A 3X1XA 2V3CC 2GETA 2ANBA 3SYLA 1RKBA 2ZPTX 4V0NA 3FHCB 1ANKA 2A7QA 2ZJYA 3AVXA 2H57A 3FFAA 2C8VA 3KL4A 1EFUA 4BLSA 5FH9A 3SU8A 4PHGA 4EKDA 5CLLA 3KKPA 4ASUD 1IBRA 4W5WA 1IONA 1NBMD 1YZUA 4IOMA 3HR8A 1XD2B 1VCMA 4EJSA 4C0BA 4IFBA 1OJLA 4PC6A 1N5JA 2YWEA 1OIVA 1G3QA 2DFLA 3GLGA 5DYGA 2OCPA 2VHQA 3EXAA 4FMCF 2LKDA 4X8OA 3K8YA 4HB2A 4UNNA 2I1VB 1CIPA 1EG7A 1E79A 1EXMA 2LKCA 4DDTA 2QRZA 3AKYA 3OESA 2ZRGA 1YZGA 4G1UC 1UKYA 4FXPA 4URWR 1W4CA 1E2DA 2IYSA 3B1YA 2ONJA 3R20A 5JBQA 3MD0A 4JLVA 4U5XA 1KZGB 5SZKB 1FQKA 1Z22A 2WBLC 5KDLA 5FPHA 1CF4A 3KQNA 1QG4A 3N70A 3CPEA 1ETUA 2IL1A 3R8FA 1VHLA 1W46A 4MYCA 1G6HA 1KK1A 4Q01A 3CRMA 4S35A 4B3CA 5KTYA 1K8RA 4TLCA 4EIWA 1YE8A 2H7VA 2VP4A 3OEEA 1LS6A 4GZMA 4QGGA 1VG8A 1KTVA 1U9IC 5KYKA 1G3MA 1CJVC 3GJ3A 1L4YA 3CONA 3A8TA 3DMDA 1F5NA 1XEXA 2O0KA 5JWOA 2E9SA 4HAZA 1N6KA 1KSHA 1KAGA 2GA8A 1W1WA 2VA8A 3ZJYA 4I1SA 3LLUA 1G8PA 1HQCA 2N46A 3AF2A 1DO0A 1KSGA 3WXMA 4JL5A 4C2TA 2FFAA 2XTNA 1I2MA 1EFCA 3K0FB 4LSGA 2E1RA 4M1MA 2ZRDA 2ZJ5A 4NMMA 2WSMA 4PO1A 4DXAA 1N6OA 3ZZTA 3HWSA 4B74A 2O8CB 1BS1A 3W5IA 4BZQA 3Q72A 2VEDA 2Z6VA 5ELXA 4FCVA 4L4UA 3B8HA 1NG1A 3MLEA 3NBZC 4XTRA 5AUQA 1RC8A 3TAHA 1J70A 3QSYA 1U8YA 3QXHA 621PA 3EA0A 3ETLA 4V0ME 2HT6A 3BWDD 3NDPA 4W5JA 2DFTA 3A4LA 3MHVC 3E1SA 1GNQA 1IN4A 5BYKA 1G7RA 1JECA 4CYMA 4GRAA 4CW7A 5JMTA 4DT1A 5LDDC 3OZXA 1Q3TA 1KO5A 1N6PA 2W2XA 5JJKA 3NC1C 2WHXA 3LX5A 3TNFA 4DCSA 4A0RA 4F91B 4XIGS 1GRQA 2J0QA 2PZEA 3R9IA 2AD1A 1TPZA 2OAQ1 4TN1A 1Z07A 5HE9A 1XB2A 3EC2A 1Z8FA 4E5UA 4A3VB 3GEHA 3KX2A 4M0LA 3VKGA 4G5SA 3C8UA 3DM9B 5C46F 1D8TA 4JL6A 3K1JA 2R6DA 4M1YA 4BLOA 3CR7A 1E0JA 1UDXA 4EJSC 3TLXA 4B2LA 1G8HA 1M7BA 4CVNA 2QZ4A 2Q21A 1W4AA 3CW2A 1P3JA 3G82C 4JKIA 3NVAA 2F1IA 2N42A 1G5RA 4D4KA 2EU8A 1L8QA 2PL3A 1KI9A 4KYUA 2FSIA 1IXRC 3AP2A 4WBSA 4WVFA 3MGCA 4EQ6A 2J59A 1U0HC 4RKEA 2A78A 4B75A 4XWAA 2BM1A 5HE8A 3PUYA 4TYYA 1ZP6A 2DYKA 1NKSA 3ZQ6A 2CCKA 2WKQA 1TU4A 5C2JB 2HT1A 1OYWA 2YNMA 3IIKA 2QP9X 2KSQA 1TU3A 4HZUB 1SKYE 3AKEA 5CITA 4HLCA 3WYAA 2OXRA 3EG5A 1OB5A 5FL3A 1DG3A 3DHWC 4L5BA 3U44A 2CEAA 2C96A 2IXEA 4JVSB 4PZLA 2A3RA 1AGRA 3SJZA 3PITA 4FI3C 4NCKA 1KI4A 2CJWB 4QBFA 5B30A 1GKUB 4DUGD 2X19A 4KYIB 3AVUA 1BOFA 4XOIA 1AZSC 1KO1A 4FINA 1G4AE 4ILEA 5FBRB 4R2HA 2AD5A 5C1BA 1Q57A 1YRBA 3KUCA 1DS6A 2A5GA 3QKSA 4TQAA 1UKZA 3B1WA 3T35A 1GRRA 2WV9A 4A0HA 4PHTA 4K46A 1ZU4A 2ZAOA 1DO2A 2ZU0C 3THYA 2JJ1A 2B21A 4AK9A 2VHUA 4Q9IA 5A5GA 1W44A 4MRVA 4Z54A 1E96A 3B1ZA 2RGCA 4PX9A 2AKYA 2ATVA 1UEJA 3UWKA 1XXHE 1RRFA 4ON9A 4C0JA 1HT1E 3EZ9A 1YZNA 4XWKA 2BBOA 4IVPA 3DOFA 4MUBA 5DLQC 4MUAA 4D2IA 5FR1A 4HLUC 5JSZB 1TMKA 3QUSA 1EGAA 1W49A 4JKYA 5HCNA 3QE0A 2PJZA 3GFPA 1VYUA 1NVUQ 4QNRA 1XEWY 5SZIA 3C5HA 2C04A 1WQ1R 1Z08A 3BFVA 3ECCA 4P33A 4TLEA 5UKDA 3BH6A 1TEVA 4IJMA 1J99A 1KI8A 2W2TA 3B6EA 1E2LA 3NH6A 3U6BA 2WJGA 1TX4B 1ZW6A 1E9BA 1IOZA 2OLJA 2QORA 2OSBA 1JAHA 1JR3E 1TQ4A 4NBSA 4GBMA 4NYJQ 5TXGA 4CEHA 1RW4A 5FI1B 2F9MA 4XVUA 1CRPA 1P75A 1QRAA 1G291 4PAOA 1XCGB 3SHFA 3UPUA 3L0IB 4DDUA 5CIQA 2IYXA 5FTKA 121PA 1D5CA 1WA5A 1E2JA 1KMHB 1UBGA 2WPDD 1P4SA 4DEXA 4LPKA 1XTIA 4UJ5A 4W7SA 1US8A 3TUZC 3HU3A 4URZR 4BEJA 3FMPB 4ITRC 4KU4A 3DMNA 4DSNA 4RFVA 1DAIA 4IDOA 4R7ZA 2LWIA 3CLVA 2IS4A 2WKPA 4OI1A 4OI0A 3LAWA 4NZYA 1E2HA 2RCNA 3ADKA 1OIWA 4HLDA 1XTJA 4P4SA 2GAOA 3P26A 1S9DA 5ANRB 4DBLC 4V02A 3QF4A 1F2TA 3R8CA 1E1RA 3Q3JB 2OFXA 2OFOA 2XAUA 3O8RA 3VR3A 1C1YA 3RS2A 3GLGB 1Z28A 1SXJD 4XVRA 4JLMA 4D0LB 5JFGA 2QP3A 2HXSA 2HLDA 5EE3A 3NHAA 4TZ0A 4BZXA 2D2EA 3SFZA 2VF7A 4BE7B 1IAQA 3EZFA 1HV8A 2AWOA 2IXGA 3ONWA 4DLUA 4V0MA 1CRQA 3EZ2A 4A1FA 4DLWA 3I62A 4JMPA 4R2IA 1P5ZB 4URUR 1RZ3A 4WAUA 5KO2A 3THXB 2V54A 3X1ZA 2ODNA 2DWOA 4Q5IA 3PEYA 2NMVA 1XD9A 2ZS7A 4Q4AA 2B6HA 4UJ3A 1MRNA 2AR7A 1ELOA 4PSKA 1G8GA 4PO8A 1FOEB 4LHZA 2GXUA 1R4AA 4JJZA 4YXWA 4LJ7A 3BFKA 2FSFA 2QSYA 3MWLA 4IHQA 4E07A 1NNEA 3IIJA 3U3RA 4YMTA 1RJ9A 3QBVA 1QHXA 4S2EA 3SZRA 3LW7A 4ARZA 2ZJOA 1W2HA 1XEXB 2ODEA 3CBQA 3IILA 4KJZA 4KCGA 3TBKA 3VR5A 3AJIB 2J7KA 3AUYA 5IRCD 2FNAA 2EYUA 1KDTA 2P0EA 2YC2C 1KMQA 2P6UA 1QVRA 3B7GA 4DB4A 4LHXA 1CR0A 3TSWA 4QNMA 2ZI9A 3GP8A 2CCJA 2QTVB 3L0OA 1E32A 2CMKA 4G3XA 3PIRA 2ERXA 2YOGA 3U3OA 5K8TA 3SHWA 4NCNA 3SR0A 2GXQA 3BOSA 5F3WB 1PZNA 1CULC 5E7MA 1JXMA 2C5LA 3EIQA 1QHYA 3O8DA 4FCTA 3VKWA 3CM0A 3E5HA 2W00A 4HDCA 4A2PA 2GF9A 1W48A 3D8BA 2DWQA 2ZM5A 3TUJC 2CLDX 4KSBA 1XBTA 1SXJA 1I4LD 1SVKA 2C77A 4N3NA 2CE7A 4KLNA 2D7CA 4ZDKA 3FTQA 3I8SA 4DT1B 2WJIA 3QBTA 2D74A 3VNUA 1R8QA 2QQEA 1E0SA 4HUQA 4A6XA 4OJQA 1T0HB 4GFDA 3ICQB 3V4FA 4M2LA 1NI3A 2Q9CA 1N3BA 3PUVA 1ZUNB 8OHMA 1JPNA 1S96A 1YZQA 1LW7A 1CJMA 2CVHA 1NMXA 4D81A 1ZCBA 2A9KA 3DM5A 4FMDB 1E0KA 5LBIA 2PCLA 3PR1A 3NBXX 4URVR 2JA1A 4WZAE 4JL8A 4MGZR 4PHFA 1GAJA 3ZGXA 2FGJA 3CZQA 1UADA 2XJ9A 2H1LA 4KBFA 3NHBA 2FPKA 1XXHA 2PX0A 4B76A 5BYJA 1AIPA 2VP6A 3OFND 2CCGA 1XCPA 2ORVA 2D2FA 3AGQA 3RC8A 4JVMA 1XEWX 3CKLA 5LD2B 3NEJA 3A1TA 4G5QA 3CNOA 1FP6A 3KJGA 4EQ6B 4PHHA 1KJYA 1QHGA 2IYRA 1G3RA 1ZC3A 3CX6A 4Q18A 5P21A 5BQ5A 3RVBA 4BASA 4BZPA 4OI2A 5D3QA 1YJ5A 1Q1BA 2NOAA 3BD9A 1UBFA 3TJZA 5J4YA 1CS4C 2AL7A 4QL3A 1IM2A 1CR1A 4YMUA 1UEIA 1A7JA 5FL7A 4OHZA 4B6FA 3GMTA 4Q7JB 2KBEA 2FZLA 3NIBA 1N5IA 2IXFA 2DB3A 4M21A 1NLFA 2YOFA 3W90A 1RRCA 3U44B 1OH5A 4OYHA 2FEMA 2BCJQ 2VP0A 3B5JA 4BLPA 4DLVA 5FUWA 1UDWA 2XZOA 2ZUDA 5E7IA 1E69A 3LX8A 4CZ2A 1P2SA 1E9RA 1QHNA 3WRYC 3OIWA 3QEJA 1VG0B 4ZCMA 2WWXA 1DPFA 2O8CA 5D3MA 3K9LA 4PANA 5DE3A 2O8EA 3FKSA 3VR4A 3QKSB 2GJKA 2EFDB 2QN6A 2GK7A 2OBNA 4QBIA 4F92B 2HJVA 2XSZD 4ZI3A 1T5IA 3THYB 4P32A 4Q4LA 4QJ3A 1MKYA 4FMBB 1NLZA 5GADl 3BFXA 2OFWA 3UANA 2ORWA 4G5GA 1K6MA 3HPQA 5JEEA 2F55A 2JLVA 1FUUA 1UBEA 4PXAA 1OSNA 3M6AA 2PEYA 1NVVR 1S0UA 3ZIAD 4OHYA 2WJJA 1OT3A 1SHZA 3B60A 4ZKEA 1V43A 3K9GA 4ZIRA 1AKYA 2QAJA 4GOXA 5IK2D 3W5JA 4MGYR 4BRWA 3PUZA 1WBDA 1X1SA 1SXJC 4KFTA 2QP4A 5AJZA 3WP1B 2V6IA 3FFBA 2WIAA 3B2EA 1DVRA 2IYUA 2WJYA 1GP2A 2Z4SA 1EFHA 2R6FA 1OHHD 4IDQA 5CB8A 3UG7A 3ASZA 4PTLA 4I4LA 2ZUCA 4LYFA 4MH0R 4GP6A 1MO5A 4H1UA 4Q7LA 4QBHA 4FWDA 4HSEA 4TMWA 1UKVY 3AUXA 4KFUA 3VKHA 2GXSA 1ZIOA 2W6ID 4B43A 1P72A 4M1KA 1ZM3A 2VRWA 4UXIA 2J46A 1JR6A 3KKMA 1KOFA 5FOTA 1UPTA 4TT3A 4CT4B 2BMFA 2BV3A 1G20E 4KBGA 1MABA 3T5DA 3UK6A 3DPUA 3ZS9A 1LNZA 4NYJR 5H68A 3KB2A 4B35A 1US8B 1OH6A 1S1CA 2PCJA 2AFHE 1QHHA 1JEEA 1DOAA 4M9XA 2PZFA 1RYFA 2HV8A 2Q0HA 1KKMA 2A30A 3SN6A 1JPJA 3AKDA 3R7WB 1OKKD 2AXNA 1HURA 4IDPA 1F2UA 4MYHA 3DDCA 5CK5A 2VSFA 1XDBA 1H8HD 1NP6A 4LRTA 1AS0A 2QMEA 4P4SB 1XMIA 3LLMA 1RVDA 2B92A 1G6OA 4MA4A 3RYTC 2J5XA 2ZI4A 4RY2A 1GTVA 2KE5A 4DCVA 1F2TB 5FTMA 4LRSA 4X8MA 3WNCA 1NBME 1I2DA 1G8FA 3QY0A 3OEHD 3A58B 1E1QA 3AVWA 1FQJA 1PUJA 2QT0A 3ZVNA 4OK6A 4Q00A 3I5XA 3GJ7A 4GDFA 2WMNB 1NMYA 2UZIR 3N2IA 1KO4A 1OPXA 4P31A 5C4MA 1QDEA 2I3BA 3GD7A 4LCBA 4CIDA 4D0NA 2RGGA 1W7AA 1QZMA 4LV8B 3TW8B 5B64A 5IF9A 1NVWQ 5JJIA 2OBMA 2FF7A 2RH5A 2QSZA 2REOA 1A1VA 4AI6A 1UF9A 3RDPA 2ZJBA 1RFLA 1G19A 3F0TA 4JT4A 2RGXA 4I1VA 2XTMA 2OM2A 2VLIA 1OFIA 2IUUA 3ZDQA 3HDTA 3PQCA 3EZ6A 2GEDA 2IA5A 3NTUA 4Q4AB 1OHHA 1YZTA 1P9WA 3OE7A 2Y8EA 1KNXA 3QENA 3TSZA 3TVDA 4R98A 2VP2A 2FEOA 4AC9A 4BFWA 4EPWA 2YWHA 4HDOB 4W9MC 1G5TA 3KKNA 3L82B 1G8YA 5FOVA 2CDNA 1RJ9B 2ZVQX 4LC1A 2X2EA 3C41J 3LVQE 1YVDA 2GCNA 4ARZB 4GSYA 1P60A 1XU4A 4IDHA 5EE1A 2YV5A 3QNUA 3U7GA 2ZSFA 3ZS8A 4PPNA 4I99A 3Q8XB 3FHTA 2P5SA 5JI2E 1HE1C 1P2TA 1DE0A 3OEED 4LV5B 4B48A 5FI0B 4M1TA 2CNWA 2WICA 5HR5A 1COWA 3CR8A 3FPAA 1SVMA 4MDFA 1E9CA 1DAHA 2QEQA 4B2IA 4DEYA 1GRNA 3CIOA 4M8NE 5FPSA 2EYQA 1GKIA 2GVDC 3FMOB 4KFRA 1IY2A 3VNVA 3T12A 4JSYA 1XMVA 1ZNZA 3IEUA 1SKYB 1ZUHA 2JCSA 1KK2A 3A1VA 2Z4RA 2QM8A 3JVVA 3OEHA 1JQJC 4XH9B 1SXJB 1M74A 3TW4A 1ZM7A 3GJ4A 4TMXA 2A2ZA 2ZXUA 4FCWA 3DKPA 4A0FA 2QBYA 2UZ3A 4YMVA 3KJEA 2UVQA 4HUQB 1II0A 4OQNA 1NN3A 3I5YA 3U2QA 2R6AA 4RFSA 2ZUBA 1AQYA 3AEZA 1IXZA 1XMJA 2BOVA 2ZI7A 5DH9A 5BW8A 5JRJA 3K0SA 2ODWA 1JEDA 2CLSA 4QFMA 4URXR 1DAGA 3WBKA 5DNYB 2OESA 4QC2A 4HB4A 3THXA 2N1BA 3C5CA 4A8JB 4CT5A 1PJRA 1G17A 3CX7A 1XXHB 2GKSA 5GVRA 2BC9A 1N0UA 3PENA 4A9AA 2QI9C 4URYR 3KFVA 3AKCA 3TIFA 3IO5A 3MUFA 1YR7A 1RE0A 4ACAA 4AURA 5DN6D 1MO4A 2XZPA 4UNPA 1XX6A 3J81k 1NN5A 1Z2AA 5H70A 1Z06A 4LC0A 3VU9A 4Q4JA 3LWNA 2DHRA 4ZKDA 2CHGA 1JNYA 1KI2A 1QF9A 5EP1A 3WHKA 2CK3A 2QENA 4E22A 5GVSA 1GM5A 3Q5DA 2WWFA 3RRZA 1LB1B 3UMSA 4CF7A 5EJEA 2ZSDA 4YONB 1KK3A 4IOLA 2C9CA 1Z0JA 4D80A 3VHLB 2BBSA 1EESA 1JQLB 3BXZA 2VP5A 4M22A 3VTKA 3LV8A 4Z8YA 2XB4A 4C0AC 3HU1A 1X8LA 3IHWA 2AXPA 2D06A 5D3MB 2ZAMA 4B3XA 2WAXA 1DADA 4PC3A 2O8EB 3HR7A 1N2CE 1ZUIA 1U98A 3U7EB 3H0KA 1ZNYA 1KDPA 2W0SA 5EXPA 2G1JA 1PLKA 3WNBA 3FWYA 5KSZA 1KDOA 1QBKC 3K0CA 3GLHE 1IY1A 2IUTA 3AF3A 1XPUA 1GILA 2JIZA 2EVWX 2JJ1D 3CWZA 5JEDA 2IF2A 4GOJA 1CTQA 2KBFA 2HJGA 2JGNA 3SEAA 2OILA 1AJEA 3MSXA 5KSOA 5M04A 4ZIRB 3VR1A 1T3HA 2RGAA 2ATXA 5B57C 1X3SA 1OFTA 4I1UA 1GL7A 2KI5A 4EAQA 4IXMA 1UBCA 2ZRCA 3AF1A 1O87A 4CGZA 3P4XA 2O8FA 4XVQA 4FWIB 1S4QA 4NPHA 3VMFA 1AM4D 3FVQA 2RGBA 3NBYC 1TAGA 4LWZA 4M4SA 3TQFA 4TTRA 3T1TA 3O8CA 2V1XA 2X77A 3U3KA 2BVNA 3EASA 1XPOA 5DN6A 2F3TA 1N0VC 3TK1A 3CWQA 3TQCA 1X6VA 1Z6AA 1J90A 5FUXA 3WYGA 4N1AA 4Z1MD 3A1UA 3GEEA 2JAQA 5FUYA 5TDHA 5JI3E 3I73A 2J41A 3SC3A 1SVIA 3QI2A 2GJSA 4HLQB 3A4MA 5DO9A 1R8SA 3IO3A 2QMHA 3UKDA 2FSGA 2ZJ2A 1MABB 3GFTA 4LYAA 4OJKA 2Q3HA 2ECKA 1S2MA 2JLYA 1MO6A 2ZRIA 2XJ4A 4WIAA 4G01B 3LXXA 3VR6A 4P0TA 4Q9HA 2HDNB 1WB9A 1QHHB 4LYHA 3CNNA 3Q5EA 3ZZ0A 1RPZA 1D9XA 1N6RA 4QGAA 4TMTA 4LY6A 1G3UA 1NMZA 1C4OA 1E9DA 4MKGA 4UNRA 1F2UB 1T8TA 2NO0A 4OQXA 4B47A 2Z43A 3IPYA 2FWRA 2FPMA 4MRPA 3LD9A 3RLFA 821PA 2QU8A 1SVWA 3R9WA 3X1WA 1UM8A 4Q03A 4MQBA 1XNJA 1T3SA 2GDJA 2O52A 2Q6TA 2V7QA 1XJCA 1P61B 3L8ZA 1E9EA 1N5KA 5DGXA 2JASA 1NVVQ 3AH8A 4Q9KA 1PV4A 4CDGA 4PSAA 1E1RD 3VHXA 2K5UA 2YC4C 4UNQA 2B8WA 1AK2A 1DARA 2HXYA 2JLSA 4TTPA 1A2KC 1OH8A 3GLFE 2HLDD 3HPRA 1QVAA 3AVYA 3EARA 3QKRA 4B71A 5DI9A 1D2EA 1ZM9A 4DCNA 1QHIA 3U7FB 3QXXA 1TUIA 3BIFA 4HZIA 4ESVA 1M7GA 2ZE7A 2J0UA 1G7TA 1EFRA 5FOWA 4JLKA 2A5DA 2PEZA 1L2TA 4L15A 4LJ6A 4QGFA 1N6LA 1T91A 4RKFA 2ZEJA 4MITA 2FFBA 3RS3A 3KZ1E 4B3GA 3QVUA 5F9HA 2F9LA 1HA3A 1ZNXA 2X8AA 2ZJZA 4ZDJA 2OT3B 2XXAB 3UWOA 1DEKA 3W6NA 2YINC 2C99A 1SKQA 2FJUA 3PV0A 1LV7A 4Z1MA 1FNNA 2ORIA 3K0AA 4A15A 4POAA 1OLOA 4YXWD 3QKUA 4JYBA 1MRSA 3H84A 4HB3A 1RYHA 4R71A 4JIMA 5DI3A 3PEUA 4G0NA 4GITA 2ZE8A 2RB4A 5FUVA 2IWRA 1KIMA 4RD4A 3ZD7A 1A4RA 2JLQA 1VIYA 2ZR7A 3AVTA 5IT5A 2H8KA 221PA 2PMDA 4NDZA 4KAXA 4EUNA 1G3IA 4LYJA 3WNDA 3MJRA 3EA5A 3T1QA 4X8HA 4Q7MB 2VH5R 2PX3A 3FMFA 1KK0A 3V9PA 2G0TA 1CKEA 3PEWA 5LD2C 1UJ2A 4PAMA 3THOA 2PJRA 1U8ZA 3R7WA 1I4TD 5J4LA 1OW3B 1KI6A 2CL6X 3IDQA 2VQSA 1YQTA 4XD7A 4QHTA 2MMGA 4AKEA 2ZRFA 2OHFA 1ZU5A 4OHXA 4Q1AA 4BFYA 1W5TA 2IC5A 1C1KA 2RGNA 5G41A 4FMDF 2V6JA 1R6BX 2BMJA 3HYTA 3ZVLA 4RD1A 3GLIE 5FPYA 5KDDA 3X1DA 4A92A 4O3MA 5JS7A 2KJQA 4AYTA 1E4VA 2V8OA 2AK3A 4RZ3A 2KRKA 2QBYB 1KSFX 3PEVA 1ZIPA 3DZ8A 2VSOA 5EZ6B 1VYVA 2OE2A 4N0DA 4EFLA 2WZQA 4UXJA 3F8TA 2YJTD 4RFSB 5CM9C 3CUEF 4DLXA 4LJ5A 4Q19A 2BWJA 4PPGA 1GDDA 1R0YA 4RD6A 2IYZA 5HTKA 2JLUA 1KHTA 2IHYA 3C15C 3LA6A 3W3AA 4Q02A 4DCUA 2WSSA 3C7KA 4ZDWA 3U6KA 3B1XA 4NONA 3RC3A 1G18A 2IYYA 5EUQB 5BN5A 1HQYE 2HEIA 3C4JA 4AG5A 4BPBA 1CR4A 3A4NA 3O47A 3QIAA 4NYMQ 3BS4A 1WCV1 4M53A 4RJLA 2H17A 4LBWA 2GZAA 5FPKA 1FTNA 5KNCA 2ZS8A 5J4KA 1P6XA 3DKVA 3PVSA 1NJGA 4L9WA 4EPVA 5AR1A 3VLFB 1R5BA 5SZHB 2ZQ5A 1FPMA 4OKSA 1HH4A 1J8MF 2OBLA 2CE2X 3QQ5A 1Q12A 4DKXA 3UIEA 2YWGA 1G21E 1VG1A 2PLRA 2NG1A 3HYRA 3VU9B 4Q4JB 5BN4A 4QM6A 4A0GA 4M1SA 5KUTA 1FMJA 4LBYA 1WP9A 1A82A 3RRNA 3CRQA 5FFMA 1P7CA 1S3GA 2GHIA 4TSFA 4UNSA 5FL7D 2EW1A 1CBUA 1C9KA 3U3MA 4I81A 2QT1A 1ZD1A 4Y0AA 3L8YA 1ZRHA 1N6IA 4AY2A 3CRVA 3REGA 3I72A 1NVMA 3HJNA 5DHFA 2R8RA 3TE6A 4PPQA 5AUOB 4NTZA 2GRJA 2R2AA 2TMKA 1LY1A 3VR2A 5G40A 4MGIR 1FMLA 3OIVA 4V0OA 5CYPA 5FTNA 2F7SA 2MSEB 1XF9A 3RWMB 5EP4A 3WMGA 2P6NA 2ZRAA 3LNCA 3MWYW 2R6CA 4TWZA 2WWIA 3AB3A 2AHOA 3FKSD 2CL7X 4LV6A 5HCIA 2RHDA 1ONBA 4RCZA 3ZZUA 1W5SA 2IYLD 3E2IA 3T5GA 4DCTA 2GJ9A 4H9GA 4MRNA 4DIDA 2ERYA 2JJ8A 2V55B 3BJIC 1NG9A 3U3JA 3CPHA 3I61A 4FWTA 5JRZA 2NPFA 3CO5A 1KYIA 3SBEA 2ZYUX 2NTYC 4GI7A 4V03A 4QHSA 1H8EA 4TTQA 1SVSA 4BLRA 5K8LA 2O8DB 3L0SA 3HU2A 1NRJB 1VCOA 3CB4A 4JBWA 2FV8A 2JATA 3GJ8A 1BKDR 3QG1A 3QEOA 3RSLA 4NP6A 4UXHA 4D26A 2WTUA 3D31A 2HCBA 1DTSA 1FUKA 2EQBA 3SDZA 2YKGA 2O8FB 3JVUA 3WRXC 4A8JA 1J8YF 4YMSA 2C2HA 3EX7C 3GLFA 1K5DA 4KV9A 2WAYA 1XJ0A 2XZLA 1P9NA 1IJEA 1VPLA 1T9HA 2FG5A 2ZRMA 2KB0A 1GWNA 4KVAA 2FFQA 1UFQA 4F7WA 1XMSA 4Q9LA 3KKOA 1NLYA 3P4YA 1ESNA 2RGDA 1ODFA 3GEIA 5BN3A 3EZ7A 5JLJA 2CHQA 1KJWA 2Z5FA 2CHVA 1S1MA 4QHYA 4EDHA 1BYIA 3B85A 3TUIC 4C0KA 2DFKB 4ZO4A 1TADA 4AIIA 3KJIA 3BH7A 3Q85A 2QPTA 1XD8A 5DHAA 1GUAA 4QBGB 4TT3D 1L4UA 2NIPA 3PG5A 2O0HA 1GZSA 3WMEA 4DIEA 2OCAA 2ZYWX 4JSTA 4DRZA 2QMUA 3H1TA 4DZZA 1JR3A 3EWSA 2Q9AA 2IYWA 5G3YA 4C3ZA 1HT2E 4PZZA 2QAGA 5BWMA 3NKVA 2H16A 1FFHA 1OIXA 3BB3A 4YMWA 4EPYA 2IS1A 5JS8A 2BCGY 1HEIA 2FN4A 5TMPA 3TKLA 3K09A 1VYTA 3IQXA 3FGNA 3BERA 2R9VA 4TYQA 4KXFB 3LDAA 1GIAA 2DVWB 2GJ8A 4TL6A 3L43A 1Z0FA 4DDWA 4BUJA 2IWHA 3ZQJA 3KJHA 3SBDA 3SQWA 1E1QD 3BORA 3OF5A 4OK3A 4QRHA 4XJXA 4BFTA 2GWHA 2XTZA 2FSHA 2CXXA 2IS2A 3P20A 1J2JA 2FMXA 2DZNB 3CZPA 2P5TB 3RABA 2WWGA 1G16A 3EAQA 3VX3A 4II7A 3VX4A 5EXSA 1SGWA 2GCOB 2ZI6A 3QKRB 3AF0A 3C14C 5J47A 3GPLA 3Q7QA 2XOKA 1BYUA 1Q1EA 5J4VA 4TMVA 2YZ2A 3GLIA 3SFVA 3SNHA 4LUCA 2BJWA 4JLPA 4QM7A 4EPTA 2JJ2A 1X37A 5K8UA 2J0UB 2PMKA 4IKEA 4JZKA 2NO6A 2KWIA 2A5FA 1KDRA 2AN9A 4BLTA 1YR8A 5F98A 2AFIE 4M1WA 3FMIA 3WY9A 4ACBA 1GL6A 3DZDA 1Z2CA 4IDNA 3DL0A 3OIYA 2GVZC 4Q21A 1XEFA 4Q1DA 3K0AB 2QGNA 2ZTSA 3OE7D 4B3FX 3JZMA 3EIHA 2IEZA 4BFVA 4Z51A 5J4HA 3FB4A 1XTQA 1Z47A 3KB1A 3MWJA 3FYHA 4UQOA 5B2ZA 1AKEA 4LZZA 3DO6A 2D3WA 2V9PA 2YVUA 4KI0A 4PR0A 2G83A 1ZCAA 5DI3B 2RKOA 1G1MA 4M9ZA 5TVKA 3TR5A 1XTKA 2PT5A 4B73A 1IN8A 1O3YA 5CYOA 4C0HA 3ZD6A 2FFHA 4YQFA 1CU1A 2E87A 5TY0A 1FTSA 4Q1BA 3SJCA 3V4RA 1OXTA 2B7BA 2DR3A 4A8JC 2I4IA 5EXXA 4Q1FA 1FL9A 2HYIC 2IEYA 3W8NA 1U99A
chains in the Genus database with same CATH superfamily
2ZAIA 1RMYA 1IMOA 1MJFA 2RHTA 3QYEA 4R9RA 2ZIZA 3JR3A 4OK5A 3ZU4A 1Z2EA 3HDYA 4JLOA 3CRW1 4OB6A 3UG6A 3UW3A 4R2LA 1OYYA 1L5OA 3GLHB 1A1SA 3GPYA 2D7HA 3T7DA 4D79A 3ESQA 4TLDA 2EGHA 1XAIA 1KO7A 1Z5WA 4NBVA 2IHUA 4ENSA 4QPZA 3A1EA 1GU1A 5L95A 4CG2A 2JVJA 4X66B 3VXKA 1T2AA 3ET5A 3EFEA 1NXTA 2B7LA 1OTHA 1C7FA 4CISA 4WH0A 3WI7A 2V45A 3P0EA 2NUTA 2QROA 4EH1A 2W6JA 3O7WA 3N75A 3GDWA 2XRFA 1BMFA 3E7XA 4PCVA 3LUJA 4ENRA 2ID4A 3C4QA 1TCAA 4V1CA 1R3DA 4HUTA 5E3JA 1C1XB 4HP8A 3T4UA 1I2BA 1NOJA 4TWBA 3MFYA 5BUCA 3HJUA 1KE1A 1N7JA 1NYTA 3E23A 1FFXA 2PLFA 3OAAA 1GUBA 4RTPA 3TRFA 2GXAA 1F06A 1W0JA 5EJCA 1OWLA 4U5QA 3LXUX 4RD0A 3A3YA 3VK7A 3KEQA 1FYWA 4GM1A 1GPJA 4BLQA 5C35A 3UFXA 4AKIA 1UMCB 2BKUA 1Y3FE 1KBQA 5KQPA 2ID7A 3D3QA 4YJHB 3OIFA 4FIDA 4JUBA 4DG9A 1LBHA 3SBOA 5EXTA 4B34A 1V4VA 2EA0A 3EXEB 1NNUA 2BLNA 3ROFA 1SVUA 3RC7A 3T15A 3V4ZA 1YCGA 1RWXA 4X6YA 2EP7A 3TF5A 4PSCA 5C4GB 2Q4BA 4DB2A 3DHNA 1SCBA 2X4GA 4BPRA 4C9BA 2EJCA 5KTTA 1CJSA 3T3IA 1X15A 1DUSA 1G7SA 4RW0A 5K2OA 4D9GA 4HQNA 3D4NA 4I8IA 2YV4A 3X1KA 2H2HA 1XTSA 3K2IA 1NBIA 3GEMA 3STYA 3K6SA 5EFZA 1NP3A 3KYCA 3SZ3A 3B3GA 1WKVA 3SC2B 2YWCA 5D8DA 1AHIA 1EDZA 1YU9A 2I8AA 2GESA 1E6EA 3IEPA 2E49A 4RNAA 1KJ8A 1PQ4A 1QYRA 2CV2A 2EBUA 4DTIA 4Q37A 4ZEVA 6Q21A 1DJQA 2P2GA 3WWZA 3ZW7A 3ZCVA 4G9EA 1V3TA 2XNHA 1E4EB 2JIRA 2Q2OA 1U81A 2GBFA 1LZLA 5KNCD 5EWJA 3LKBA 4LXQA 5IABA 3USCS 3Q7SA 4YHBA 3KV3O 1IEXA 2J0SA 4H08A 4H7PA 2VSQA 2AQIA 4AAYA 2NT4A 3U1VA 3VR2D 4ME6A 1WL8A 5AUPB 3FKEA 2CVFA 2GILA 3TZLA 3VU3A 2JLZA 3T6KA 3U3ZA 1WE2A 1Z2DA 2Q29A 4J76A 2VDNB 3N0VA 3MYYA 3LSTA 3IP8A 4O4LA 3RC2A 4BFXA 1U94A 4MYUA 1TF5A 1X39A 3T5PA 2HNAA 4KSCA 5KSYA 3W3ZB 3DPSA 3O5AA 3E3OA 1NATA 2E5WA 3ZH9B 1ZVQA 3AX6A 4JDPA 3OQNA 2XA9A 2B2CA 2XBUA 1QB7A 4TX1A 3QPUA 1NL3A 4WZ6A 3SVZA 3KDSE 2NZJA 1KP9A 4WCFB 5KIAA 1Z35A 1YL6A 3FDIA 4XSHA 1YAHA 1JJAA 5JWRA 4LFCB 4J0DA 3LW8A 4GNKA 2HKJA 4L9SA 4FFBB 1SCDA 2WI8A 4IUDS 4K6MA 3QLUA 1XIVA 3TS1A 4J1TA 4KVFA 1E7QA 2HIMA 4OMUA 2XRZA 2QQGA 1F6BA 3DMTA 4LOAA 2ZIEA 5D00A 4TKUB 4XB6B 3W5BA 3ZW8A 1OXXK 1E8NA 5ADVA 4UBLA 4C7OB 1AN9A 1R4GA 4O0MA 5K9ZA 2O0LA 1CG6A 3JAWB 4IMJB 3T0FA 3W68A 4WNCA 5KNLA 2ZANA 3V80A 3SIWA 5TGTA 3RRMA 1FPQA 3W4JA 1FP1D 5E4JA 1Z63A 3BWXA 1PKEA 3WKBA 5KPJA 1F0PA 3VQTA 4U7DA 4DCGA 1P9RA 5LM3A 1Z7YA 4DV3B 4TMYA 3G68A 3SQOA 1A9PA 1FVXA 1A2QA 1CS0A 2V8BA 1TF7A 4DLPA 3P0RA 1LH0A 4OM7A 4I3HA 2VYFA 2JL1A 4NCIA 3VR6H 1F8FA 2J3DA 4ZFNA 4XOUA 3GUHA 5KPDA 2E4ZA 3LBYA 3W6PA 3DJFA 2P41A 2I6SA 3GFGA 1Z12A 3NV9A 4NPCA 4P3YA 4L08A 2P4SA 4Y3UA 2P91A 3TR6A 1EFKA 3FCYA 2JZ0A 4C2UA 1USKA 5DSTA 1HDEA 4J16A 2D5LA 3M0EA 2X4IA 1GO2A 3WDSA 4PYOA 4QRDA 2QRGA 1EK0A 3F1LA 3OMWA 2IEGA 2E3JA 3PC8C 5JR3A 5BSUA 2D0PB 1HE5A 1NXPA 4G86A 3U61B 3K35A 2YRFA 4WINA 1F38A 2B8JA 3VOSA 3P2EA 1ZPDA 1MX0A 3DVAB 4QDOA 3Q88A 1FE8A 2HADA 4S24A 2ANBA 3R7NA 4FN4A 3BTVA 2CDBA 2Y9PB 3EDYA 3P19A 1VSUA 4BLSA 1X1EA 4ZJUA 5CCDA 3PX7A 4UBMA 2FG7C 3M1AA 1VCMA 4IFBA 4FMPA 1OJLA 2PFGA 2O4UX 3QWAA 2OCPA 4W1RA 4HB2A 1WJ7A 4BVLA 3FTCA 1OFUA 2XMCA 5LA6F 2LUOA 2R0QC 4RVSA 2LVBA 4U7PB 2AFIA 3CZRA 3B7WA 2V7WA 4U5XA 1QQ7A 2FK7A 3UENA 4TOIA 1BWSA 5IKEA 1WCXA 4EA8A 2EHDA 2IPXA 4FDUA 3ZHCA 2PUFA 3CRMA 5KYKA 2QZ9A 3GJ3A 3CONA 2NU7A 1XEXA 1KAGA 4HS4A 3ZJYA 3T9AA 4LHSA 4IBEA 3AWIA 3UCXA 1KTIA 1I2MA 4Y2QA 3WLKX 5T6MA 4BS9A 3GNSA 1PJSA 1U8YA 2KQUA 5TEWA 3D4LA 4W5JA 2LCQA 3TRDA 4D46A 5BYKA 2MR5A 3CLTC 1KO5A 4ZI5A 3HYSA 3J81S 4OSOA 2HB6A 3ER8A 4C78A 2EKQA 2RH4A 1YS2X 1CE8A 3GEHA 4B83A 5CAEB 1PNOA 3IVXA 5MN4A 2PBFA 5EKSA 2K0BX 3IR7A 2QRQA 3QFRA 1MJGM 2YIDA 5HE8A 1NKSA 5C2JB 1TU3A 3N8DA 3A9UA 4DHWA 5JDIC 3QTTA 4AMBA 4LNUB 5I7FA 1B42A 2XMGA 2AEEA 4YTEA 3FI9A 4BATA 1KO1A 3ANYB 3SGLA 4M9UA 1WIVA 4A0HA 4I5IA 4K46A 1Z8NA 4WCFC 1OBFO 3QQPA 2BONA 4RK1A 4ZVOA 3DOOA 1UANA 1RWKA 4XWKA 4H0FA 2JPDA 5AIBA 4MCHA 4YP1A 1RKVA 4MW0A 1NVUQ 2FN8A 4PLTA 5KCMA 3WTBA 4Z9FA 4MUGA 1JAHA 3T94A 2SICE 2I7DA 2WG1A 4K9NA 1XCGB 3H7AA 3G7SA 2ZYAA 4BEJA 3STXA 4DSNA 4RFVA 1DAIA 2ZWIA 1Z45A 3U6QA 1ORHA 3GVHA 1SQGA 1EK1A 3QF4A 3UGJA 5IU6A 3CLSD 4KQWA 3IB6A 1B26A 4D0LB 4P0PB 2HLDA 4U7JA 2YBEA 4PPYA 3ZH2A 5LP6B 5KVVA 5BV2P 1HV8A 2YIJA 4URUR 2VT6A 4MPPA 3BFJA 5J2TA 1XD9A 2WF5A 3K4PA 2IBTA 1YDEA 1SRQA 2Z09A 3TL6A 2R48A 1NNEA 4FKZA 1Y9ZA 4ZVKA 2WJWA 1V6SA 2YW9A 4KCGA 2YN0A 1KEVA 3OCUA 3DB1A 4HQOA 1E32A 2ZB3A 3PIRA 4ND2A 2YOGA 4MA0A 1UPXA 4NCNA 3FOBA 3SR0A 3MWDA 5E7MA 4JP3A 1ZWLA 5E6RB 2W00A 3IT1A 2FX5A 4REZA 1ORVA 2D7CA 4HWKA 1IFXA 1M2JA 1R8QA 1E0SA 1UK8A 5DNEA 5DM0A 4WK0B 1HDGO 3DZIA 1ESEA 1JPNA 1K5PA 5IVIA 3QI7A 1XPJA 1J0AA 4QOHA 2FW6A 5CYFA 3ULKA 2EFJA 2ZBEA 3UAVA 1HSZA 2JFYA 1ZXBA 3F6CA 4U39A 1ORIA 5A71A 1MEEA 3RC8A 4HNTA 1IBLB 3INTA 1V1JA 1JR2A 4PVDA 3Q87B 2PX6A 4YMUA 1UEIA 2HD4A 1B1AA 2B82A 2DLDA 2IXFA 2LVAA 1EE1A 3QW4B 4DLVA 3V7NA 3BWMA 4DCCA 5FDFA 4P92A 1P6QA 1WPQA 3BL6A 3ONDA 3QYFA 4JBGA 1O6BA 3IG8A 2OHIA 2QYHA 1Y7LA 2VYND 2WE7A 3ZIAD 2O5CA 5LDHA 3PUZA 1EG2A 4UAUA 4MRMA 5G02A 4OXQA 3O90A 1T5TA 1FFSA 3L5OA 3F9RA 4PTLA 3OKPA 4X64M 1TO1E 3VPXA 2O07A 4HNRA 4NZPA 2IXTA 2J46A 1WDWB 1NXQA 4EJ0A 1MABA 3UJHA 1RNLA 3KB2A 1QHHA 2GHRA 3KVVA 2PSHA 4GMKA 4OG2A 1Y7HA 1W6RA 5EJ5A 2YZKA 3CO0S 3OQMA 3AYZB 3SLKA 2WG0A 4DCVA 2R85A 4R83A 3DMGA 4QTYA 1PYGA 3CTMA 3GD7A 2LPMA 4HGZA 1L5KA 2OPFA 1A9XB 4IIJA 1HE3A 3FNQA 5HQ3B 5KQGA 4MA5A 4ZEWA 2GEDA 4P98A 2WT8A 4UZSA 3TVDA 4AC9A 4L8WB 4LC1A 4IBCA 3A4YA 3FTNA 3RIMA 4FYXA 5KYUB 1DE0A 2WZCA 1PHRA 4MAMA 4BP1A 4CL0A 1UFRA 3HDHA 3IOMA 2QEQA 4N6GA 2XE6A 1YNOA 4EWLA 3RRJA 2OUIA 3ZXYA 3VNVA 3T12A 1RJWA 3KSZO 4RVHA 4YMIA 4FCWA 2J5YA 1J49A 4KN5A 1T6ZA 1GD1O 3DQPA 4X20B 4HWTA 1IXZA 2QJOA 1TM4E 1XJ5A 3FRHA 4CKZA 3OF2A 1QUSA 3SAUA 1TYBE 2IW1A 3CX7A 1M33A 1O6ZA 5CA0B 3NWLA 5B58T 4B87A 2FH0A 1JT2A 1CUIA 2VTVA 4LF7B 2BN4A 9MHTA 1DKMA 1MVLA 1XZDA 1B4DA 3QX8A 1PG5A 2W8BB 1CIVA 2CXPA 1EDBA 3G1TA 1SXPA 3QGMA 4WT7A 5IAJA 1GV1A 1KP3A 2K2WA 5DK4A 2PS9A 1NKVA 5L8RF 3AF3A 5G4KA 5F3RA 2JJ1D 4MP8A 2XYGA 3QELA 1ZI8A 1PWXA 2Y6UA 5DU2A 4ZIRB 3BGOS 2O8FA 5AFSA 2RGBA 4M4SA 1VCHA 3T1TA 3FDZA 1CVIA 5LP6C 2ZWPA 3QBDA 4N1AA 4MK4A 2J41A 4GLFA 2P3OA 1FXUA 2O2GA 3WAJA 1SG9A 2DKFA 5IM4F 4Y2SA 4UW9A 1BHO1 5LP6F 4B7AA 1Y48E 2VF4X 2CB9A 2X6RA 5A4MS 4KQ1A 3HUFA 4GXNA 3LUAA 2VDWA 3L8ZA 4KH0A 1PR5A 3N6VA 1YULA 4K9DA 4MW5A 4UNQA 3VZDA 2H1HA 5E4TA 2D7JA 5E38A 1NSYA 1JB9A 2C2MA 5JSYA 3DFMA 3AIKA 2OGSA 2R7AA 3NAMA 3FLBA 2R1ZA 1J07A 5A3QA 2C29D 4IF6A 4N12A 4G0NA 4GITA 4OX9Y 2YMQA 3KQTA 3QYBA 1JVNA 3DE2X 3EA5A 4Q7MB 3NDJA 1B73A 4ALIA 1SC4A 3C3AA 1QJCA 4ZJPA 4B0PA 1L7BA 1C30B 4OHXA 5F64A 2IYNA 4JI7B 4CLRA 2V7GA 5KDDA 4YAIA 4YREA 4PLWA 2V8OA 2ZSJA 3KFUG 1PGNA 1OREA 2OE2A 4OREX 2HK7A 4ZI7A 1N2CA 1GDDA 2G08A 3K1AA 2G63A 2WM8A 3W3AA 3D8TA 2R47A 3ZK9A 1WHSB 1VOTA 5EJ2A 1CFZA 5BT9A 3AEUA 3IKMB 2JBHA 1E6WA 1XXLA 2AJTA 1PCXA 2BI4A 4OQDA 1ZK4A 5BN4A 1Y6QA 3V4OA 2PH7A 2JBWA 2GHIA 2O3TA 1XEAA 1VEGA 3KAPA 4CE6A 3HJNA 3KRTA 4D9CA 4YRBA 1LY1A 3Q1LA 4UUQA 2OOBA 4A5OA 5KTOA 3EAFA 1OLSA 2BTQB 2Z9BA 1XQVA 3FKSD 3DO8A 1TK2A 5KYTA 3B51X 2V55B 3UJAA 5AW3A 3SBEA 4I9NA 2O8DB 2UUBM 2JATA 2C4TA 1L4FA 3QMPA 2VDOB 1J8YF 3AR6A 4BE4A 4C4TA 4MPDA 3N28A 3I39X 1JYEA 1ZMOA 3BKWA 4LJLA 5E9AA 4U2GA 1YTUA 2OP0A 2QPTA 2Y27A 3LYLA 5HSGA 1O97D 1M1NA 2ZYWX 4JI4M 5D5HA 4A6EA 2FWMX 4PZZA 3ERCA 3SF8A 4XZ3A 1HEIA 4IBIA 1ZW1A 1A27A 1BQ3A 4R5HA 1A50B 3L43A 5JCOA 1YFZA 1IPFA 3IAEA 3QEAZ 1G6Q1 1FDTA 3KJHA 3EIWA 3DTVD 2FPIA 2FMXA 3BMQB 2E85A 4QASA 4ZWNA 1D1PA 2RGOA 4DLBA 4HJRA 5DTMA 4GRIA 4UARA 4P54A 4RJKA 3VAYA 5CLFA 1RADA 3ZHBA 5J4HA 4OQ4A 3FB4A 2IY9A 1ADBA 1XLVA 4LZZA 4JCOA 4KI0A 4BC0A 5HQJA 1DDIA 5IT9S 4KE8A 2E87A 3BK1A 1FTSA 3S27A 4LIPD 2IEYA 4AJPA 1GG9A 4NJEA 2NQ2C 4YROA 1DLIA 3QBJA 4G1VA 4H0NA 3FCUB 4FGZA 2XNSA 5F35A 3AIMA 4NU0A 3UWSA 1ZVMA 3HB1A 5CX4A 1KBZA 1WDTA 1XVIA 5KSPA 4AZFA 4XR4A 5DIFA 2XVXA 4BWYA 1E9FA 1XCBA 4IRUB 1YRYE 2VN8A 4FGLA 4XGKA 4JVLA 2VIIA 3H6KA 5CX1B 4L72A 4YGXB 4DQXA 4OTZA 1S8AA 2ZBKB 4LZNA 2BIFA 5FBHA 2B69A 3RK1A 5AI4A 4G4GA 2RK4A 1MF7A 2IT1A 2Z1DA 2JLBA 4MR7B 3NC0C 1GT6A 1L4MA 4TWJA 4YO7A 1WBBA 4FE4A 2DJIA 3IELA 3R0IA 2AA3A 3AVQA 1X77A 1GL9B 3AM3A 3U5ZB 1KVRA 1P2DA 1A9OA 2EO2A 4IFEA 2ASEA 2VF8A 3HJTA 4BBPA 1D3AA 3NATA 2QLTA 4YRKA 2IYFA 3O95A 1A9RA 1XNQM 4O1MA 4IHKA 3DE4X 3AETB 3K9FC 3I58A 4MQFB 4J90A 3HRHA 4L2IA 4ZCPA 2F1RA 5AI9A 2NGRA 4OHVA 3HHXA 4EUSA 4ID9A 4EHLA 1W4RA 2QZZA 3EK2A 1EAMA 4QVGA 4PE5B 4RKWA 1TTHA 2C59A 1RZVA 1HYQA 3L84A 3N5CA 3BRSA 4Z4QA 2BGJA 5KMGB 2IE0A 1MGOA 4GE0A 4US2R 1MX9A 1ST3A 1CUEA 2NQTA 4MVJD 1OV4A 1U7PA 1NBMA 1IAVA 1QDLB 1KIAA 4FHFA 5ESRA 13PKA 3LS2A 1BJRE 1SR8A 4UPVA 1TQHA 1ES9A 4LY0A 1VHQA 4OJMX 2ZE6A 5B6IA 3WIEA 3DLPX 1TJPB 4AECA 2BFDA 2JRCA 1NSTA 3S8EA 1RAEA 3AIIA 4FCCA 1XRRA 2I1QA 5AJXA 1JJ7A 2BE9A 1EUDB 2QPAA 1ZN8A 5HIAA 5CMLA 3IE1A 2IV2X 2IKSA 1LPBB 5FTWA 1UK6A 2HHHB 6ABPA 1RU3A 2FZEA 1OH7A 1G2PA 4JJKA 1K97A 4HQLA 5AWFC 1NQUA 2IDZA 2K9DA 3G0BA 2ZS9A 3R75A 3U7HB 3S4YA 3TI7A 1Q3BA 2XOEA 2WUGA 4TXLA 2NO7A 3PQ2A 1A8UA 4EL0A 3NEYA 4NY1A 2B4TO 1R5JA 2A9OA 1MT0A 3SI7A 3I23A 3SS7X 3F47A 1PVOA 3LM8A 2V1UA 3D4OA 1E5VA 4LI3X 3MTIA 1D6NA 2WKWA 5GJBA 3TMKA 1EK6A 1XU9A 5DCUA 2MR9A 1DBVO 3O8OA 1ZNQO 1FTGA 2ZETA 4DLTA 3W67A 1ZISA 2GPNA 1LU9A 5F2EA 1J7JA 4BCDA 3MT0A 2OLKA 1VB5A 2EZ4A 1A9YA 1YQWA 2HL7A 4HAXA 3IQZA 4H59A 3TYXA 3TLMA 4WBXC 1P1BA 1SZDA 2Y93A 1BO6A 3K70D 4EYEA 1MN3A 1IVSA 4C4AA 5EQFA 4W5HA 1D0IA 5AM4A 5FTJA 4K1LA 4P81A 4M7WA 2VQEM 2J30A 1WVMA 1XTRA 1POWA 2O19A 2DSTA 3ZGYA 5CFPA 3EJWA 2D7EA 4OQYA 3LBIA 1M3SA 5HX7A 1BW9B 2NUBA 1AQUA 2DKNA 3DC7A 1YR9A 3F9CA 3QPAA 4G1CA 3ABOB 2F2TA 3O2SB 4QO7A 5IXSA 1KRWA 2F8TA 1TUEA 3J27B 2Y66A 3E5NA 1NIJA 2IF0A 3LFHA 3L2OB 1JTEA 3HLTA 4RVGA 3OOJA 1T10A 2WR8A 5FAXA 5AM5A 2YXLA 4QT4A 2ZRPA 4G4SO 3TZHA 2P68A 3OURA 2WJ3A 3ESRA 4TUYA 3JQPA 5HCUA 2FCRA 2XUGA 4DV1M 2V6MA 4MTLA 1P7PA 2J08A 3TBFA 3EPHA 1R50A 1TRKA 5A3VA 1I1OA 1D2GA 1P7ZA 2CXNA 1TNDA 2R8XA 3PFNA 5DVZA 2CVQA 5LWHA 3K0FA 4DSUA 3DLTA 1JIVA 3A46A 1NBAA 5KTSA 3GUVA 3KPVA 3V55A 3RSFA 1SOAA 2ZQZA 2I34A 3PRJA 4BMOB 1GYPA 1CY8A 3U7JA 3H5WA 2W2OA 1NVBA 1XNRM 4IDGA 5FCDA 3OCCA 2G77B 1TTTA 3VSEA 2G0AA 1W2GA 3N39C 1HT0A 4ONEA 1WX1A 3EYAA 5EIEA 2HV9A 3EEFA 4EW1A 2QE7D 3G7UA 4ZVTA 3OIUA 2AUTA 1WLYA 3T0IA 1D5WA 2X0DA 2YWDA 1PVVA 2GAJA 4CIAA 2C4KA 2Q28A 5HGXA 4YJFA 3WL4A 2LZ0A 1I1QB 1CHDA 4WBNB 4KXVA 4MB2A 1QAOA 2VWHA 4KLZA 4WFKA 4K6GA 2OC4A 3CFYA 1TMYA 2W70A 2G80A 3OI7A 3N8IA 1P4RA 3KZOA 3TG8A 3O4VA 4EI7A 3BG5A 1KH3A 3FAKA 2H9AA 1QIMA 4KO2S 1LNSA 5KYXA 3AUTA 1YK1A 4A6PA 3H5RA 2Z3ZA 3GJXC 1A7AA 1JI3A 3K0EA 2NV0A 2D2XA 2CNNA 2X2PA 5DKFA 4LCJA 3RGSA 4EJ6A 1VJ0A 1DKNA 5DJ5A 2H07A 1MENA 1MW8X 2XKJE 4XCXA 2ZPTX 4V0NA 1GGJA 2A7QA 3C5EA 4KLAA 1IULA 1XWWA 2Y3IA 3M49A 3PX2A 3HR8A 1VM6A 4PC6A 3KEOA 2JVKA 1JLHA 1QO0A 2O2EA 2I1VB 1Y4SA 1IK6A 3AKYA 4IHAA 1E3SA 1FA9A 3DEKA 4H2DA 1OPRA 1FQKA 1QJ4A 2FMIA 5AO9A 4XAQA 1IHXA 4HH4A 3ZLUA 1J9ZA 4B3CA 2XDAA 2ZIVB 1I7PA 1XVLA 2XHEA 4L5IA 4IUBS 4F85A 4UD6A 1CUYA 4JOCA 4CL3A 4LF6B 4BAZA 3P9XA 3AI2A 4I1SA 3AF2A 5B2FA 2XKKA 2P2ZA 2RAVA 2Q2NA 5AQEA 3AMVA 4B31A 3IJ5A 1RC8A 3O3NB 3TQOA 3INYA 5IJXA 1T13A 3PXDA 3K9PA 1HOTA 3T7RA 3RAGA 1ECCA 2JNHA 3E1SA 4BN0A 5H4GA 3HKEA 2QMYA 4WHMA 4A0RA 5JANA 1GRQA 2J6HA 5E7QA 2FZKA 3LTNC 1UZMA 5D6NA 3D64A 4PBTA 2I9KA 3TLXA 1EZ1A 5HJ5A 4DA9A 2PUDA 1G8HA 2CFOA 3LMMA 1T0PA 5CGQB 3H9UA 3CRNA 1ZP6A 3IS3A 1GNLA 4KAAA 3M9LA 5AW5A 5AKHA 3AI1A 4CFZA 1C3JA 2QDKA 4NBUA 4LRTB 2HCFA 3PKIA 4RV5A 3EDCA 1RHMA 1YRBA 3KUCA 2VF5X 5JU6A 4M0WA 4C6SA 2E4XA 2FPOA 3B1ZA 4CN9A 3EZ9A 2XDWA 2VDKB 4YCJA 5LZ5A 2E6UX 4J8PA 1DIAA 3DOFA 3GGJA 4BDSA 1EGAA 4ZAVA 1W49A 2YV2A 3QE0A 5TS2A 1GGEA 3D0OA 1HQDA 1T6YA 3BL8A 4JEHA 2LWXA 1U5BB 2J09A 3HB9A 4D3SA 1SCJA 3SDSA 1IY8A 4ZRDA 2FN3A 1Z68A 3TUZC 3KB8A 4QODA 3QFSA 3QA3E 4JFRA 4MYRA 5AOAA 3PRKE 4P4SA 3R6GA 4O4JB 1QF7A 1QQTA 5C4IA 3GLGB 5K6AA 4BJ3A 1X92A 1WNTA 1HEUA 2C4WA 2YVAA 5IS2A 4JI0M 3HI4A 1ZD5A 3Q1KA 4V0MA 1Q0RA 2VNKA 4N8DA 2J48A 1EJ2A 1SAYA 2NMVA 2W98A 3BSFA 2WD9A 1SQ6A 2Q8PA 4PO8A 3BFKA 3ELBA 4EL5A 1YU6A 3GBVA 4R7TA 2WTBA 3BGDA 1JSZA 3Q8XA 1P4GA 4K40A 2J7KA 2DHQA 4QTZA 5IC5A 3X2EA 2IPAB 4GX1A 2ZI9A 2D1YA 4HN2A 2ERXA 3BOSA 5BPFA 3HZJA 3HVUA 4CKCB 4N0PA 1H4QA 2GEBA 4RESA 1NW7A 1DWPA 3W9BA 4UU0A 3SIRA 4EMSA 2G9QA 5IDXA 2GEKA 4JBHA 3ICOA 4ZVUA 2BGGA 4LFBM 3DM5A 1FJHA 5BYAA 1VL2A 3QV2A 5DNYA 4B3HA 4HG2A 4EATA 4EG5A 2W48A 5ITRA 4OU7A 5C53B 3OLZA 3JQ7A 2D2FA 2LVOC 3AINA 3CX6A 4V39A 2Q2EB 2W4QA 4WBNF 5D3QA 3F7NA 2J6BA 3PUJA 1IM2A 4OHZA 2FZLA 3U44B 3L0DA 1UDWA 4U9IS 1DIBA 3LX8A 2VPIA 5AJTA 3EVTA 4CQLA 2OCGA 3DP7A 3QKSB 2GJKA 2EFDB 3R5FA 3STVA 4L4RA 3O74A 3ZHVA 2EIHA 1NJSA 4EYOA 1THMA 4GVLA 4PBSA 1S0UA 1WB5A 3BAZA 3KQWA 4K87A 3UV7A 2QLMA 3PVCA 3CLSC 1V3QE 2OV6A 4KFTA 3DAOA 3S3TA 3C97A 2Q5OA 5D01A 1XYVA 2Z4SA 3MJDA 1Q3KA 4MH0R 5FWNA 1A9QA 4FWDA 2LBPA 1ZIOA 3RYCA 1BXRB 1KS9A 3OQ1A 1FRQA 4X6XA 3WFIA 1U0TA 3L9WA 4KBGA 2QT9A 3T5DA 3HA5A 1CVLA 4A27A 2EZ9A 3K0KA 3QVGB 2AXNA 1G42A 5CK5A 2C2BA 1QONA 2ZI4A 3D6NB 4X7MA 1VKNA 3BYZA 1TT5B 3IFSA 5BVGB 1ZH4A 2I3BA 2QRKA 3FDFA 2C9DA 3PHBE 3GUUA 5A3JA 2YRXA 4HRAA 5H80A 5IDQA 2ZUWA 3A1DA 1X7DA 4MI3A 2VLIA 4OD0A 4C7XA 2OO5C 2RFLA 1P9WA 3SHTA 2VP2A 3V8PA 4W9MC 2K7FA 3L82B 3TLJA 1NHWC 4GSYA 4FSXA 5IJ9A 1GT91 1HE1C 4J9VA 3CVUA 4B48A 3GU3A 5EWMB 3N5KA 4B2IA 4XPZA 3WYBA 1BXZA 1MAVA 1DGBA 2C20A 2C7VA 3B70A 1P1FA 2YY6A 5FUQA 2JCSA 3JVVA 3UJCA 2L19A 1F8XA 3LUDA 4CWAA 1MAAA 1AF4A 4HUQB 1DLJA 4RFSA 4E21A 1BGWA 4KGDA 4LDQA 2H52A 2C7RA 1P45A 2HA7A 1DAGA 1MPXA 4WESB 1JTFA 3KFVA 1LDNA 4RNDB 3MUFA 1RE0A 4TVOA 1XDZA 3H5TA 3RGGA 3SZLA 3HCDA 2FJPA 5LXTF 2YNMD 1V2GA 5J3JA 3UMSA 3PDJA 1M10A 1MJGA 2PXHA 2ZAMA 4HQ0A 1N2CE 4HR7A 4TRMA 2DAEA 2G9RA 1JW9B 1QBKC 4MMZB 4HEA1 2ZPAA 4OB8A 1OWPA 4V0SA 1JVBA 2JEYA 2X41A 1ZUNA 4RULA 3L0YA 2Y0QA 2KI5A 4ZOBA 1S4QA 1DAOA 2V1XA 4C7MA 1DOZA 1QM5A 1KARA 1ZZGA 2P9EA 2XDYA 4GF5A 3H6GA 1RKUA 4KR3A 1X1QA 3NOVA 1XV5A 4O4JF 3LUPA 3ZWPA 1FW8A 2FAXA 4KUGA 5ILQA 1XC8A 4TMTA 4LY6A 1G3UA 5LA6B 1NMZA 1PZEA 4RVDA 4YUXA 3O2JA 1XRQA 5PNTA 2QU8A 3LQKA 4B9EA 4YUVA 1RXCA 4LRSB 3NHJA 4HT3B 4KN8A 1JAXA 4DREA 3DTVB 3R7SA 1E1RD 2K5UA 5HF6A 2I65A 1A69A 4LDAA 4XQGA 1M6VA 3R7FA 4ZYYA 4CR8A 1G7TA 2QTWB 1OLXB 4OH1A 2ZEJA 4MITA 1ZNXA 1T2UA 2Q7OE 3UXEA 1JEQB 2WF9A 5LQAA 4AN0A 3GLRA 4HRXA 2ZR7A 3AVTA 4FYJA 2H8KA 1PF7E 3RGWS 3EIFA 3EW7A 2WINI 4RADA 1E64A 4NECA 2R00C 2DLNA 1V8OA 1A4XA 2CL6X 2VQSA 4XD7A 2D0DA 4PYNA 3LZCA 1O94D 3OJ0A 4RHCA 3X1DA 2B2XA 3PEVA 4JY7A 3V32A 1O03A 4XARA 5A9SA 3R9XB 4XYEA 3UKOA 1E8MA 3EDOA 2BWJA 4PPGA 3IOBA 2IU3A 2IHYA 5BN5A 3WA7A 4GM0A 3QIAA 1OILA 3R4CA 5CLGA 1HFJA 4RA9A 2GZAA 3QH4A 2C3MA 3UT0A 4REOA 4KRFA 1FPMA 1X74A 3G13A 4EW3A 4KIFA 1PW7A 4V1CI 5BV0A 4QM6A 1UOOA 4RKQA 1T9ZA 1T1EA 5FL7D 4Y0AA 4N47A 1NVMA 5IVPA 1AE1A 5GONB 4PPQA 2DKLA 3GH3A 2VSNA 3IPAA 1Y89A 5CYPA 3FNEA 2WWIA 3NBUA 3OTWA 2O05A 1OBVA 3M83A 2JJ8A 1TE2A 3CPHA 4IRXA 4JQCA 4LOHA 1UBTS 3PF9A 2ZYUX 3L7IA 1EVJA 1BKDR 1T8WA 2EQBA 3SDZA 3O8QB 1RPNA 1L1FA 3DMPA 3SYTA 1G5FA 4K05A 3A6KA 2G8LA 4E5PA 3QVKA 4B8YA 4XLZA 2ID8A 4JUCA 2WYHA 5CCBA 1TADA 3BH7A 2ILVA 1DXOA 1MTZA 3KCNA 1T8SA 4EARA 4KREA 2QAGA 1QK4A 1YJAA 2CJYA 1QMGA 4H7FA 3H4VA 3VYWA 1T6XA 3GFRA 4IIVA 1EAYA 4R2WA 1QAQA 2FSHA 3P96A 1NG9A 5EXSA 1SGWA 2GCOB 2ZI6A 4XCVA 2JJ2A 4DFDA 3P0HA 2Y1EA 3SEFA 1IUPA 3HKCA 2I4MA 1C1DA 2GVZC 5BW6B 1XEFA 4J75A 3B3QA 1B6SA 2YVUA 1IN8A 3MTJA 5A4AA 4A6DA 2YTZA 4DC9A 1YQUA 2G5PA 4YRQA 3V7YA 1U1IA 2R5NA 5IYZA 2FW1A 3RNOA 3WVNA 3W78A 3OQIA 4X91A 3GK3A 1T4GA 1FJGB 1W59A 1WR8A 4ZANA 3ZNPA 4TQ9A 2YZGA 2J87A 4BP3A 1YFLA 2GCIA 1GNRA 3CMCO 4HX5A 3E9EA 3F2IA 2CL0X 2YZMA 2TMYA 3G0IA 1RYMA 4RELA 4LAFA 4J43A 3RARA 2QD4A 1OD6A 4FTWA 2W2VA 3IP6A 2JI6A 2P2NA 4H1TA 3H16A 1ZINA 2CLFB 2L0XA 1RQNA 1V5WA 3IJRA 3P1JA 1DC7A 3IDOA 3ABZA 1VE3A 1MOQA 2OLEA 2ET6A 1KFBB 5C1IA 4LECA 2FX3A 5LDGA 2P7IA 3SJAA 3O3CA 3FHLA 2CK3D 4CGYA 1XVTA 2I7VA 1E6MA 5MFPA 3T7CA 1YACA 3Q12A 1Y1RA 1Q0SA 3EZXA 4MW4A 1P81A 1O97C 1TW3A 1HY3A 1SK9A 1RMQA 4Q1CA 2P6PA 4F2PA 1GKYA 1NY6A 2LH0A 1ND5A 1A7UA 4KOEC 2ZYIA 2O59A 1TVCA 5LKRA 4FEAA 2PIDA 3GLFB 1OT5A 3K70B 3ITKA 4KMSA 2EZ8A 3KSBC 1VDDA 1T1RA 4PX5A 1NAIA 2HFKA 1WNFA 4ZHSA 4DIKA 1SQ5A 5JHGB 4UUBA 5ALKA 2PN1A 4MULA 3C6XA 1XWFA 3KAJA 4IUCS 4G4OA 2GD0A 1QG2A 1P7VA 2VPYA 3QE2A 3QPCA 1TPYA 4FC7A 3L77A 4DR7M 2P79A 2WTXA 3MMZA 3RKSA 3ZBQA 1QYDA 3M6MD 4WCDA 4JNCA 2OENG 1UBMS 3QYJA 1C3XA 2P2DA 3L1KA 1AZTA 4O8CA 4DV6B 5AJHA 2WJ6A 1GTZA 2V0GA 4HCJA 3TAUA 1M5RA 1E9SA 4FMCB 5DOVA 3BWVA 3FPSA 1R4NB 1H1DA 1NNI1 1EU1A 4TRJA 5BRNA 2AG1A 2J5RA 5H4HA 3KOXA 4OFWA 5GQSA 4XVCA 1P0PA 2FN7A 1SKAA 3MTBA 4CM4A 4H4DA 2XECA 3ZY6A 5EYPA 1UXJA 3ZNOA 3F9IA 2O2SA 1IBMM 5J59A 5HVNA 4QUGA 1JHYA 1UFKA 4CHTA 1NHGC 3LT1A 1QP0A 4AZ3B 1R9GA 2RGEA 1M6EX 4NX2A 1X80A 4MS4B 5U9CA 4ZCLA 3W8DA 3ZVRA 5GONF 2Q50A 1XELA 5FSWA 1JSXA 3QU7A 3ZNNA 4DWJA 4YDHB 3ZI7A 2H48A 2Q3DA 1T8YA 4PIVA 3FYCA 5I8ZA 3L7NA 2W2LD 2WZBA 3QXJA 1Y1QA 5L3QB 4CBVA 3BEDA 1D04A 3TTYA 2BKLA 4OLFA 3CXUA 1AKWA 1P5RA 3HVHA 4NYIR 3URKA 1J0CA 4PT5A 1EFVA 1SIOA 4GEWA 3WV5A 2XOXA 4L0DA 2UVPB 2DCMA 3H2HA 3ORHA 4KXLA 1R5OA 2BMAA 1MBZA 1VIMA 1OE0A 4J1QA 3JR4A 4KBYA 2B34A 2E37A 2QVBA 3U4QB 1QYVA 1E3TA 3LDHA 1GN8A 5BPVA 3NWJA 4YNBA 2NZ8A 3MCAA 4MVJF 2X0JA 1FX0B 1LDEA 1WXDA 1YZHA 3ETDA 1OZFA 4OSPA 4B8ZA 3C87A 2LE0A 2V6ZM 1N36M 4JX9A 1REQB 2AE2A 1WUTA 2JW5A 5DISB 5EE0A 1JHAA 1G5QA 3ONVA 4RCYA 1B43A 3OO1A 4UBIA 2C95A 5FRDA 4A2WA 1P44A 3D7LA 4F3NA 2JXNA 4D97A 1U3WA 5KU7A 2QTHA 1SVOA 1UC8A 1D0MA 3LQQA 2WKSA 2YN2A 1VE1A 3STTA 1L3BA 3ZV7A 2ODAA 4CIZA 1Z6YA 1H9BA 4OJYA 4RF0A 3OA2A 1WHCA 1MRZA 2W0MA 1LDMA 2OYRA 3X2SA 4L73A 1ACLA 4MWEA 3JATB 4D5GA 1ZL0A