3CFAL

Anemonia sulcata red fluorescent protein asrfp
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
58
structure length
58
Chain Sequence
LTETMPFRMTMEGTVNGHHFKCTGKGEGNPFEGTQDMKIEVIEGGPLPFAFDILSTSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GFP-like fluorescent protein
publication title Structure of Anemonia sulcata red fluorescent protein asRFP
rcsb
source organism Anemonia sulcata
molecule tags Fluorescent protein
total genus 7
structure length 58
sequence length 58
chains with identical sequence M, R, S
ec nomenclature
pdb deposition date 2008-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.40 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3cfaL00
2A53A 3CFFL 2GW4A 2A52A 3CFAL 2A50A 2G2SA 3LF4A 5EXCA 2G16A 2A54A 2G3DA 2G5ZA 3CFHL 2A56A
chains in the Genus database with same CATH superfamily
5BW0B 1V8FA 4G5YA 1UFVA 3CFIA 3IOEA 5HG0A 2A56A 2A53A 3HL6A 3UK2A 4IXJA 4DE5A 3MUEA 1N2OA 3COWA 2A88A 2RETA 3CI0I 2GR7A 3IVCA 3LE8A 4DDKA 2I52A 3IVXA 3INNA 2GR8A 3IUEA 3AG6A 3UY4A 3IMCA 3EMOA 3CFFL 4MUKA 3IMGA 2G16A 4G5FA 4DDHA 3IOBA 3COVA 3CFAL 2A52A 2A7XA 3IOCA 4MQ6A 4MUJA 4FZJA 2IECA 4MUEA 3Q10A 2G3DA 2X3FA 1N2BA 4MUIA 4BHRA 3IODA 2A50A 3CI0K 2G2SA 1N2GA 5G2FA 3COZA 3COYA 2GW4A 3AG5A 3LF4A 1N2EA 2A84A 3IVGA 4EFKA 5KWVA 2A86A 4MUNA 3N8HA 4MUGA 4DDMA 3Q12A 3IUBA 5EXCA 4MUHA 3IMEA 3MXTA 1N2HA 1N2IA 2OGFA 3ISJA 4MUFA 4EF6A 4MULA 2EJCA 1N2JA 2G5ZA 3UA0A 1MOPA 1IHOA 2LMEA 2A54A 3QTTA 3CFHL
chains in the Genus database with same CATH topology
1V8FA 4G5YA 1UFVA 3IOEA 5HG0A 2A56A 2A53A 3HL6A 3UK2A 4IXJA 4DE5A 3MUEA 1N2OA 3COWA 2A88A 3IVCA 3LE8A 4DDKA 3IVXA 3INNA 3IUEA 3AG6A 3UY4A 3IMCA 3CFFL 4MUKA 3IMGA 2G16A 4G5FA 4DDHA 3IOBA 3COVA 3CFAL 2A52A 2A7XA 3IOCA 4MQ6A 4MUJA 4FZJA 4MUEA 3Q10A 2G3DA 2X3FA 1N2BA 4MUIA 4BHRA 3IODA 2A50A 2G2SA 1N2GA 5G2FA 3COZA 3COYA 2GW4A 3AG5A 3LF4A 1N2EA 2A84A 3IVGA 4EFKA 5KWVA 2A86A 4MUNA 3N8HA 4MUGA 4DDMA 3Q12A 3IUBA 5EXCA 4MUHA 3IMEA 3MXTA 1N2HA 1N2IA 3ISJA 4MUFA 4EF6A 4MULA 2EJCA 1N2JA 2G5ZA 3UA0A 1MOPA 1IHOA 2A54A 3QTTA 3CFHL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A53 A;  3CFF L;  2GW4 A;  2A52 A;  3CFA L;  2A50 A;  2G2S A;  3LF4 A;  5EXC A;  2G16 A;  2A54 A;  2G3D A;  2G5Z A;  3CFH L;  2A56 A; 
#chains in the Genus database with same CATH topology
 5BW0 B;  1V8F A;  4G5Y A;  1UFV A;  3CFI A;  3IOE A;  5HG0 A;  2A56 A;  2A53 A;  3HL6 A;  3UK2 A;  4IXJ A;  4DE5 A;  3MUE A;  1N2O A;  3COW A;  2A88 A;  2RET A;  3CI0 I;  2GR7 A;  3IVC A;  3LE8 A;  4DDK A;  2I52 A;  3IVX A;  3INN A;  2GR8 A;  3IUE A;  3AG6 A;  3UY4 A;  3IMC A;  3EMO A;  3CFF L;  4MUK A;  3IMG A;  2G16 A;  4G5F A;  4DDH A;  3IOB A;  3COV A;  3CFA L;  2A52 A;  2A7X A;  3IOC A;  4MQ6 A;  4MUJ A;  4FZJ A;  2IEC A;  4MUE A;  3Q10 A;  2G3D A;  2X3F A;  1N2B A;  4MUI A;  4BHR A;  3IOD A;  2A50 A;  3CI0 K;  2G2S A;  1N2G A;  5G2F A;  3COZ A;  3COY A;  2GW4 A;  3AG5 A;  3LF4 A;  1N2E A;  2A84 A;  3IVG A;  4EFK A;  5KWV A;  2A86 A;  4MUN A;  3N8H A;  4MUG A;  4DDM A;  3Q12 A;  3IUB A;  5EXC A;  4MUH A;  3IME A;  3MXT A;  1N2H A;  1N2I A;  2OGF A;  3ISJ A;  4MUF A;  4EF6 A;  4MUL A;  2EJC A;  1N2J A;  2G5Z A;  3UA0 A;  1MOP A;  1IHO A;  2LME A;  2A54 A;  3QTT A;  3CFH L; 
#chains in the Genus database with same CATH homology
 1V8F A;  4G5Y A;  1UFV A;  3IOE A;  5HG0 A;  2A56 A;  2A53 A;  3HL6 A;  3UK2 A;  4IXJ A;  4DE5 A;  3MUE A;  1N2O A;  3COW A;  2A88 A;  3IVC A;  3LE8 A;  4DDK A;  3IVX A;  3INN A;  3IUE A;  3AG6 A;  3UY4 A;  3IMC A;  3CFF L;  4MUK A;  3IMG A;  2G16 A;  4G5F A;  4DDH A;  3IOB A;  3COV A;  3CFA L;  2A52 A;  2A7X A;  3IOC A;  4MQ6 A;  4MUJ A;  4FZJ A;  4MUE A;  3Q10 A;  2G3D A;  2X3F A;  1N2B A;  4MUI A;  4BHR A;  3IOD A;  2A50 A;  2G2S A;  1N2G A;  5G2F A;  3COZ A;  3COY A;  2GW4 A;  3AG5 A;  3LF4 A;  1N2E A;  2A84 A;  3IVG A;  4EFK A;  5KWV A;  2A86 A;  4MUN A;  3N8H A;  4MUG A;  4DDM A;  3Q12 A;  3IUB A;  5EXC A;  4MUH A;  3IME A;  3MXT A;  1N2H A;  1N2I A;  3ISJ A;  4MUF A;  4EF6 A;  4MUL A;  2EJC A;  1N2J A;  2G5Z A;  3UA0 A;  1MOP A;  1IHO A;  2A54 A;  3QTT A;  3CFH L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...