The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
93
|
sequence length |
301
|
structure length |
281
|
Chain Sequence |
ALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTLQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Improved Structures of Full-Length p97, an AAA ATPase: Implications for Mechanisms of Nucleotide-Dependent Conformational Change.
pubmed doi rcsb |
molecule tags |
Transport protein
|
source organism |
Mus musculus
|
molecule keywords |
Transitional endoplasmic reticulum ATPase
|
total genus |
93
|
structure length |
281
|
sequence length |
301
|
chains with identical sequence |
B, C, D, E, F, G, H, I, J, K, L, M, N
|
ec nomenclature |
ec
3.6.4.6: Vesicle-fusing ATPase. |
pdb deposition date | 2008-03-01 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00004 | AAA | ATPase family associated with various cellular activities (AAA) |
A | PF09336 | Vps4_C | Vps4 C terminal oligomerisation domain |
A | PF17862 | AAA_lid_3 | AAA+ lid domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Helicase, Ruva Protein; domain 3 | Helicase, Ruva Protein; domain 3 | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | P-loop containing nucleotide triphosphate hydrolases |