3CF0A

Structure of d2 subdomain of p97/vcp in complex with adp
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
301
structure length
281
Chain Sequence
ALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transitional endoplasmic reticulum ATPase
publication title Improved Structures of Full-Length p97, an AAA ATPase: Implications for Mechanisms of Nucleotide-Dependent Conformational Change.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 93
structure length 281
sequence length 301
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2008-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
A PF09336 Vps4_C Vps4 C terminal oligomerisation domain
A PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3cf0A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3cf0A01
4LHWA 5BN4A 2DWPA 2WBLC 4ZDWA 4DT1A 1S96A 3KW6A 4A36A 2JJ2A 5FOXA 3B1XA 1Z6GA 3X1WA 4ZDJA 3K70B 1GILA 1NVXQ 2H7VA 2HYDA 5C46F 4Q4AB 3LVQE 4LRWA 1XEWX 1ZNYA 3IHWA 1M7HA 3PUWA 3NVAA 3BFVA 2DZNB 1D2EA 1KO1A 2IYSA 4Q18A 4A0FA 2IXFA 2ZRGA 5JECA 2FPLA 2DFLA 1NJGA 2J45A 1W1WA 3K0CC 3AF1A 3G82C 1EX6A 3K0FA 4KYIB 2CJWA 2ZETA 1QVRA 1YZUA 2FOLA 1ESNA 2OESA 2DB3A 1PVOA 2A5FA 5DI3A 2FV8A 2G1JA 1XEXA 3GCGA 3PCRB 1FUUA 4URUR 4CEJB 1Z0FA 3EA5A 1KK2A 1WDTA 4U5XA 4BECA 2WMNB 1E9DA 3GLFA 1IBRA 2ZJ8A 4FWIB 4HDOB 2RGEA 2CHGA 2BMDA 3KQKA 1ODFA 4D81A 3U3JA 3SU8A 1TAGA 2Q6TA 4RFVA 2HDNB 4PHFA 1ZNXA 3KJGA 3N2EA 4US0R 1TU4A 5BWMA 3OIYA 5GJCA 4F4JA 1ZM4A 3VNUA 2D7CA 1K6MA 1W0JD 1XZQA 4Q7LA 4BFZA 1LF5A 1M7GA 1D5CA 4JL5A 3A1WA 2A2ZA 2IYWA 1T0JB 3QKTA 5KOYA 3K0AA 3U7GA 3ECCA 4L9WA 4M9QA 4TYWA 5JHHB 2QM7A 5GJBA 1KMQA 4FCWA 1P4SA 4EAQA 4Q19A 3P27A 1E9FA 2WSSD 1YR9A 1P9RA 4IEEA 3T1VA 4HB2A 4V02A 4AYWA 1DOAA 1N6RA 3H0KA 4IDHA 2UKDA 2ODEA 4MUAA 1W48A 3M1IA 2ZSDA 2JLYA 3W6NA 2GILA 2ORWA 4PC6A 4Q21A 3GQBA 1GUAA 4B33A 1VDZA 4JYCA 3K9GA 1BIFA 1EFTA 2BIFA 3T35A 3AP3A 3PQCA 3EZ9A 2OM2A 1CJMA 1CS4C 721PA 1XJQA 1PLLA 3L0PA 5CB6A 5A4JA 3H86A 2G88A 4K46A 3RS4A 5FPKA 4PR0A 4QFMA 4RD3A 5CDFA 3BRWD 4BRUA 2FX3A 5JEDA 3BGWA 4JS0A 1D2NA 3MWLA 4OI4A 3IIJA 4JLVA 4YONB 4H1VA 2O0HA 4V03A 5F2EA 3VX3A 1G3RA 4OHWA 2ZU0C 3K70D 5FPHA 1TEVA 2F6RA 4TLDA 3DKPA 1W46A 3C15C 3PITA 2IWRA 2DPXA 4URXR 4E07A 1FP7A 1E1QA 3MG9A 3QF4B 1FNMA 3PUXA 2J0VA 5AJXA 5FOWA 1GL6A 3SJCA 4C2TA 1QHGA 2H18A 2SHKA 1S0UA 4TL9A 1H8HA 1UDXA 3TMKA 4M1KA 1N0VC 2BKUA 5J4LA 1JI0A 1W36B 4ACAA 4II7A 3CNOA 2Z43A 3F0TA 3WYAA 3SR0A 1WBDA 2AN9A 2CLSA 3BBPA 2ZRIA 2VP0A 1HURA 1X8JA 1ZNZA 4H9GA 4ZCLA 1JR3E 3FHCB 3ADDA 3IIMA 1AIPA 3I72A 4KVGA 4D0GA 4DEYA 2XSZD 2Z4RA 3KJHA 1P60A 4DUGA 5KHOC 2KB0A 2JDID 4FXPA 2ZAOA 1NKSA 1N0WA 1OHHA 1MABB 3PJRA 3J81k 1JEEA 4LY6A 1CR1A 3EAQA 2OLKA 4QXAA 1T8TA 4BFUA 3K09C 1E9SA 4TQ9A 4URVR 1PUIA 3K9HA 1GTVA 4B3FX 5FTNA 4WXPA 3U5ZB 3X1ZA 1COWA 4B3CA 5FOSA 5FPTA 3UANA 2WKPA 4D25A 3JZMA 3ND9A 2REBA 2W6IA 3CM0A 3CRMA 4B2LA 3AM1A 2ZRLA 3BC1A 3CBQA 2ZRAA 1DE0A 1PLKA 5HR5A 2ONKA 2QNRA 1KJWA 2J1LA 3LFUA 4PSVA 4R7ZA 4PFSA 4DRZA 3REGA 1S2MA 2VHUA 2ZANA 5BXQC 1GZSA 3MWYW 4IVQA 4C9BA 1SGWA 1ZCBA 3KJIA 3L8YA 2O52A 5HCNA 4IHQA 2RAPA 4DLYA 2CVHA 4OK6A 3AKCA 3W6PA 3NEJA 1GM5A 4HZUB 3DDCA 3IO5A 2YNMA 3QI2A 4FI3C 1P72A 2F1HA 4YMUA 1IY1A 1K5GA 2Z5FA 5C4MA 2GTPA 1XJCA 3FFAA 5GJVC 5EXXA 1HQYE 4NHOA 1AA9A 4M1TA 4D0LB 2W2XA 1G291 3R9IA 4B73A 3EZ2A 1W47A 2O8CA 2CK3A 3SI7A 1EGAA 4IXMA 1RJ9B 4KFUA 4EQ6A 1JB1A 1XNJA 1H8EA 3O47A 2RGBA 4LHYA 4KV9A 3RSLA 3EX7C 1IN4A 1KAOA 1SHKA 2FGJA 3KUDA 4OQNA 1IY0A 3WNDA 3GEIA 5DO9A 2AKAB 4RFSB 3ZH9B 4V0ME 5BW8A 1GRQA 1OXXK 1T3SA 5J5CA 1F60A 5LD2B 5EXTA 2R65A 2FN4A 4JN6A 2NTYC 5G40A 3RLFA 2B8TA 2PEZA 1VG0B 1U9IC 4HYYA 3QENA 2QMUA 3WYFA 2ZM5A 5KYKA 3W8NA 1N6OA 1GG2A 2BVNA 4CT5A 1NN1A 2AL7A 3LBNA 4D4KA 3O8BA 3LV8A 3OE7A 3C41J 1F2TA 1Q1ZA 2H5EA 3M6AA 3AUYA 1KIMA 1E6CA 1W2HA 1GL9B 1SXJB 2NO1A 4ZIRB 5K8TA 1W36D 3ICQB 1L2TA 1KI4A 3UG6A 1VYUA 1Z08A 5P21A 2AWOA 4UQOA 2AK2A 5J4KA 1JXMA 1K8RA 3EZ6A 4P4SB 4GITA 4Q1FA 4C2UA 4XD7A 2OAQ1 3PXGA 3TJZA 2YOFA 4D6PA 5UKDA 2XITA 2W83A 4TMTA 2C9CA 1KSJA 1OKKD 3DOEA 3FKQA 1KO7A 4DLXA 3GJ8A 1KI2A 1ZP6A 1AGPA 2QAGA 1VTKA 5DIFA 3ZVRA 2QENA 3VR3A 5EP1A 3MUFA 3HU3A 2IYTA 3A6PC 1DARA 4B44A 1GKYA 1N5KA 1RYFA 1DBSA 2GCOB 1MRSA 4U7DA 3IEUA 3IGFA 1DAIA 2BBTA 1MV5A 2WJGA 1JQLB 4QG7A 1G7TA 4MGIR 4F92B 1G3QA 2AR7A 1IJEA 4LI0A 2ZVPX 5B64A 4PAMA 4EDHA 2YVUA 4JJKA 1EX7A 1N5JA 4KXFB 4M1OA 3QBVA 4BPBA 2LWIA 1Q20A 3P1JA 1ZM2A 4NPHA 3TLXA 3DZDA 4C7OB 4DCVA 4F4CA 3RS3A 2ZS9A 2H57A 2RGNA 3HPQA 1G9XA 1XMSA 2A3RA 4OYHA 4DCSA 4RD4A 4CF7A 2XXAA 2AXNA 5FFMA 2QE7A 4I1OA 2QZ4A 4ZKEA 1DG3A 4G5QA 2DFNA 4LHXA 1KI1A 1OFTA 1Q1EA 1L8QA 3WRYC 2JJ1A 2FDCA 2WHXA 3BD9A 3JZAA 3QKRB 3RHFA 1NY6A 4FCTA 3MWJA 3A1UA 5E7MA 2IS4A 4OBEA 3FKSA 1D9ZA 4EIWA 2OE2A 4MRVA 3QNUA 2ZUBA 2XJ9A 3HWSA 4PAOA 1CKEA 2OCPA 2CCGA 2F43B 5AUNB 1P2SA 3SHFA 3QPUA 1UBEA 3OAAA 2F3TA 4YMVA 2QPTA 3B5JA 3KX2A 4Z8YA 2V7QD 4NU0A 1ZMXA 5FTKA 2OO7A 4TT3A 3PVSA 1SXJD 1E2EA 1QRAA 1UEJA 2YV5A 5CYOA 2V8OA 4GOJA 3HR7A 2R6DA 4JBYA 3SYNA 3K0SA 4XWAA 4Y0VA 2NZ8A 3A37A 1DAKA 1ETUA 2QMEA 4PQYA 1VHLA 4WBSA 4BE7B 3GD7A 4X8HA 4ZO4A 4DJTA 3GLIB 2O8EB 3DKVA 5TY0A 4C3ZA 2VSFA 1KKMA 3BE4A 4UXJA 1Z0KA 4PTLA 3THYB 5JHGB 1JALA 5D3MA 3UPUA 2NMVA 2OXRA 4ILEA 4RD0A 5FTJA 4PC1A 4S2EA 1RRCA 4DIEA 3D6TB 4KI0A 1SXJE 4KFTA 4UKDA 4JIMA 3TH5A 2I3BA 4RD1A 4CVNA 1GDDA 5CK5A 1JPNA 3OF5A 3MGCA 2EU8A 5FTLA 2MSCB 2QAJA 2C96A 4BWYA 5DN6D 2OUKA 3QG5A 4AKEA 2ZRNA 5LD2C 2J9RA 4Q4HA 1P2UA 1QHHA 1M7BA 1E9BA 3W3ZB 2WJHA 3CF0A 2FG5A 2YWHA 4LV6A 2I1QA 1EFRA 2CCJA 5FPSA 2FFBA 4EJSC 4B6FA 3V4RA 2ZU6A 3K8YA 1I2MA 2B92A 4YDSA 1DVRA 1VG1A 2ZUDA 2G3YA 1T8UA 4B3BA 1NRJB 1JR6A 4DLUA 2J0UA 1MOZA 1KI9A 2F9MA 2CLCX 4C0HA 1E2KA 1G1MA 3NH6A 1XCPA 4F7WA 5C4GB 1KDRA 4ZV4A 1Z5ZA 1Z0AA 1E2MA 3ASZA 2CLDX 2KWIA 2NO6A 2WV9A 3PEVA 3A8TA 1XX6A 1S9HA 2GXSA 4CW7A 1Q22A 1NMXA 2V4ZA 5KUTA 3KQUA 1VCOA 1IN7A 2V6JA 4GP7A 3RABA 5E3HA 2ZI3A 1B23P 4MGKR 4XTCS 1NN0A 3NBZC 1G7RA 4UJ5A 1ZU4A 1WMSA 3NC0C 2IUTA 2GZAA 3ZS9A 4O0MA 1AS0A 2FSHA 4BEJA 3ZVNA 1OH8A 3DHWC 4FMCF 2C95A 3LAWA 1LF0A 2WAYA 2R6AA 4W5WA 2ANCA 1ZD8A 4KYUA 3CWQA 2D06A 2ZYTX 4G3XA 5JLJA 2BEKA 1JBKA 3VR4A 4DSNA 1FX0B 1KK3A 3I8SA 2A78A 2B7CA 2JLRA 4B2PA 1AM4D 4HZIA 1HT1E 1OH5A 5G53C 2ZYVX 3I3SR 4Q4JB 5EUQB 1H65A 3BIFA 3T12A 5L3QB 2O8FA 4CEHA 4MKIA 1XD8A 2BC9A 2WPDA 3THWA 4LDJA 1D6JA 4IKEA 1ZC3A 2YWFA 2CHVA 2C03A 5K8LA 1Z28A 2CDNA 1NMZA 2VSXA 3RC3A 1Q1QA 2NPIA 1FZQA 5GVRA 1P3JA 1VCNA 3Q7PA 1D8TA 2QN6A 2WKRA 4JLJA 1BOFA 2AFHE 2X1VA 3CH5A 3VMFA 4D4JA 5HZHA 2IHYA 4TMKA 5CIWA 1LFDB 3KB1A 4TSFA 4HI0E 2WICA 4DDUA 3CRRA 1XMIA 4PO9A 3BFKA 3CZQA 4HAWA 4CZ2A 1DAFA 1U0JA 2JLQA 3RWMB 3U4QA 1E9EA 3RVBA 3X2SA 4IW3B 4I4LA 1ZUIA 5DLQC 3TSZA 4Q9KA 2JGNA 3TK1A 2OHFA 3ZIAA 4LRSA 2IS1A 4BQSA 5F3WB 5JZVA 3GLGB 1HEIA 1R4AA 1U98A 4NKRA 1RPZA 3VR5A 3LW7A 1US8A 2KSQA 4HB4A 3FFBA 4XJXA 2BDTA 1OFHA 1XTRA 1GOTA 3EWSA 3RANA 2VP2A 3ZJYA 4PO8A 1N3BA 1NSFA 1W4BA 1ZUHA 3MD0A 2QPAA 1WQ1R 2WJJA 1GL7A 1DO0A 3D3QA 1YZTA 1O87A 1QF9A 3LO5A 3Q8XB 4AYXA 1E9RA 4M21A 5LPNA 5FR2A 1OH7A 4JMPA 2LKCA 2YOGA 5DH9A 4FCVA 1IONA 1G5TA 1KO4A 1XTIA 3CX6A 2Z83A 3L0SA 3TAHA 2JLVA 4AKHA 5B30A 5CK4A 2A5DA 3IDQA 2D2FA 4PPQA 5J4HA 4IDOA 4DLWA 2ZSEA 1E1RD 1R2QA 4FINA 2R44A 4ASUD 5BN3A 1FUKA 3LRPA 3QG1A 4JLBA 3SJZA 4JLAA 2NOAA 3T15A 2GF9A 5K8UA 4GL2A 4MRRA 4AI6A 1NIPA 1SVMA 2LKDA 4OQFA 4B35A 1S3SA 1UKZA 2FWRA 3NG1A 4DDVA 2JEOA 2E9SA 5FL7D 3ZYCA 3QVUA 2IYYA 3ZZUA 1Y3AA 2ZI6A 1KYIA 5JFGA 4B3XA 4EPWA 1HUQA 1JAHA 4A8JA 1Q3HA 3SHWA 2GZDA 3R20A 3RS0A 1KZ7B 2JLUA 3TUIC 5A0FA 4Z1MA 4A3VB 5JWOA 1YQTA 1MO3A 3W5JA 1BYUA 1AQUA 1KTVA 4CDGA 3V9PA 1LS1A 2E1RA 1KDOA 1N0UA 4KFSA 4URYR 2QA5A 4BFSA 1SVLA 2H92A 5HE8A 2OFOA 4MKHA 1BO6A 2ERXA 2UZIR 4DLVA 3OEHD 3LXXA 3BB4A 3UATA 4HAYA 1EFCA 1AGRA 2OLJA 3TQCA 2PCLA 2TMKA 3GJ4A 1EG7A 1F6BA 1YRBA 2YC4C 3U44B 3LX8A 2XZPA 2JATA 4CIDA 1UBGA 2GESA 2PCJA 5IDVA 2JLXA 4P32A 1NSTA 5FUYA 3UWKA 2CNWA 2FFHA 5JEEA 1Z07A 3I92A 3ZVMA 2RMKA 1E2PA 5J4VA 3L0OA 5KTYA 1UPTA 3A4NA 3KTAB 4MYUA 4LYAA 3WNBA 2DHRA 2HXYA 2ZVQX 1IOZA 1RE0A 1SKYB 3FMFA 1UKYA 2EFCB 4ZDIA 2PZGA 2HUPA 2DFTA 3OESA 3KQHA 3I8XA 2IYXA 2RH5A 4AIIA 1CJUC 1N5IA 1IAQA 1A4RA 4PANA 1NVVR 1MO4A 2AXPA 5DGXA 2VP5A 3GLGE 4Q7KA 4TLCA 5JSZA 4B43A 4C30A 2V3CC 4DSUA 2VO1A 1JJVA 2VHQA 2QU8A 1EWQA 5FOTA 1Z8FA 2GRJA 3GMTA 1R0WA 4P31A 2W00A 1RFLA 1PJRA 3A4MA 3BXZA 3CR8A 2HCBA 2DR3A 4G5SA 3E5HA 4YXWD 4HUQB 3PEYA 2JASA 1SVOA 1IXZA 5HKKA 4TYYA 5KSOA 4QKQA 2ASEA 3B82A 3W8RA 2QTVB 3QPVA 3RSOA 3GEHA 4HDCA 4A2QA 5EZ6B 1VMAA 3AV0B 1XMVA 1TF2A 4G5RA 4HLUA 1XF9A 2XX3A 5AJZA 4JLOA 1V5WA 1G64A 1V43A 2O8BA 2VP9A 3BS4A 3DOFA 4M9SA 1YZGA 4XH9B 1MO6A 2FFQA 3KXLA 3ZQJA 3PEWA 1R8QA 3DZ8A 1G21E 4IFBA 1YHNA 1E2GA 1IXSB 3LVRE 3NEYA 4JBXA 3U3OA 1ZRHA 3U2QA 2WIAA 4BUJA 5EE1A 2GBLA 2ZJYA 2O8CB 2BWJA 3AUXA 1WB9A 4Q03A 4MH0R 4XTRA 4GSYA 4MDEA 2Q9AA 3IQXA 1E0AA 1LTQA 1T3LA 4WAUA 4AKGA 3BH7A 3FHOA 4IXNA 3X1YA 1NBMD 1GRRA 1W0KD 2W6JA 3L2OB 3S1AA 3KZ1E 2R8RA 3CONA 3QBTA 2RGCA 1O3YA 1R0ZA 5DHAA 1QG2A 1Z0JA 4Q9IA 4FWHA 5L3RA 3OZXA 1FP6A 1FW6A 2VIIA 2R6FA 3LQQA 4RY2A 5DYIA 4LJ4A 1E2DA 2CL6X 2IBMA 2GCPA 4YDHB 2CEAA 3RC8A 1NBME 3I5XA 2XGJA 4ZI2A 4MUBA 5J47A 3SS8A 4JLPA 5HCIA 2ZI5A 2WWFA 1TU3A 1EFHA 4XWKA 6Q21A 4PPGA 3HDTA 1RIFA 2F7SA 3PR1A 3CUEF 1DPFA 2P3SA 2PJZA 1U8ZA 3OIWA 5EP4A 1PUJA 1ZM7A 4KFRA 2FEOA 1P61B 4BFVA 3AGPA 4WZAE 3K9LA 4Q47A 1CULC 1JPJA 5EUMA 3KFXA 5FPYA 4BLQA 3B7GA 3EA0A 1SKYE 2P0EA 1E96A 2BCJQ 4C4PA 5JCPA 4TL7A 1TF7A 4BLSA 1G6OA 1N6IA 3SJAA 5HPYB 4Q4LA 2ATVA 3DL0A 1JR3D 1OSNA 5FBRB 5EJEA 3LX5A 5KSYA 2ORIA 4A6XA 2P6RA 3IBGA 5D3QA 1PZNA 2OAP1 1ZD9A 2FSIA 4PC7A 2IEYA 1KSHA 3GFOA 1MKYA 2JCSA 3DVLA 5DI9A 4WXRA 2GJ8A 2PLFA 1W0JA 2I4IA 2YHSA 3Q9LA 4M1MA 2B8WA 3EW9A 5CIQA 1NL3A 3I1FA 4LGMA 5LBIA 4ZCIA 2W58A 4KCGA 3THXA 2R9VA 3W6OA 4QHSA 1P62B 3NDPA 5L3VA 3FTQA 2PBRA 1XPRA 1N6KA 1ZAKA 2WSSA 2WJVA 2O0KA 2IC5A 4E09A 4FN5A 1KNQA 2FFAA 2GK7A 3KL4A 3WRXC 1FTSA 1XD9A 4PZLA 4PZZA 1SQ5A 4XVUA 3AVQA 5JS7A 1VKJA 1GKUB 3C5HA 1NI3A 1KMHA 2BHRA 1X1SA 3T5DA 5AJVB 1I4TD 2V6ZM 2VBCA 1R5BA 4IDQA 4NCKA 2ZJ5A 4HLQB 1YZNA 2JIZD 3AVWA 5CB8A 1VECA 3RDPA 2D62A 1W5TA 1YJ5A 2FZLA 4X8MA 3TIFA 5EXPA 1ZJ6A 2OG2A 4KO8A 3BAFA 3LNCA 4KBGA 4TLEA 3AVUA 3IPYA 5L3SB 1Q57A 2VLIA 2DCUA 4G5GA 3K09A 4EPRA 5TXGA 3BWDD 2MMCA 1IN8A 1ZINA 3Q3JB 2LCFA 3HJNA 4OI1A 1PLJA 4WA7A 2GEVA 5EE3A 3ZQ6A 4DDTA 1VIAA 3QIAA 1UM8A 1U90A 1KI7A 4TYPA 3KKMA 4X8OA 3G0HA 1GNQA 2ZRPA 3FE2A 2GA8A 2WWIA 5FUXA 4GFDA 1N6NA 2VF8A 3OIVA 5D3MB 3FOZA 2AWNA 2GJSA 4V0NA 3BH6A 4B32A 4AY2A 1JNYA 3PUZA 3A36A 2CL0X 2AKYA 3AF4A 821PA 4WZBE 4R71A 1E98A 3A58B 4LC0A 4DCNA 4URZR 3RAPR 3EC1A 1XCMA 5DHFA 3LA6A 1II8B 3KQLA 4Q5IA 4U02A 4PC2A 1XTJA 3F5FA 3VLFB 3AF2A 2ZQ5A 4Q1AA 4TLAA 3TUZC 1FQKA 4DWJA 1FFHA 2XSZA 2R62A 4BFXA 4LRTA 1EFUA 2ZTSA 4P4TA 3OEED 1CXZA 4V0KA 2JDIA 4EJSB 1G8FA 4OQLA 4AC9A 2AFIE 5CJPA 1F2UB 5JI3E 3TR0A 2RKOA 2IUUA 1MO5A 4DHEA 2J0UB 2PX3A 2ZS8A 2FU5C 1YR8A 2OSBA 2P5SA 3JVVA 5IF9A 4UJ3A 1IY2A 1Q44A 4CYMA 2IL1A 4WVFA 4MYCA 1A2BA 4Q7JB 2J3EA 1Z06A 2QEQA 3C5CA 4FIDA 3LD9A 4N3NA 2Q3MA 3PV0A 1U2RA 2PH1A 1GITA 3GFPA 4MYHA 4OQXA 4KITB 2YOHA 3AVPA 3R7WB 1ANKA 2PJRA 2J7PD 3OIUA 1AS3A 3KKOA 4JVSB 4QJ4A 4JKYA 4PHHA 1I2DA 2FGKA 1G7CA 4B3GA 2H8KA 1U99A 3B8HA 2HV8A 4D82A 3I62A 2QBYB 3QXJA 4B6EA 3FB4A 5BQ5A 2QAGC 1F5NA 1IN5A 5SZHB 3ZZ0A 4B76A 4PHTA 5FR1A 4BFYA 2W0MA 1X3SA 3AKEA 3TKLA 2AK3A 1AKYA 2DVWB 2HLDD 4Q1DA 4V0MA 4BZXA 3R9XA 4L5BA 3KDSE 2ERYA 5CLLA 4JLMA 3HP1A 1NVVQ 1DAHA 1WP9A 2IYZA 2W2TA 2IUSA 4LPKA 1CJVC 1XXHB 1HE8B 3SDZA 4R9UC 5TVKA 2I1VB 2ZE8A 3V00A 5CYPA 2P2LA 3THWB 3CPEA 3IQWA 4WIAA 3AGQA 1C1YA 5KDLA 4MGZR 5AUPB 2WZQA 3SNHA 1OXVA 1OYWA 3E2IA 2QI9C 4IRUB 1IQPA 1NG9A 2RGNC 3BJIC 5SZKB 2GF0A 5FTMA 3QE0A 3LQRA 4HAZA 3QF4A 3CIOA 3TSOA 1R5NA 1UDWA 2WM9B 4KBFA 1NP6A 1ZNWA 4NL4H 4D4LA 1G3IA 1ZC4A 4LHVA 2ZRBA 4YC7A 2DY1A 1YZLA 3MCAA 1DELA 1UF9A 1KKLA 4O2LA 1M1YE 3ZVLA 1LY1A 3U6BA 4BEBA 2DZOB 3U4QB 1R7RA 1I4DD 2P65A 1NNEA 2FA9A 3ONWA 2J7PA 1LS6A 4HSEA 5JCZA 4GMDA 1DG1G 221PA 2F3RA 3QJYA 4JT4A 3EZFA 5FOUA 2Q3FA 1CEEA 1M8PA 1KO8A 5CJ2A 4RZ3A 3T1QA 1RW4A 1U81A 4A6PA 4QGAA 2NZJA 1T0HB 1YVDA 1OKKA 5KNDA 4N1AA 3I73A 5ELXA 1Z0IA 1OE0A 2C9OA 1P2VA 5G3YA 3SJBA 1Q21A 2PMKA 2ZROA 4K81B 5HTKA 4D0NA 3QXHA 4TMZA 1E9AA 2IYUA 4DLTA 1DAGA 1TUEA 1ZIOA 3FGNA 3VU9B 121PA 1KI6A 2PLRA 2HLDA 4Q1BA 1NIJA 1QHNA 1G4UR 2OCAA 1S3GA 3E70C 4Q9HA 5BYKA 1UBFA 2WWGA 2GAAA 3VR6A 3K53A 2ZJOA 1W4AA 4PC3A 3UKDA 1OW3B 4LHZA 1ZBDA 1IXRC 2D2EA 2G1KA 2J7KA 1XD2B 3WHLA 2DWOA 1J90A 2P67A 3TVDA 5JBQA 3NKVA 1YKSA 1GSIA 1KK0A 2IXEA 2D4HA 1ZVQA 2WVJA 3O8DA 4PQRA 1F3OA 3GJ0A 3K9NA 4PO1A 2QUZA 1CRQA 3RWOA 1WA5A 2HF8A 1GWNA 4HZUA 4KAXA 2XZLA 3WHKA 1W4RA 1OIWA 4NMMA 5E7JA 5TDHA 3LBHA 2ATXA 4GOKA 4FMDF 4NYIR 2UZ3A 2F1IA 3DMNA 4NYJQ 1XDBA 2RGDA 3U7HB 4FMBB 3FPAA 3Q72A 4QRHA 4M2LA 1EWRA 2FF7A 4DB2A 4QHTA 5CM8B 4I1UA 3FHTA 1BH2A 4A0RA 2IYVA 2JJ8A 3PG5A 2HCJB 1OFIA 4GT1A 2O8DA 1E0SA 4I81A 3IKJA 3GPLA 4NH0A 4RFSA 4DSTA 4TTRA 3AEZA 5TARA 2MMGA 4GI7A 4WOPA 1XP8A 3AF0A 4OQMA 2GETA 2RGXA 1XRJA 1DS6A 1II9A 1XXHE 4O2RA 4IDPA 4XSHA 2ZREA 5JJKA 1NLFA 5JRJA 1J7KA 1X8LA 4KJZA 2WWHA 1OLOA 2V7QA 4HB3A 2KJQA 3A4LA 4I99A 1SXJA 4EUNA 4ZIRA 2CBZA 3O8RA 4DLZA 1A2KC 5A5GA 4Q02A 1VIYA 2ZXUA 3SQXA 4V0LA 1P6XA 4NCIA 2N42A 3C7KA 3U6KA 3EARA 4P4SA 2BBOA 2QT0A 1P75A 4G01B 4PPFA 2GK6A 1L4UA 1VG8A 1KAGA 2ZRFA 2PZEA 3GJ3A 1NVWQ 1QZXA 2AHOA 3QXXA 1XCGB 2F9LA 4JL6A 4OI2A 3D8BA 3F3YA 4Q01A 3WMGA 4F4IA 4LBZA 1U94A 4YMWA 1YR6A 2ZJZA 4B34A 3T34A 5DN6A 4A9AA 5JS8A 3NWJA 4P4UA 5C2JB 3QKSB 2GZHA 2OFWA 4DEXA 2OBLA 3ADKA 4EFLA 4GNKA 4AURA 2VYFA 4OHVA 1G8GA 5H1YA 4R98A 2G6BA 4C0BA 4RZUA 2GCOA 4EFNA 5JSZB 4TN1A 3GJ6A 5JMTA 4JL8A 1NVUQ 4LWZA 2L0XA 3KUCA 1R0XA 4DT1B 1P9WA 4H1UA 1C4OA 5FL3A 1X8KA 1LW7A 1X86B 5EXSA 4A92A 1CR0A 3EASA 1U8AA 3MFYA 2F1RA 4QBFA 4TYQA 1MRNA 4QNMA 2F55A 1G4AE 1J2JA 1UJ2A 4TMVA 4PSKA 3IO3A 2OBMA 4TZ0A 1A1VA 3VFDA 1P5ZB 3GLIE 1E69A 5TMPA 1ZD1A 2A9KA 2QP9X 4C7OA 3CR7A 4NBSA 3QUSA 2CE2X 4Y0AA 5EE0A 4LJAA 1WRBA 4TLBA 3K0FB 4JKIA 1NLZA 1HV8A 2CJWB 2DBYA 4M9XA 3I5YA 3NBYC 4G5OA 2OCBA 2YC2C 3D31A 5DI3B 3AVXA 1XEXB 3EXAA 4R2HA 4IVPA 2IYQA 1DAMA 3QKRA 1TQ4A 3T5GA 1EK0A 2XB2A 4LJ9A 1HQCA 3GLFB 1KHTA 4OJKA 4EPTA 2WAXA 3QEJA 4IEIA 3VHXA 4JJZA 1N2CE 2V54A 5KSPA 2FNAA 3MJRA 3LLMA 2JA1A 2X2EA 1YR7A 5KNCA 4BGDA 2F43A 4M53A 2G77B 5H70A 3U7EB 4PPNA 3U60B 1CTQA 2ZI4A 2C78A 4P3YA 4GDFA 4NYMQ 2GXUA 2GXAA 1JEDA 5EQTA 4PAQA 3ADCA 2PX0A 4Z8XA 3C4JA 4W9MC 3S1AB 1IJFA 2W2VA 521PA 3K0AB 3P20A 1SHZA 2QGZA 3B1VA 4LBYA 1Q1BA 1MH1A 4Q7MB 2O8EA 4HLCA 3QXCA 3RS2A 2XB4A 3CH4B 2F1JA 1Z6YA 3U3MA 3THYA 3UWOA 1HA3A 5K8IA 2C77A 1Z47A 3THOA 4L8GA 3VR2A 3FYHA 2NO0A 4LUCA 2J87A 1E79D 4TWZA 1ZIPA 4C0KA 1Z2AA 3GJXC 2HXSA 4LOAA 2CE7A 1QHSA 2NPFA 2FZ4A 3CPJB 4A8JC 3N5CA 1I4LD 2EWWA 4UNQA 621PA 1XEWY 2XTMA 2BM1A 5J4YA 3VNVA 3BORA 5C18A 3IHLA 2ZS7A 4MKGA 4ESHA 4EPYA 3O8CA 3TRFA 3ZS8A 4UXHA 3NXSA 3NHAA 3WMEA 3A1SA 1EXMA 5H8WA 3ZD7A 4LK2A 1W7AA 3NDBB 2C5LA 2JJ2D 4JSYA 1OB2A 2BMJA 3WP1B 2IF2A 2IYLD 3FMIA 4C0AC 1IN6A 1QHYA 4XWOA 2VTKA 3VAAA 1BMFD 2BMFA 2KBFA 2QORA 2NO9A 1FTNA 3CKLA 2C8VA 3B2EA 3MRSA 1TMKA 3NTUA 2GNOA 3NC1C 2RHDA 1CF4A 3V4FA 3EWAA 4F91B 5B2ZA 2HF9A 1KI3A 4OHZA 4DLSA 3VKWA 5L8VA 2IEZA 1UKVY 3F8TA 4RD6A 5JRZA 4F93B 3U61B 3BERA 3AVYA 1OB5A 2HYIC 3GLHA 3TNFA 1NG1A 1W44A 1E4VA 4LJ7A 1E94E 1OFUX 3QEOA 1NN3A 5EP3A 3EPHA 2ZYWX 1MR3F 2YWEA 1G3UA 4BFTA 3THXB 4QM6A 1E1RA 3CF6R 3RRZA 3HPRA 3WBKA 5AJYA 3UMRA 1J70A 1A5TA 1RRFA 3D7MA 4ASUA 1G8PA 4F38A 5KO2A 4D26A 3C14C 1J8YF 5IHPA 4CEIA 2BJWA 1CRPA 4L9SA 1FX0A 1OXTA 4J0QA 4DCUA 4EKDA 1D2MA 3RRYA 5GJWC 4B3DA 3LLUA 2J41A 3KKNA 2XTNA 4RCYA 4OK5A 2QT1A 3TUJC 1SVWA 4KVAA 4L4UA 4ZI3A 2R6GA 4Q4JA 3B6EA 5L3QA 4Q9JA 4HUTA 4MRNA 1Z63A 2HT6A 2BEJA 4RZ2A 4UNPA 5FL7A 5F9FA 2Z6VA 4RKEA 2B21A 3RS7A 1UAAA 3GLFE 1OPXA 2RCNA 4Q1CA 1ELOA 4FMCB 1TNDA 2P6NA 4AYTA 2WWYA 2V1UA 2FPKA 3QOFA 1E9CA 3NIBA 5EE9A 5FBQB 3IPXA 421PA 4W7SA 4HLUC 4QOSA 1OYYA 4XSGA 4OJQA 2IA5A 1KSGA 4M8NE 3B13B 1X6VA 1R8SA 2NGRA 2X77A 4JVLA 3CWZA 4P33A 5AK0A 3OEHA 2ZI7A 3HU1A 2FJUA 3MHVC 1TX4B 1RKBA 1TQDA 1UFQA 3AF3A 3KXKA 3MLEA 3TBKA 4BZPA 1GNRA 1NY5A 1BMFA 3T1OA 4AK9A 4BLTA 1FQJA 3B85A 1HY3A 1G5PA 1KDPA 1N6LA 1OXUA 3IILA 1SVKA 2GBLC 2QROA 3R8CA 3REFA 4ZPXA 4BRWA 3CB4A 3B1YA 4C0LA 1M2OB 4NYIQ 3P4XA 2B6HA 1GRNA 1NMYA 3K0CA 4EQ6B 1K5DA 1GVNB 3GLGA 3TR5A 1XTKA 2VHJA 5DE3A 3VTKA 1XPOA 3NBFA 2PT7A 3WY9A 4ZCMA 1XJ0A 3KKQA 4M22A 4PXAA 4JBWA 2V6IA 3A1TA 3B1ZA 3HYTA 3MSXA 3WYGA 4I1SA 1E1QD 4ARZA 1N5LA 3VKGA 1E32A 4A4DA 1XWIA 1P9NA 2A5GA 4W5JA 5CDFE 4U00A 1F2TB 4LCBA 5E95A 3DO6A 5AWFC 2XZOA 4NCNA 2ZE6A 3H84A 4RSGA 1H8HD 1E2NA 2CCKA 2QSZA 2XEXA 2Z4SA 5FBWB 3BH0A 2PZFA 1D9XA 2VEDA 5CM9C 5BYJA 5J40A 4ZDKA 3QQ5A 1Z29A 3SE0A 4A1FA 3UIEA 1G19A 4YXWA 5KPJA 3CW2A 3EIQA 4DUGD 3FMOB 2DFKB 4TYNA 2ZUCA 2BOVA 2V55B 1OHHD 4NYJR 2QP4A 3L0IB 3QF7A 1CP2A 2KBEA 3B9PA 1J99A 5EZ5A 2ZR9A 5TB5A 4O3MA 3Q7QA 4MYTA 2XNDD 1ZW6A 2A5YB 5H68A 1VYVA 1LVGA 1E4YA 2ZRCA 2QAGB 2WMOB 3QXSA 4JLDA 5AUOB 1AJEA 2EFDB 2IYRA 1ONBA 1COWD 3U7FB 3SBDA 2V9PA 1J8MF 5G3ZA 1CJTC 4A2WA 2W6ID 4BFWA 3RRNA 3GJ5A 2KI5A 3FDIA 2YWGA 2C9YA 5BN5A 3SQWA 2X19A 3UG7A 2OBNA 3BOSA 4FWDA 1A7JA 3KFVA 4IJMA 4M1YA 5DYGA 2MSDB 4DDWA 4WW0A 2OILA 4GPTA 1W5SA 3GFTA 3CNLA 1KY3A 3W9YA 4AG5A 2VP4A 4IDNA 2VHCA 1AKEA 1E2LA 1FOEB 1NBMA 1W0KA 2EFEB 4NTZA 3R8FA 4JVNA 4NZYA 3VQTA 4GZLA 1G20E 1VPLA 3U44A 1P73A 1Z6TA 5IRCD 2IS6A 3LBIA 3U3KA 1TL7C 2QMHA 4N0EA 5F98A 2Y8EA 1A82A 4UNNA 5AJWA 4C0QC 2XXAB 5E4FA 1N6PA 2ZR0A 2CK3D 4MITA 2OZEA 2Q9CA 2OCYC 1Z0DA 2IK8A 1Z83A 4AD8A 5LDDC 1R6BX 1YZKA 2D3WA 3M0EA 3KTAA 1H8ED 2G0NA 4M4SA 4OKSA 5CITA 4DCTA 1RYHA 1AZSC 3CO5A 4D80A 3QY0A 2YINC 4MQBA 1E2QA 1SKQA 1KJYA 3SEAA 3SFZA 3UK6A 4P0TA 3I61A 4Q48A 3P26A 3K1JA 4QGGA 2QSYA 3C16C 4ERNA 2FSFA 4AG6A 1OIVA 1QHXA 2ZSAA 3I4LA 3OE7D 2CMKA 2VQSA 3SOPA 3VHLB 1JXOA 3X1DA 1TADA 4LPSA 2MSEB 4D4MA 2A7QA 4IOKA 1Z6AA 2XNDA 3SYLA 2EFGA 4MKFA 1G16A 2ZE5A 1QHIA 3EC2A 4DVGA 1WF3A 4ACBA 1EESA 2ZE7A 3K70C 2H1LA 4QGFA 4B71A 3DPUA 3ND8A 4PHGA 1KI6B 1LB1B 4Q4AA 4A0GA 5FBVB 1C1KA 5EE5B 4HUQA 1NLYA 1JR3A 4M1SA 4QM7A 4CT4B 2H17A 2Q0HA 4XD7D 3X1XA 2IW3A 4KSCA 1XMJA 4V0OA 3W5IA 3DEFA 2ZRKA 1NN5A 3SYKA 2XJ4A 3N2IA 4LV5B 1KGDA 1DAEA 2VL7A 1NVMA 2BBSA 2WSMA 2VH5R 3KJEA 4GBMA 3LH5A 4LBWA 3WP0A 5KU1A 3TGPA 2XAUA 1GP2A 1G5RA 4R2IA 4C0JA 2QL6A 3AJIB 4HEJA 4LC1A 2FPMA 4Q4HB 5F9HA 1QHHB 1XTSA 1XFAA 5E7IA 4YMSA 1TQ6A 1KDTA 4Q1EA 1NJFA 1M74A 4CEJA 1L4YA 1U8YA 1XU4A 2VHTA 2FE4A 2J59A 4IOLA 3CPHA 2YJTD 3LW8A 1W49A 2QRZA 4Q66C 2VP6A 3T1TA 3AQ4A 4LYJA 1XTQA 4HAXA 3GEEA 4NYMR 5FBLB 1OT3A 4NCHA 4AWXA 2QM8A 2CL7X 2VSOA 4A82A 4Q00A 2O8DB 5JJLA 4FD2A 4Q9LA 3W34A 1U0LA 1YE8A 4MA4A 4A15A 1S4QA 2JIZA 2ZITA 5HE9A 1U9IA 2B7BA 1TUIA 1QZMA 2BJVA 2XNSA 4RJLA 2QE7D 5LB2A 1KJZA 1E2IA 1ZM9A 3OFND 3CNNA 5FI1B 2JJ1D 3LY5A 1P7CA 2VA8A 4E5UA 5C1BA 2BMEA 2NQ2C 4JLNA 4XOIA 1G41A 3PUVA 3FKSD 2GJAA 1PV4A 1T6NA 4B47A 2GAOA 1E2FA 1XZPA 3ZGXA 4KHZA 5FOVA 2JLZA 2ORVA 3OAAD 3JVUA 2O8FB 3B60A 2PMDA 3NHBA 1FL9A 3EPKA 4CEHB 4QL3A 4S35A 3RS5A 1T91A 1JAIA 2IXGA 4KLZA 4TT3D 4BLRA 4HATA 4ESVA 3EPJA 2GEUA 3DM5A 1RRPA 2BV3A 3HU2A 2NO7A 3IBYA 1M6NA 3NBXX 2CXXA 4B48A 3NH9A 4QGHA 3RRMA 4M0LA 2WOOA 4JLKA 4UNRA 3ADBA 3OEEA 4DKXA 3TW4A 1GKIA 3KQNA 3M4YA 4RCZA 3HYRA 4TQUS 2ZRHA 2QQ0A 2IX3A 3IEVA 4GOXA 2IS2A 4WZ6A 1W36C 2GDJA 1ZU5A 2JLSA 3E1SA 2WJIA 5SZJA 1T5LA 2ZRMA 1P2TA 3DM9B 3EG5A 2EVWX 2QRNA 1Q3TA 2UVQA 1KSFX 4TMWA 2PL3A 2W0SA 3QSYA 1OJLA 2PT5A 3AVTA 4PZYA 5FH9A 1AK2A 2ZR7A 2EWVA 1EFRD 4GZMA 1RZ3A 3IUYA 2VRWA 3H1TA 1JJ7A 1AQYA 2ECKA 3H4MA 4A0HA 5GVSA 4N0DA 4TMXA 2D7DA 3Q85A 1MABA 3CLVA 4TZ6A 1US8B 1II0A 3KXIA 1E99A 4TQAA 1R5OA 4HAUA 3GP8A 3OFNA 2QQEA 1GIAA 2XOKD 4JT2A 3WBJA 1IHUA 2ZEJA 1DEKA 1HYQA 4LX0A 4MDFA 5FI0B 1CBUA 2ZPTX 1W4CA 3ZDQA 1HH4A 2QTFA 4URWR 2XTZA 4QBIA 5KDOA 1ZUNB 4HDQB 1TPZA 2QY9A 5CLQA 3DMDA 1Z22A 2G9NA 5LB4A 4PQFA 4QBHA 1N6HA 1OXSC 1Z2CA 3FVQA 3MMPA 4G1UC 4UNSA 4BASA 1WXQA 3K0EA 2RGAA 4RKFA 3ZZTA 3SFVA 1X37A 3B1WA 4EPXA 1DADA 4EPVA 2GWHA 1YZQA 5L3SA 2O0JA 3B78A 2J0QA 4LBVA 4RD2A 4TL6A 5EP2A 1FPMA 3UMSA 1QBKC 4KLNA 2GVZC 2FEMA 3QPWA 4GP6A 1LV7A 2C04A 2K5UA 3PENA 1U0HC 4IVRA 1YU9A 3VX4A 1WCV1 1JQJC 1E0KA 2GHIA 3CF2A 4KSBA 4G0NA 4ZKDA 4ABYA 2J5XA 4NDZA 2YKGA 1RJ9A 2ZRJA 2WPDD 2C2HA 3AP2A 3PEUA 2C98A 2N1BA 1II8A 1Q0UA 4A8JB 3TVTA 3BK7A 4DBLC 2GXQA 1XPUA 3AVVA 1AZTA 2ZAMA 2V1XA 3ASYA 4FWTA 1WE2A 1XEFA 4LJ6A 2J0SA 3R9WA 1G8HA 1KOFA 4MGYR 2RGGA 1BS1A 4YLGA 4E22A 2ZJ2A 1G7SA 1OV4A 4EJSA 1HT2E 1SVIA 1BYIA 1F2UA 2KE5A 4NCJA 2Q3HA 5HZKA 2NG1A 2XOKA 1SXJC 4OI0A 4DSOA 4TSFD 1CIPA 3FWYA 4D2IA 4PX9A 2REXB 4DIDA 1IM2A 4DZZA 3MWKA 4LYFA 2FH5B 3R7WA 3T06B 2BCGY 2Z0MA 2ZRDA 4LZZA 4ITRC 3W3AA 1Z3IX 3T61A 2E87A 1UEIA 3ZIAD 3GLHB 3EPLA 3PFIA 4QBGB 4LV8B 3SC3A 2ODNA 4KU4A 2QPOA 3AH8A 1UADA 2EW1A 1T3HA 5DNYB 1R0YA 1DO2A 2QBYA 4M1WA 4XVRA 3Q5EA 2ONJA 3LXRA 4M9ZA 4CRWB 1SZPA 2G0TA 8OHMA 4CEIB 2QMOA 4LJ5A 3ETLA 1OH6A 4QNRA 1N25A 2AX4A 4XVQA 5B58C 2WOJA 1S8FA 1S9DA 2ZSBA 1G8YA 2IT1A 4NE2A 2GCNA 1S1MA 3CX8A 2D74A 2P6UA 2NIPA 4JYBA 1KZGB 1C9KA 1XXHA 3EIEA 2GEDA 3VR1A 1W2GA 4E03A 2IF0A 4CGZA 1E3MA 2N46A 3I32A 4FW9A 1VYTA 5TV2A 2C99A 1BKDR 3P4YA 1UKEA 2AD5A 1TF5A 3CRVA 2VPPA 4YMTA 1FMLA 2JAQA 3B9QA 3KKPA 1SVSA 1CR2A 4JVMA 2IHBA 4PSAA 4HAVA 5ANRB 1E2JA 2G83A 4IFEA 5IT5A 2REOA 3L43A 5DSZA 4AKIA 1Y63A 3BB1A 3ICEA 3A1VA 1OF1A 2PEYA 2QP3A 5KDDA 2GJKA 2ZI9A 2HT1A 4POAA 1AN0A 2RB4A 2O8BB 1ZM3A 2EFHB 5KSZA 3G5UA 5JI2E 2ODWA 2HJVA 2QTHA 3EZ7A 1G6HA 4OHXA 1OIXA 5SZIA 1E0JA 4US1R 3WXMA 4LYHA 4L15A 3SZRA 2WWWA 4TTQA 1QDEA 4Z1MD 2WIBA 3LWNA 4LJ8A 3UMFA 3HR8A 4KODA 2QG6A 4QJ5A 1VCIA 2OXCA 1JECA 4BZQA 1GFIA 5KPDA 2GKSA 1TTTA 2X2FA 2DWZB 2EYUA 4NONA 5KNBA 3C8UA 3TW8B 2AD1A 1XBTA 4HLDA 3L8ZA 2GVDC 2GJ9A 2ZYUX 3W90A 3ZD6A 2HEIA 3N70A 1HTWA 4IOMA 2R6CA 4DC9A 1NF3A 1VCMA 4ARZB 1MT0A 2EYQA 5DISB 2FMXA 2J46A 4LSGA 4RZXA 3VU9A 5M04A 3MAAC 4K8OA 1QVAA 2CNWD 5JWRA 3GLIA 4ON9A 3TSWA 1Z6XA 3AKYA 4Z51A 1HE1C 4JZKA 3TAUA 3WMFA 5IK2D 4I1VA 1AS2A 4RVCA 1Q12A 4MRSA 2ZJBA 3KB2A 1T4GA 4Z54A 5FUWA 3PUYA 1XD2A 1TQ2A 4GMXA 3L82B 1S1CA 2R2AA 4OK3A 1UBCA 2OFXA 3AB3A 5AR1A 2IWHA 3H2YA 3U3RA 2YZ2A 4OL0A 4FWGA 4QHYA 1X1RA 1LNZA 4IOJA 3BFXA 1KO5A 4JSTA 4DB4A 1FNNA 3TE6A 3EIHA 1GNPA 1ZYUA 3GLHE 4XIGS 3PIRA 1NKTA 5FUVA 1VHTA 3FMPB 3QKUA 4L16A 1CJKC 3RNLA 1ZCAA 2ANBA 2WKQA 1KNXA 1XB2A 1FMJA 1RRGA 3BB3A 4DXAA 4QC2A 1RC8A 1KI8A 4A2PA 4UXIA 3QVVA 5JJIA 3LDAA 3CZPA 2OV2A 1F48A 3AKDA 1ESMA 4C0SA 4US2R 4EFMA 2JLWA 4W5HA 3VKHA 1G18A 2OT3B 1KK1A 2BM0A 1CR4A 5HKKD 2BKEA 3P32A 4TL8A 2ZJAA 3AVOA 4QJ3A 1E2HA 1RVDA 2Q9BA 2CHQA 5G41A 3SBEA 4GRAA 4FMDB 2RHMA 3TQFA 2ODBA 2ZIAA 1R10A 2X8AA 3GJ7A 2HJGA 1M34E 3Q5DA 4LJYA 3RYTC 3IIKA 2WTUA 4TTPA 1VG9B 4B74A 4B75A 1WBBA 4B2IA 4X8LA 2ZSFA 3AP1A 2BBWA 4DLRA 4YQFA 2P5TB 1G3MA 1T9HA 1CU1A 2DYKA 3CRW1 5AUQA 1SULA 2FSGA 5IK2A 5B57C 1KY2A 2QGNA 1T5IA 1YRAA 1GAJA 2O5VA 2YYZA 4HB0A 5JWHA 3CRQA 2VF7A 2Q21A 3OHMA 2H16A 2KRKA 1E79A 3UXMA 1B0UA 1TEXA 3ZLJA 1L7VC 4NP6A 4OHYA 3SN6A 4BLOA 1KMHB 1DTSA 2W6JD 1CLUA 1QG4A 2A30A 2WJYA 2DWQA 4MRPA 4O25A 3QKSA 3CX7A 2EQBA 2CVFA 4BLPA 2WWXA 2A5JA 3MJHA 5GADl 3WNCA 1G17A 2OEPA
chains in the Genus database with same CATH superfamily
1NONA 4MWCA 4QPZA 7MHTA 5TMDA 2DHCA 1B00A 2VXYA 3RH0A 4LRWA 4CLXA 1M7HA 3BL6A 3B74A 1SOVA 3LPLA 2HHHM 3BG5A 3FR8A 1SPBS 4EEXA 1UZUA 4GLJA 2OESA 5A4DA 4KLRA 1R4GA 4E1AA 4YUAA 4IH4A 3ZYZA 4U5XA 1E9DA 4WI1A 3A6EA 2IEAA 4XIYA 1J0EA 4YAOA 1ZNXA 4QFDA 2CKMA 1MW8X 4RJIA 1LD3A 2FW7A 2A2ZA 5KOYA 4OXRA 1JT9A 2JLYA 4INZA 5BUZA 2HQBA 4GPAA 4YRIA 2ORWA 5I4CA 5J5VA 4FZ5A 3MOSA 5F77A 3E4CA 4FFDA 3MGBA 1JHYA 2AB0A 721PA 1WUTA 3IPCA 4JS0A 1VBMA 4YONB 1S2LA 3VX3A 3L93A 4F97A 4KNYA 4MYSA 4XYGA 4RVGA 1GL6A 3SJCA 3L7CA 4TL9A 4URFA 3TMKA 1I6KA 2P9QA 3B7WA 4K6FA 1IHDA 4II7A 1J8VA 3CNOA 4U6NA 4BTEA 2E4ZA 2CL5A 4ZT4A 3KJHA 4N82A 1OA0A 1OHHA 1U7TA 1UM9B 4RJKA 1JQKA 1T8TA 2NT4A 4B6QA 4W5NA 1C1XA 4B3IA 3AM1A 1KZ9A 1QNFA 4B6GA 3A11A 1C7ZA 3CJTA 3QTLA 4RPKA 4PBSA 5AW3A 1SBQA 4X45A 2CMGA 4HDMB 4HNRA 5C4MA 1Z5WA 3RSQA 2PX8A 2W4IA 5NULA 2I7DA 4IL5A 1HQKA 4KR7A 4ER6A 3KUDA 4OQNA 2H6EA 4N5MA 3VSBA 4RFSB 5HM8A 3PNKA 2XBUA 1EK6A 3OE7A 3C41J 2WHEA 2EWMA 4DSAA 3GELA 3TWKA 1NP3A 1SG9A 2OYSA 2OA0A 2HUNA 2Q4BA 2YWBA 4ZQFA 1PVVA 4MQEA 3LQKA 2WJ4A 4TMTA 2VR1A 3HKCA 3KHTA 5A7GA 2QAGA 4DQUA 4JBHA 5I47A 5EP1A 3KK0A 3I8OA 2GRAA 4L02A 1J00A 3VKUA 3R3WA 4U7DA 2VTEA 3L02A 5AQEA 1MV5A 5EJ4A 2C88A 1Z5CA 2Q3JA 2ZCUA 2EDCA 2OWEA 4D3DA 3HZHA 3KE8A 1EX7A 2OAGA 2I3GA 3DZDA 3R5SA 5D3ZA 3ZNOA 5DOZA 2ZS9A 1XAHA 1SUDA 2H57A 5CFNA 3KQTA 2A3RA 2F59A 5FFMA 4FOPA 3FUWA 4L7QA 3JVIA 2B4AA 5AJTA 2VQ6A 1CE8B 3OT5A 4C14A 2F43B 1CZNA 1EAMA 3K8QA 2OO7A 2FH0A 3I9KA 4ZTBA 1Z6PA 3BXGA 4DBLE 2O0MA 4HGZA 1ZAYA 2QMEA 4BE7B 5DW3A 2A5LA 1Y4UA 1GCIA 2ZB3A 3ZJTA 3GUZA 1FTQA 1SOMA 5FTLA 3CLSD 2I8AA 4IM7A 4NICA 1QHHA 1FVOA 5FPSA 3FWPA 4NULA 1J2YA 3NR2A 2B5WA 1U0FA 1G1MA 2FQ1A 4DV4B 3MTQA 5LP6A 1B73A 1FY2A 1OZGA 2WV9A 2WF7A 1LSUA 1WP4A 1USWA 2IUEA 3NBZC 1ORWA 3ZWVA 6AT1A 2L09A 4Q39A 1AS0A 5K8CA 2WAYA 2C82A 4DIOA 2IW1A 1E3EA 1JILA 4DSNA 2VJOA 4AMGA 4B2PA 4HZIA 3TDNA 4YRPA 4HDAA 1KA9H 1XD8A 3THWA 4IKEA 2CHVA 3ZWAA 3GZNA 3RC3A 1R9GA 2UVPB 3A9UA 4PONA 5BNTA 5H7XA 1OA1A 2B7LA 2GN8A 5BWOA 4W7IA 4YV0A 3CE9A 2BFOA 2BFAA 1ZKMA 1AV6A 1J0CA 2YV1A 3WLTA 1E7YA 1GL7A 3D3QA 2P1ZA 1YS7A 5D5HA 2AV6A 3HNRA 3KOWE 5ALMA 2GKOA 2XE4A 3K72B 3Q3VA 3FWZA 1D4FA 2JI7A 1Y5RA 4AKHA 13PKA 1DC3A 5JANA 3H2BA 1KMNA 4HKTA 1Y3FE 2HIAA 1NIPA 4MV1A 3BF7A 1UKZA 1PD1A 1LX6A 3MXTA 4ZAXA 3QVUA 1HUQA 4C7MA 3TN7A 4NSOB 5ERXA 5IVPA 2HQRA 3W5JA 3V9PA 1R4NA 4BNLA 4BDTA 2FPRA 5B36A 3U6LA 1KY4A 3HDHA 4DLVA 3NIWA 4ZO8A 4YRDA 5C5IA 5G0VA 3UWKA 2VRCA 3KKZA 4FDAA 4DLPA 3EXG1 3CF4A 1UJ6A 3R24A 3BIOA 1IOZA 4ZVSA 3LCJA 3PRKE 4AP6A 5LQNA 4LF7M 2DAGA 5IZCA 3I8XA 5G1NA 2XMBA 2NTVA 2C3MA 3A3PA 1VMIA 2R1TB 2DTEA 2FWPA 3E7PA 1JJVA 1F12A 2F8LA 4C7VA 1PSWA 3JZFA 4FR0A 2HCBA 3N2KB 4YXWD 4IDGA 4HUQB 1XZEA 4MS1A 3GDHA 5KU7A 4OTZA 2W2OA 4V0RA 3SHQA 2Q2EB 4IS3A 1EGMB 2WIAA 5BURA 5FUMA 5F7JA 3KT0A 1REQA 4XLTA 3D8HA 4HHEA 3RFUA 3FHOA 1JHVA 4HPJB 3TD9A 1XA4A 1RXVA 2C83A 4BBAA 4MS4B 3O8OB 2HWWA 1IQUA 4ARSA 1FW6A 2QXYA 4RY2A 3PFKA 1XKQA 5GWXA 3QVOA 1CUCA 1L4MA 3PPWA 3TL3A 4IV8A 3WKEA 5FNZA 2Y1CA 5K1ZA 1E96A 4IRMA 4TL7A 2EGUA 4U2FA 2IGTA 1U0EA 1N6IA 2XQFA 3P9RA 3LDHA 4PYRA 1IG0A 2JHCA 2Q4OA 4XE5A 4KR2A 4G84A 4TKUA 2B8WA 3I1FA 4GWKA 4ZCIA 2ZYIA 3FTQA 1H0HA 3LUKA 2KS6A 5F2OA 1IYZA 5D5PA 3L7BA 4RV5A 1I4TD 1Q2UA 3VU0A 3IP1A 3H9BA 3IPYA 1VE1A 5KVCA 4KQ1A 4ICIA 3L9WA 1XP5A 4KAAA 3HJNA 4C01A 2V7BA 1LJ8A 4MX8A 4TYPA 3KKMA 1TU0A 2O2YA 4AZFA 2UZAA 1L3CA 4BKOA 4G0OA 3KQWA 3NOVA 2Z3WA 2DG2A 1M2HA 1P8AA 3VLFB 2AJTA 5K0JA 4KHPM 1F20A 1FFHA 2FMTA 2LNHC 2XSZA 4XR9A 4P4TA 2Y21A 4KFCA 3TWLA 4MTCA 2AFIE 2A88A 4KYTA 3UV3A 2WTNA 4DLNA 1M72A 4W9NA 2ZBDA 4FIDA 3AXSA 2PJRA 4JKYA 1LI7A 3Q6NA 3W2HA 1WLYA 1Y4ZA 1Z0ZA 4BC1A 1FFDA 3C8MA 2QAGC 2O1SA 4ALIA 2G1AA 4WOBA 1F4IA 2DVWB 3UOAB 3LLCA 1WL8A 4BZXA 2Z3XA 3W5UA 5LUBA 1WP9A 3PQ2A 3UGQA 2HJSA 1HE8B 2JZ0A 4G4SP 5E4JA 1M10A 4X1OA 5GPBA 1HNNA 4HRXA 1XHEA 2PYZA 1NG9A 2I65A 5DMXA 2J3MA 1ZNWA 1N5DA 4OGWA 1I4DD 2PRZA 1NNEA 2OKCA 3WKCA 4GMDA 4YRKA 4GM0A 2Z5VA 1EM8A 1T0HB 1IUPA 4Q3AA 3U5ZA 2HLDA 5IW8A 3BMNA 3W3AD 1UBFA 3TEMA 1YVUA 1Y8RA 2P67A 2VK2A 5JYCA 2K6BA 3O8DA 3PZRA 2XZLA 1F6DA 4FMDF 3SF0A 4NYIR 3C3WA 1BRMA 2QLNA 2PUBA 3ZJUA 3LG2A 5LP6C 3V4LA 3RUCA 3PG5A 2YTZA 5GINE 4N76A 3SIXA 1HWYA 3NRJA 4MQ6A 2PD3A 5C80A 1CYEA 4Q02A 5AICA 3EVDA 4KMMA 3L49A 4NK4A 1Z5NA 2NUPA 3QEKA 3GT4A 3GJ3A 2Z1MA 4WURA 4OI2A 1FRQA 3LA8A 3I6BA 1U94A 4P4UA 2IFTA 1SIOA 4L73A 4BQIA 3TJRA 2G6BA 3ZE1B 4BHTA 1JHAA 1UPUA 2CV1A 1EVKA 3OOJA 3MFYA 3M6WA 5EWLA 1GG9A 2NU6B 1IZ8A 4BB0A 3D8TA 1P5ZB 3KOXA 4EHJA 3SD7A 4DR3B 4LF4B 3NFYA 5MFPA 2H3EA 2GD6A 3IBCA 3INTA 2EBUA 2C5FA 3FRHA 4J43A 5AHOA 1XQ6A 4YPOA 1C30B 4WZZA 1O5TA 4OJKA 2I6XA 1MAAA 3CFYA 4PLTA 1JHRA 4BJ1A 1N75A 1BC5A 3HXKA 4FYXA 4JLWA 1V5IA 2GXUA 4NLLA 4JASB 2UDPA 1W75A 5TQ0B 1AQ6A 4LBYA 4D9EA 2V59A 1KERA 4BFCA 1QYDA 3UWOA 2NO0A 2RFLA 1Q7CA 5FFNA 4LZWA 3QHPA 3FVWA 4C3VA 3P9ZA 4LF8B 4IMIB 2Q5HA 3ZS8A 2EP8A 4LYYA 3NHAA 5H8WA 5IBRA 3NDBB 1AA6A 4BX9A 2X9GA 3CKLA 3MRSA 1TMKA 1XRNA 5B2ZA 5JRZA 1QFYA 3D6MA 2ZTDA 3WWCA 1IOVA 4RAOA 2YWEA 3HUUA 4C3OB 4F38A 4ZEWA 1FX0A 2BT4A 2ZB2A 2O23A 4YFVA 3KKNA 1TTQB 2ZWMA 4X91A 3TUJC 4ZI3A 5DU2A 2A1TS 2CD7A 5L3QA 4HUTA 5JO9A 2Q46A 2X15A 4R0MA 5DBIA 4MGHA 1ZOPA 2FW8A 4DV0M 1ELOA 1NJ8A 2BFEA 3JD4A 4AYTA 2LTUA 1O58A 2Z6AA 5EE9A 3HV2A 2Y2UA 4KTTE 2NGRA 3FETA 4JVLA 1L7QA 5FBRB 8OHMA 3CG4A 1FK8A 3KXEC 3B1YA 1GRNA 4CPDA 2QX9A 3VTKA 4OGLA 1VL2A 4XGKA 4B8ZA 4Y9TA 1NF2A 1NU6A 4HTFA 1M0EA 4LCBA 4LJSA 1U8CB 4JAVC 3VPHA 4D8XA 3DKIA 1Q95A 5KPJA 1RKQA 3V32A 4DIFA 4R3WA 1E3LA 3VJMA 4J4TA 1MMFB 2IHTA 3V6LA 3JASA 2WMOB 3KOOA 3V76A 2WR8A 1PNQA 4XJTA 3K73O 3RFXA 1HZZA 5F5LA 2EKDA 4R5HA 3J7AC 1W0KA 2YNMD 2Q1YA 3U44A 4MGYE 1NT4A 4K9DA 4Z49A 4QZVA 2Z2XA 2HL7A 1GARA 2Q9CA 3NJRA 4WFKA 4ZREA 4DCTA 5CCBA 2H08A 5KYVA 2WJ3A 7REQB 4MQBA 4MV7A 3RSZA 2IHZA 3BRQA 1H3NA 1PWHA 4LPSA 2VSNA 1QHIA 5AM5A 3GHHA 5IFKA 3BGVA 3K70C 4II2A 2RGHA 5K4GA 1C1KA 1VYHA 4FGZA 4CT4B 3X1XA 2IW3A 1TIKA 1PG0A 4V0OA 2FPUA 2ZRKA 3SYKA 3L8FA 3LFHA 2C42A 5KU1A 4PG5A 3FVVA 2QL6A 4HEJA 5M34A 4BBPA 1XFAA 3UWSA 1C9EA 3KEQA 4K88A 3RIXA 2FWNA 2QRZA 3DXZA 3IEPA 3LW8A 2ZFUA 4HAXA 3GEEA 5FBLB 3UTDA 2YWXA 4W9NC 5K0BA 3OJEA 3C4QA 1OAAA 4Q16A 3OMWA 3MFQA 4FILA 3ELDA 1A9QA 3DMRA 2A0UA 2GB4A 3PLAE 2BKAA 1G41A 1WKCA 1WPQA 4IJ6A 2VNSA 3E03A 1L9KA 1GCGA 3VJKA 1XXLA 4HATA 4WESA 1V7PC 4B31A 4J29A 3W9UA 2QTCA 4KH1A 1CX9B 4YCAA 3UHAA 1JR2A 5JCJD 3H5RA 2VDRB 1MORA 3FI0A 3B1JA 2VRWA 3CLVA 1GLVA 3F7TA 5JH7F 3F90A 1AGYA 2XNJA 1C8KA 5DGHA 1U5AA 3TFWA 1EXDA 2C2BA 4LCEA 1RYBA 3WK7A 4OXXA 4DWOA 1Z22A 4LRYA 3V7FA 1LH0A 2JY8A 3GBSA 3MS7A 4DREA 1X80B 1IZ9A 4MQFB 5JDCA 1Y6GA 3M5CA 5EP2A 3UMSA 2VDMB 2HO5A 5ALDA 3DAPA 2GHIA 4PLYA 2HU8A 5CG2A 5BSWA 3FXAA 3PEUA 5KNBH 1U8TA 1XPUA 1G8JA 3AVVA 1G7SA 2XCOA 3QE2A 4YJKA 4MV4A 5IKMA 3V46A 4K28A 4RTLA 1PJSA 4HV4A 3KSDO 2W82A 3B12A 4MA5A 1SUFA 2AF4C 4FD3A 2ENWA 1Z4QA 2C0QA 1SZPA 2G0TA 2HN9A 2NXEA 3GXBA 1JB9A 3GNLA 4JYBA 4O6VA 4ZGWA 2Q1UA 3WDKA 2QG4A 4YCSA 1TF5A 2I8LA 1H0RA 3ICEA 5B1SA 1HQDA 4FQ7A 3G5UA 2QU7A 1GPUA 4Z1MD 4CKYA 4DR2M 4IBEA 5KPDA 1U0OC 3VUEA 2AD1A 4BQRA 3D7KA 1HTWA 2DF8A 4N03A 3MLAA 4KOEC 1JUDA 4ZVLA 5IASA 3I53A 1Z6XA 3EB9A 1AS2A 5EVCA 4Z54A 2GOYA 4A8TA 2WHYA 2IWHA 3H2YA 4OL0A 3LVBA 1G21B 4JSTA 4W7HA 4GZ6A 3D6JA 5LZ4A 3OOYA 4F8EA 5HZMA 3PR3A 1QFMA 3H2KA 1CJKC 1N2CA 4E94A 4RVSA 4PYQA 4LXGA 2Z2KA 4TYMA 4FIZA 2YQ4A 5JAOA 3ETCA 5K3OA 4MCIA 3SBEA 5KQ8A 3B89A 4J7XA 1KEKA 4QYIB 2QDXA 1I14A 3IIKA 5MGBA 3UJPA 1P77A 4X8LA 2MCFA 1WR8A 5KJCA 1G3MA 3JAMS 5C5CA 4MVJI 3IX7A 5F52A 3LC2O 4G0WA 5JQGA 2QW1A 3P5BA 3WAKA 2HBZA 2BM8A 2V0GA 4LDQA 1RZUA 3IQDB 2CVFA 2WD7B 4HG2A 2GPAA 4HR7A 5CT4A 5K0EA 3N7TA 4FGSA 4DUYM 4NV3A 5C46F 1U2ZA 4PLPA 4A0FA 3IALA 1BQEA 3TCKA 2FOLA 4EJ6A 4I5FA 3OT1A 5K6RA 3REQA 5HW0A 4BECA 2WMNB 2YHIB 2HDNB 5FEMA 5BWMA 4O4IB 3VSAA 2BI8A 4NDAA 4JL5A 3K0AA 4DANA 4TYWA 3LSTA 3T1VA 2GM3A 2EHJA 1DOAA 2YIJA 3R41A 4DIUA 3GQBA 3FVRA 3QAUA 1PFWA 1JSCA 1CJMA 4QO7A 1I80A 5CB6A 3NXKA 5FPKA 1HZZC 3AB8A 5IT9S 3BRWD 3WL6A 4FKZA 4GMQA 4QO8A 1TD9A 3TBHA 1J0BA 2XD4A 3S2SA 1WIVA 2VYVD 3VI3B 3PUXA 2J0VA 2PMFA 3MTJA 3HKDA 1S0UA 3DEHA 2ENUA 3O84A 3CYFA 1JIJA 1JI0A 1E1CB 2K47A 4HXGA 1GJSA 2V3VA 4C7XA 1A2OA 3CTWB 3PQ7A 4D0GA 4DEYA 4BDSA 1ENYA 3OLZA 4DNOA 3SF8A 1NKSA 4B87A 4X7PA 1UPBA 3DCIA 1URPA 4EO7A 4RA6B 2ZTCA 1UFRA 4HD8A 1P1KA 1PEYA 4WK0B 3DL4A 1WY5A 1CHNA 4MPTA 3E15A 2ZANA 3UJ3X 2YX1A 3FSJX 2MSLA 4IHQA 5JRDS 4OK6A 4QXMA 2JFGA 4HZUB 3SAUA 2IHKA 1NV9A 1K5GA 4BO5A 1EFPB 2PH5A 5FA8A 3NP7A 5IVDA 1H9CA 3O47A 4K05A 3JD2A 3RSLA 1SHKA 2AI1A 5IAGA 2R65A 2YJGA 5FJIA 5H59A 1GG2A 2AL7A 4NHEA 1F2TA 1UDAA 3FHJA 1ZXXA 3DOOA 1K06A 3V7WA 4EW6A 4HBZA 4CI9A 2AK2A 2ZPUA 4KN5A 3TJZA 4C5BA 3NU1A 1ICIA 1ZD2P 1GPNA 4GSLA 1OKKD 1XVTA 4FOTA 1VTKA 3VDMA 2X1HA 3ZVRA 4AY4A 3V8EA 5I7UA 2G5CA 3DE2X 2HSZA 1DAIA 3QV2A 2QTLA 4LI0A 1W52X 1P74A 4IIJF 2BTEA 1KJ9A 4ND8B 3HBNA 4NXMB 1ZM2A 4LRQA 3NAMA 3T3IA 3HFSA 5DP2A 4EB8A 4YUVA 2OQVA 1XMSA 1JA1A 1WGNA 4EY5A 3E8XA 5A9RA 4EB3A 5DEOA 2XT6A 2JJ1A 1N36M 9GPBA 4DZTA 3GJZA 2KW5A 3RC9A 5IJ0A 5HIKA 2ZBPA 4PAOA 3IOMA 3NM5A 5JDCC 1I9CA 4HNAB 1XMOM 1SXJD 1NW5A 4L0DA 1HFWA 2OHIA 2YV5A 4NZOA 2CZCA 5AI9A 4KI0A 5CK5A 2R8XA 2MSCB 3MQ2A 1B8UA 5EERA 1M7BA 4TM7A 2CF6A 1UBTS 1RIIA 3W3ZB 2BWEA 5EZYB 3V4RA 1B1CA 4XARA 3RASA 1DVRA 3E81A 2HQ1A 4BGUA 4C0HA 4JMLA 3HJQA 3CY6A 3NH6A 3LY7A 4RACA 4AL4A 1AQNA 4Q7JA 1XKLA 3OA2A 2C4WA 3GF4A 2QZSA 2XB8A 1B23P 3M1YA 1NPTO 5JALA 1LF0A 3GX1A 3KOXE 3ZWWA 3LWDA 1Y4SA 1LDBA 1PM5A 1UMBB 5LFAA 3F71A 1OOEA 1XLTA 3KBBA 4D0RA 4QGBA 2XUZA 2D8AA 3CVYA 2ZYVX 4H1TA 3SMPA 1AHNA 1ZC3A 1TM7E 2FSSA 4S0ZA 3NMUF 3PGVA 4M60A 4ND6A 2W71A 3D02A 3BWVA 1W96A 2JKYA 1ESEA 1I2BA 3FOAA 1WG8A 4RSRA 3MJEA 1W581 2EARA 4DLLA 1NMQA 1EM6A 1A7UA 2HCFA 1SQ0A 4TROA 2ODAA 3I45A 1BD3A 4OQEA 3WOVA 4NKRA 2PPLA 3UMCA 4L22A 5K2MA 4HB4A 2XH8A 4RGBA 2VP2A 5BQ3A 4PO8A 3QZUA 4D92A 1QF9A 1FDVA 3R7SA 1NBOA 2GJ4A 3BA1A 1MAWA 1OH7A 5HIAA 1CD5A 1PR3A 1GAEO 4FCVA 1RABA 2P9JA 4A26A 1K75A 2OMKA 4F5EA 1RC0A 1ULUA 1FUKA 5CGZA 3WLJA 4AO6A 4MRRA 1SVMA 4AWBA 2QRQA 3TD2A 3OE4A 1R0BA 1SD1A 3GRCA 1SXGA 2XZUA 4X84A 1NFFA 2WAMA 3LUJA 3D4IA 4WUTA 5E1MA 4HXEB 4BNDB 3BWBA 5JARA 1ZRSA 3HHEA 2UZIR 5FLYA 3HDGA 5BN1A 4D43A 3DNMA 3TG8A 1JSLA 4JI1M 1NSTA 5JMWA 1MJGM 1JG2A 5KTYA 2PFKA 3AM4A 4QEZA 4A8PA 5CFMA 4CG2A 2FZ5A 3DLHA 4JX8A 1Z4IA 5F2NA 4UHDA 1Y6JA 1EEHA 2QU8A 1PJJA 3OICA 2OM6A 5TEWA 1S89A 3E9ZA 2WF9A 5TJ9A 4MI9A 4BUCA 1E3DA 1FFXB 3QPVA 1IUNA 1T9KA 1GPBA 3NHWA 2XX3A 5F7ZA 3BS4A 2FHPA 4XH9B 2LRHA 3YASA 1Q39A 1YHNA 4L3VA 1DGGA 5FDFA 3T5MA 2WUDA 2RAUA 1AH2A 5C7YA 2Y1DA 2PBLA 4Q03A 2OQRA 5KYGA 4O4HA 1A1SA 4D4HA 1NXXA 4R0NA 4WAUA 1W2WB 2W6JA 2PD4A 1IC6A 1MRZA 3AUFA 1PJIA 4P81A 4JKOA 3MGAA 3A3OA 4OXYA 1H66A 5BRNA 5D84A 2XGJA 3P2YA 1Z4OA 5ECGC 2X22A 3BK1A 3SS8A 5AVTA 1X7XB 2WLSA 1OZAA 1Z8HA 4QAQA 3O38A 2XRFA 1YBHA 1TK2A 3ND7A 3ETDA 3HK2A 4FM9A 1WDWB 4YAWA 4RDCA 2Q0QA 1N9ZA 5KSYA 2P6RA 4N49A 1R3DA 2FSIA 2GN2A 3H0CA 4RTSA 1NL3A 5LBIA 3EYWA 3FNBA 4QSHA 3DBHA 4BAZA 1ML3A 2AT1A 1OJ7A 3BQMB 1JN0A 3KEOA 1S02A 1CR6A 1KEZA 4FNMA 3ON5A 3C5HA 4JUBA 2ZJ5A 2XUIA 3ZGYA 2HRQA 1TJNA 3UGTA 1VSUA 2ZUFA 4KO8A 2YVAA 4PIPA 1Q57A 4C87A 4NJMA 1XU7A 1TUBA 4WA7A 1UM8A 1M1YB 1A69A 4DADA 2WWIA 3GNSA 2O2ZA 5CTJA 3TGLA 1O95D 2RJOA 4ZRMA 5AHKA 4QOJA 3A36A 1GVNA 3RAPR 3HBFA 4IBOA 2FTKE 1M54A 3RAFC 5M3BA 5EMMA 1TCAA 2J0UB 3A1FA 2BEWA 4YRSA 4EY6A 3JTEA 3LBYA 4HVAA 1VXOA 2NUBA 5TSDA 1DKMA 1QV7A 4GVPA 3W2FA 3OOEA 2NUTA 2QBYB 4RV9A 3KAJA 2RCYA 4J9UE 4GKKM 4DNXA 2BI7A 1NVVQ 4YQYA 2IUSA 4EKYA 1Y3CE 3OX2A 2JFOA 3USES 3SNHA 1IBLM 2SECE 1U0SY 4PN3A 4ZHQB 4NQRA 2JFQA 5C51B 4JK3A 1XUOA 4TV8F 1DTWA 1L1RA 5MN6A 4L72A 4D4LA 3WQQA 2ZRBA 5KO3A 4FR2A 5IYZB 3G49A 1QU3A 1S8NA 3G9TA 1E3IA 4FQ8A 1L1QA 2P68A 2I87A 3A9TA 3QEBZ 3QXHA 1E3TA 3BGSA 3ZHCA 2QXUA 3VOSA 2IRWA 1Z5UA 3G8AA 1RJFA 1QIMA 1M2NA 3UKDA 4KRYA 4F86A 2OB2A 3Q7IA 1P0FA 2X0KA 4KUHA 3GJ0A 4MA0A 3F6SA 3W9SA 3WLRA 4GI3A 3PT5A 1BH2A 3GBPA 3IKJA 3L1HA 3N5KA 3CKYA 4ANRA 3AF0A 2WSLA 1I7DA 4MUMA 4ZT5A 5JJKA 1TVMA 5JZOA 5GQSA 1C9DB 1YS2X 3JQ6A 1DB3A 2G7ZA 1ZK1A 4ZIRA 1XLTC 1V6CA 2NVOA 1YE9A 4GGPA 1N2XA 2QT0A 3WGZA 2R1UA 3EH1A 2ZRFA 4LZAA 3GO8A 1WHTA 2Y92A 4KXUA 1XCGB 2F9LA 1SCBA 3F67A 2ID4A 4NFYA 2ZAGA 4A9AA 5BV1A 2RHBA 1Y1KE 3A0RB 4Z6YA 4C0BA 1VA5A 4MPJA 3WE7A 4P84A 2W4MA 5A3RA 5BSFA 2D5BA 1C9MA 5THXA 2Q4RA 2VPYA 3VFDA 4HH1A 3CR7A 3V6MA 4RAQA 5CT8A 4JKIA 4MI6A 3VYTB 4DV1M 3AVXA 2OK7A 4EP1A 2OP0A 5AW2A 1P1CA 3T5GA 4JI5M 2WVGA 1K86A 1KHTA 3H83A 1ZV1A 3F74A 1ZEMA 1N2CE 3TOSA 2X2EA 4L0MA 3VYVA 3S1AB 1KPIA 3P20A 3B1VA 3ZWNA 1X7ZB 4AY6A 3A9VA 5LA6B 4L8GA 3VR2A 2XCIA 3QX7A 2GZ1A 1I1NA 1QAQA 1NBEA 4RX1A 2JLAA 1XEWY 4DR7B 4LG2A 3IHLA 5AKKA 1YONA 2PKCA 5CDYA 4FUQA 2PXAA 1APBA 3N2GB 2HF9A 2RH9B 3F6CA 1CQIA 5LSAA 3RADC 1O7JA 1NG1A 3RS8A 3B53X 3PQ3A 3I4FA 3D7MA 4DDMA 2BJWA 5HILA 1RPAA 4MJ7A 4OK5A 3JTMA 2O3JA 2NV2B 2BFNA 2Y0CA 2B4YA 2CFOA 1TTPB 4RZ2A 3TMAA 4OQYA 3ZUGA 4KQ2A 2CB0A 2SCUA 3G02A 1N0HA 2P4UA 4K86A 421PA 5ED4A 4W7SA 5SICE 5AK0A 1DJQA 3CWZA 3HU1A 1TQDA 4EPRA 4I5GA 4P3PA 2J3KA 3C6MA 3CB4A 4C0LA 1ZLYA 3L26A 3NBFA 2NX2A 4XQ0A 2WP8J 3B1ZA 4B6PA 4I0WB 3AESB 4CTJA 3D43A 3JVDA 3EVFA 1IBKB 3Q8XA 1XWIA 4PX5A 5AWFC 1T43A 3CUKA 4M7PA 2J08A 3FNQA 1FFEA 5ES4B 1N32M 1JU3A 1XR3A 5KYUA 2RHGB 1QH1A 5TB5A 2XGMA 2AYYA 4Q3EA 3TOVA 3OJFA 4JI3B 1WDLA 3OY7A 5JYEA 3GJ5A 1TIBA 3SQWA 3UG7A 1JZTA 1UPFA 2WTXA 1MDFA 1YRWA 4GPTA 2VP4A 1L5RA 4OGFA 4GKVA 3R8FA 5CDGA 1RAAA 5IRCD 2IS6A 1GT6A 3GFBA 2J5QA 2W11A 1QB8A 2XXAB 3HCPA 3PNPA 4W9RA 1YZKA 2G0NA 3C6BA 4WZAA 4E1VA 2YMMA 4ME6A 3VXKA 5E2IA 4AG6A 2C94A 1J21A 2D0DA 1XTVA 1DIOB 1HT3A 1H3FA 3OIFA 3HEBA 3DPUA 2PE5A 4KRGA 4QE3A 1JR3A 1SXQA 4XYLA 5BWNA 4WL0A 1V96A 4X65B 4MUXA 1E5VA 4ZVKA 2FEXA 2OQIA 1TM5E 2YRXA 4IOLA 4HJRA 2MROB 4XPIA 4PCUA 2CJFA 5A3VA 1NJ1A 4JSRA 3HI6A 1JMKC 3ZWMA 5F4ZA 4I1PA 1NX6A 2WMYA 3R75A 3ISTA 1FDWA 2GO7A 3STUA 4BMYA 1G38A 1T6NA 4B47A 3L7KA 3OY2A 4YRCA 3RYFB 1K7CA 3H4JA 3EZGA 4ESVA 1M2VB 2PDAA 4B4WA 3HU2A 2CXXA 2XBLA 5CA0F 4QGHA 5JNTA 3ZHXA 3NWEA 4DM3A 2QRHA 3O90A 1GABA 3HA3A 5JS1A 3M4YA 3W3AH 2IS2A 2GDJA 3IUSA 4JENA 2IV2X 5AOVA 3BMOB 1ECJA 2UVQA 2BEUA 4Q05A 5TF0A 1M73E 2M2IA 1UZNA 4BC0A 1GU0A 2C2OA 1H1TA 2YV2A 5E6SB 3GEGA 1ZMRA 2KYRA 2XHZA 2RKWA 3H7AA 1EDEA 1HH4A 3DBOB 1QCYA 4CTMA 1ZJWA 4G4RA 2JGJA 4FEGA 2BKVA 4QOFA 3MMPA 1CRZA 1X37A 1Q7RA 2BY4A 2PS3A 1GYPA 4RD2A 4YYEA 4I2NA 5LZ9A 4KLNA 4H60A 5ADVA 4ZAWA 3LVWA 1E62A 5B6PA 4QDOA 2OV4A 3JQAB 1Y80A 3QVMA 2N1BA 4IHKA 3W5AA 1HR0M 4CMKA 3U6MA 5EKXA 4D8TA 2X3FA 2JFHA 5BOSA 4E22A 3I4VA 1NDUA 2WUVA 1KOJA 4F1IA 2FX2A 1PBNA 4DIDA 3F7NA 3M83A 1A04A 2HADA 2W98A 2I2XB 3SC3A 4NAUA 2EW1A 4UTPA 4M1WA 4P83A 5KPTA 2PVSA 5F7OA 2P2NA 2ES4A 2NV0A 2GEDA 1UJCA 3GWZA 4YQZA 1NVAA 4GYJA 5BNFA 4HAVA 4YT8A 3OJXA 4BKPA 1Q0SA 2JPDA 3H5WA 3X2EA 1ZZGA 3DJYA 2QN8A 1GJTA 1KQOA 4LKOA 2E4AA 3ZDRA 3EBOA 4BP1A 4MUGA 4PIMA 3LWNA 4FZRA 2YY6A 4WK2B 3I2YX 4M0WA 2IOYA 4FFMA 1TTTA 5H02A 1N2OA 2EYUA 2FW1A 2LZ0A 2YZNA 1V7QA 3ZD6A 4INOA 4R8KA 3U6DA 3I5AA 4I8DA 4OUDB 1DGQA 3VU9A 4YJ3A 3TSWA 2OO3A 4RXTA 4EW1A 4MRSA 2QYTA 3EVZA 3U3RA 2V97A 5ILOA 2ZWVA 3I09A 3BFXA 1KO5A 5BV7A 2OPHA 1A9ZA 1YQ9A 4YAIA 5K20A 4BQNA 4TS1A 1JLLA 1XB2A 4E2XA 4JH0A 1G63A 4F3NA 4A6EA 1ESMA 4C0SA 1H1LB 4P7JA 3K1AB 4AQYB 2EDAA 3UXEA 2Q9BA 1B8OA 2HJGA 2QD4A 4O4JB 4FBGA 3EVTA 1OI2A 1RHQA 1UWLA 3UAXA 4K1LA 2I22A 4REOA 1M1ZA 1YRAA 4HDNA 3OHMA 2H16A 1B0UA 2QVXX 3KYJB 1N3IA 5AP9A 4Q37A 3L0CA 4ESOA 4LFCM 3PHJA 5E26A 4GX5A 1U1CA 2DBQA 3SIRA 1YI0A 4GKJM 2B5OA 1NVXQ 4ZEXA 2QLBA 3NI2A 3HL0A 1ZNYA 5CBPA 3AF1A 3DBIA 4CHTA 1B3BA 1O6BA 2FWAA 3GRVA 4JQYA 2H48A 3EA5A 4N5IX 4LRTB 4HDSA 2XYQA 1V2HE 1QGUA 2VDWB 4CCYB 1NRXA 3SJUA 3KJGA 4PZUA 1WIWA 5GY7A 4D9NA 3E9SA 2GH1A 3RVQA 5JH7A 2QM7A 5GJBA 2Q5IA 4LXIA 1YR9A 3UFBA 5KAMA 1CIVA 2AS0A 3V8MA 4G4GA 1XKXA 3GGOA 4EMTA 3OIGA 3JQQA 2OM2A 1RACA 1YFZA 3RS4A 4OP1A 1Y9JA 1NFRA 5JJ5A 2VKQA 3KZMA 5BV2P 1W88A 4TLDA 2W2PA 2DPXA 4QNNA 1TM1E 2Y1EA 4JU8A 5AJXA 2SHKA 1FTGA 1SU4A 3ODGA 3ENQA 2PR7A 5LMUB 4UD6A 1VC2A 2ZRIA 2UUCM 2IUFA 1QV6A 3VDPA 1VJRA 3WLEA 4IBDA 1E8DA 3PUIA 2AOXA 4IWYA 2OLKA 4DR4M 2X4IA 1KF0A 5TMBA 4J3NA 2W6IA 3SP1A 1G20A 5HA5A 1FXUA 3OD1A 5JZBA 5FQOA 5L3ZA 1WMAA 3ADOA 1C1HA 2RGUA 4WY8A 3KUKA 4DTIA 1CDOA 3AKCA 3OCUA 4FHFA 1DQSA 3SLKA 1XJCA 2FG7C 1AA9A 4M1TA 4PLFA 1YE3A 1XL1A 1GR1A 3SI7A 1EGAA 4ARUA 4R1QA 3WO1A 1IY0A 4CXMA 3HCRA 1U7ZA 5IKXA 4YGYA 5G40A 2B8TA 1YI1A 5KYKA 3Q15C 3P19A 1SIUA 2P8SA 3U1BA 1QG6A 3QYFA 3ICQB 3HHXA 1VYUA 2IP2A 2Y1GA 2PS9A 2WSIA 4KQKA 1N2JA 4W6QA 4DY6A 3EOZA 3AOGA 2DLDA 1TYEB 5EINA 1SHTX 4O63O 1USVA 4GP9A 1ORDA 3KUUA 3IEUA 3HABA 3DG9A 1ENOA 4X1KA 4F92B 3MWDB 1SCUB 2CNDA 4ENWA 3OBIA 2E5WA 3U0BA 1CZOA 5ILQA 3W8EA 3P1JA 1JJFA 4E5SA 4X71A 4A91A 1LPSA 1OFTA 1QS0B 4OBWA 1L8QA 2POQX 4U9UA 3CLTD 1Q1AA 4GX1A 1P7ZA 1TO6A 4MRVA 4DBVO 3VYRB 3HWSA 5E8RA 1H1DA 2GLXA 4R40A 1P0QA 4Z2AA 5KTRA 4IVNA 2Z8YA 5CYOA 2G5PA 3K0SA 4PQYA 4CODB 5DLDA 1L5ZA 3BE4A 1I5RA 5GONA 4AJJA 1M8FA 4UKDA 1MC5A 4ZV9A 1XGKA 4O2AF 4TUYA 2JD2A 1L7DA 5CDTA 2GD1O 3EJWA 2FUCA 1BVHA 3IB3A 3T8YA 1V25A 1I2MA 1KI9A 1E2KA 5JNVA 3VPGA 2CNNA 3HJSA 3A8TA 1NMXA 4E2WA 3GN1A 4N0QA 2ZI3A 1GCAA 1T2UA 1M67A 2YZ7A 3T6PA 3MQFA 4OYLA 5ALTA 2A9FA 2R6ZA 3M5WA 4K6HA 4P6VF 3DT6A 3FW1A 3G7UA 2B7CA 1FW8A 2DFPA 3VM6A 3VOTA 3TPZA 3DAHA 2L7IA 3U13A 3ZNQA 5TGZA 1HLPA 3F97A 4ZQBA 2C03A 4P58A 2PT9A 2CDNA 1E6MA 3DUFA 4IUYA 4OUKX 4CCAA 4FYJA 2YS6A 3IUMA 4JLJA 4D4JA 1VBFA 2IU4A 2D7EA 2FLKA 4TSFA 1XVIA 2GI4A 3CRRA 3KZXA 2BR3A 2JLQA 4R9RA 4K0RA 4IW3B 5DLQC 5AW8A 1H2WA 1I7LA 1U7XA 2YR0A 5KYYB 4XJXA 4PDIA 1FFSA 2BDTA 3EWSA 4QVIA