3CFAL

Anemonia sulcata red fluorescent protein asrfp
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
58
structure length
58
Chain Sequence
LTETMPFRMTMEGTVNGHHFKCTGKGEGNPFEGTQDMKIEVIEGGPLPFAFDILSTSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Anemonia sulcata red fluorescent protein asRFP
rcsb
source organism Anemonia sulcata
molecule tags Fluorescent protein
molecule keywords GFP-like fluorescent protein
total genus 7
structure length 58
sequence length 58
chains with identical sequence M, R, S
ec nomenclature
pdb deposition date 2008-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.40 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3cfaL00
3CFHL 2G2SA 2A56A 3CFFL 2G5ZA 2G3DA 2A53A 2A54A 3CFAL 2GW4A 2A52A 3LF4A 5EXCA 2G16A 2A50A
chains in the Genus database with same CATH superfamily
3CFFL 3UK2A 1MOPA 3CI0I 3IVXA 5BW0B 4MUJA 3UY4A 4MUFA 2A56A 3CI0K 3UA0A 3COZA 2X3FA 3IMGA 1N2IA 5HG0A 3MXTA 2RETA 4MQ6A 2A7XA 5KWVA 4DE5A 2GR7A 3AG6A 4BHRA 3IVGA 3COWA 4MUHA 2G3DA 3ISJA 3QTTA 3Q12A 3EMOA 3IVCA 2OGFA 2G5ZA 3LE8A 3COVA 3IOCA 2G16A 3COYA 3HL6A 3IOBA 4IXJA 4MUEA 3AG5A 1N2BA 2IECA 1N2HA 2I52A 3CFIA 3N8HA 4DDKA 3IODA 1N2EA 4MULA 4EFKA 2A50A 3IUEA 2GR8A 4MUIA 3INNA 2A54A 4FZJA 1V8FA 3IMCA 1N2OA 2A88A 3LF4A 5EXCA 4DDHA 4DDMA 3MUEA 2EJCA 4MUNA 2A53A 3Q10A 2A86A 2GW4A 1N2JA 2LMEA 2A84A 2G2SA 4G5FA 1IHOA 3IOEA 1UFVA 4MUKA 3CFAL 1N2GA 3IMEA 4G5YA 5G2FA 2A52A 4EF6A 3CFHL 4MUGA 3IUBA
chains in the Genus database with same CATH topology
3CFFL 3UK2A 1MOPA 3IVXA 4MUJA 3UY4A 4MUFA 2A56A 3UA0A 3COZA 2X3FA 3IMGA 1N2IA 5HG0A 3MXTA 4MQ6A 2A7XA 5KWVA 4DE5A 3AG6A 4BHRA 3IVGA 3COWA 4MUHA 2G3DA 3ISJA 3QTTA 3Q12A 3IVCA 2G5ZA 3LE8A 3COVA 3IOCA 2G16A 3COYA 3HL6A 3IOBA 4IXJA 4MUEA 3AG5A 1N2BA 1N2HA 3N8HA 4DDKA 3IODA 1N2EA 4MULA 4EFKA 2A50A 3IUEA 4MUIA 3INNA 2A54A 4FZJA 1V8FA 3IMCA 1N2OA 2A88A 3LF4A 5EXCA 4DDHA 4DDMA 3MUEA 2EJCA 4MUNA 2A53A 3Q10A 2A86A 2GW4A 1N2JA 2A84A 2G2SA 4G5FA 1IHOA 3IOEA 1UFVA 4MUKA 3CFAL 1N2GA 3IMEA 4G5YA 5G2FA 2A52A 4EF6A 3CFHL 4MUGA 3IUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CFH L;  2G2S A;  2A56 A;  3CFF L;  2G5Z A;  2G3D A;  2A53 A;  2A54 A;  3CFA L;  2GW4 A;  2A52 A;  3LF4 A;  5EXC A;  2G16 A;  2A50 A; 
#chains in the Genus database with same CATH topology
 3CFF L;  3UK2 A;  1MOP A;  3CI0 I;  3IVX A;  5BW0 B;  4MUJ A;  3UY4 A;  4MUF A;  2A56 A;  3CI0 K;  3UA0 A;  3COZ A;  2X3F A;  3IMG A;  1N2I A;  5HG0 A;  3MXT A;  2RET A;  4MQ6 A;  2A7X A;  5KWV A;  4DE5 A;  2GR7 A;  3AG6 A;  4BHR A;  3IVG A;  3COW A;  4MUH A;  2G3D A;  3ISJ A;  3QTT A;  3Q12 A;  3EMO A;  3IVC A;  2OGF A;  2G5Z A;  3LE8 A;  3COV A;  3IOC A;  2G16 A;  3COY A;  3HL6 A;  3IOB A;  4IXJ A;  4MUE A;  3AG5 A;  1N2B A;  2IEC A;  1N2H A;  2I52 A;  3CFI A;  3N8H A;  4DDK A;  3IOD A;  1N2E A;  4MUL A;  4EFK A;  2A50 A;  3IUE A;  2GR8 A;  4MUI A;  3INN A;  2A54 A;  4FZJ A;  1V8F A;  3IMC A;  1N2O A;  2A88 A;  3LF4 A;  5EXC A;  4DDH A;  4DDM A;  3MUE A;  2EJC A;  4MUN A;  2A53 A;  3Q10 A;  2A86 A;  2GW4 A;  1N2J A;  2LME A;  2A84 A;  2G2S A;  4G5F A;  1IHO A;  3IOE A;  1UFV A;  4MUK A;  3CFA L;  1N2G A;  3IME A;  4G5Y A;  5G2F A;  2A52 A;  4EF6 A;  3CFH L;  4MUG A;  3IUB A; 
#chains in the Genus database with same CATH homology
 3CFF L;  3UK2 A;  1MOP A;  3IVX A;  4MUJ A;  3UY4 A;  4MUF A;  2A56 A;  3UA0 A;  3COZ A;  2X3F A;  3IMG A;  1N2I A;  5HG0 A;  3MXT A;  4MQ6 A;  2A7X A;  5KWV A;  4DE5 A;  3AG6 A;  4BHR A;  3IVG A;  3COW A;  4MUH A;  2G3D A;  3ISJ A;  3QTT A;  3Q12 A;  3IVC A;  2G5Z A;  3LE8 A;  3COV A;  3IOC A;  2G16 A;  3COY A;  3HL6 A;  3IOB A;  4IXJ A;  4MUE A;  3AG5 A;  1N2B A;  1N2H A;  3N8H A;  4DDK A;  3IOD A;  1N2E A;  4MUL A;  4EFK A;  2A50 A;  3IUE A;  4MUI A;  3INN A;  2A54 A;  4FZJ A;  1V8F A;  3IMC A;  1N2O A;  2A88 A;  3LF4 A;  5EXC A;  4DDH A;  4DDM A;  3MUE A;  2EJC A;  4MUN A;  2A53 A;  3Q10 A;  2A86 A;  2GW4 A;  1N2J A;  2A84 A;  2G2S A;  4G5F A;  1IHO A;  3IOE A;  1UFV A;  4MUK A;  3CFA L;  1N2G A;  3IME A;  4G5Y A;  5G2F A;  2A52 A;  4EF6 A;  3CFH L;  4MUG A;  3IUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...