3CFBB

High-resolution structure of blue fluorescent antibody ep2-19g2 in complex with stilbene hapten at 100k
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
213
structure length
213
Chain Sequence
EVKLVESGGGLVKPGGSLKLSCTASGITFSRYIMSWVRQIPEKRLEWVASISSGGITYYPDSVKGRFTISRDNVRNILYLQMSSLRSEDTALYYCARGQGRPYWGQGTLVTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSETVTCSVAHPASSTTVDKKLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords BLUE FLUORESCENT ANTIBODY EP2-19G2-KAPPA LIGHT CHAIN
publication title Deeply inverted electron-hole recombination in a luminescent antibody-stilbene complex.
pubmed doi rcsb
total genus 38
structure length 213
sequence length 213
chains with identical sequence H
ec nomenclature
pdb deposition date 2008-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cfbB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cfbB01
2EO9A 5F6HI 1I7ZB 2EE6A 4GRLA 1EFXA 1NFDA 2VLLB 4OFDA 4BM7A 5L7XL 1OW0C 4IJ3B 5DEGA 1LGVA 2OQJB 3EO9H 2C4XA 2E8YA 5GS2H 2R4SL 12E8H 5I8EA 2O5XH 5DHVA 5FCUH 5GQBA 2CKBL 1YNLH 2GCYA 4HLJA 4HKJB 1RZ7H 3GSNH 2XZCL 1GOFA 4OIIL 5I30H 3OKDB 5TGBB 4ZG1A 3FQXB 3SGJA 2OK0L 1J05A 1RJZA 4J3OC 1XCQB 2NTFA 1FO0L 3MLRH 3SKOB 3CX5K 5KJRH 5MI0C 1I4FA 3O3DA 2EKJA 3WUWG 2EXYC 3VXUD 1IM3A 4RGNB 4I9WD 1N8ZB 4LHJB 1V05A 1NSNL 1AXTL 3P73A 4HUXB 5DZLA 1B2WL 5TQ2H 3VXTB 1X5IA 1RULL 5ILTH 3OB0K 3RP1A 5DD6B 3DVFA 3MRNA 1RZFH 3ZKMC 3DWTA 2V17L 4ERSL 1SBSH 5CHNB 3MRKB 1D6EB 2HLAA 3NZHH 2DBLH 1J0YA 4NQXB 1V3JA 4IBLT 3EYUH 3BQUA 4ZUWB 4YDVB 2D31B 4JFFA 4U6VL 4DKEL 4EIZC 2WBJA 3HFML 5HYJE 2EDEA 2VOTA 1CD1A 1MHCA 3PV7A 1F02I 3HG1B 4ZTOL 4NBZB 3AS1A 3UYRH 3SJVD 3AXLB 2MSPA 4UDUB 3RAJL 5I75B 1AI1H 4XH2B 4W4OC 3UXFA 2DQEH 3O81A 4XC1H 4RGMB 3C6LB 3UTZB 4NCC2 1BWWA 1SJXA 1AGEA 3I2CL 4OLVH 1FC2D 2WQRA 2A83B 5D2LF 3W2DL 4F7MA 3HE6B 1X3DA 1Q9WB 3C60B 4X4YA 3ZKND 2WIIB 4YO0A 1XGPB 3GRWL 2COQA 3VFGH 2FX8H 3VXMA 5J0BA 2J12B 1A3LH 1WITA 3BYYA 2HT2D 1UFUA 1JZ7A 4IRSA 4V1DE 3T08A 1NGXB 4K7FA 1YEHH 2DTSA 3QNZA 5ICZA 4O58L 4Z76B 3HMXA 4UT6L 1T0MB 2CSPA 4FRWA 5IMKB 5IHZB 3D2UB 3ZYIA 1EV2E 2Z0BA 1F6AA 4G8GD 1DBBH 1EZVX 4GAYA 1P2CA 1JPSL 1JF5A 1H3XA 3DVGA 5EORL 5IMMB 1R24A 2HLFD 4XWOC 1KCSL 3TT1L 1ROWA 5J89A 2H2PC 2YMXH 1RZKC 1CICC 4QF1B 4UILL 4XCCL 2IAMC 4DGYH 3ZT5A 3NFSH 1KJ3L 2VLRA 3ZDYF 2BCKB 3CSYA 4BSJA 3B9VA 5C0GB 4LVHB 1NLBL 1U91A 3UBXG 5MEOA 4PGDA 5BJTA 43C9B 1MCHA 5E5MA 3PGDB 4HQQH 2EH8L 3TWCL 4Z95H 3IGAA 1SY6L 4LIQH 5I1IH 3SQBA 1SJHB 2DQIL 4NC1E 4QTHA 2OI9B 2G60H 4LLVA 5FK9A 1IAKB 5C0EA 5GZOC 1S7QA 5F9OL 2D0FA 1KB9J 3QUMH 3RIAK 4XCFL 3RKDC 1Q9OA 5KN5A 1QFHA 3FT3B 4Y88A 1A14L 4HK0B 1HZHL 1U8KA 3MRQB 4GKSB 1FH5H 1R3LB 5ALCH 2DLTA 3U6RA 4B50A 3UROR 4L29A 3B9KB 4J4PC 1IM9B 1BZQK 5GSRB 1JPFB 2E6JA 5E08L 1VGEL 3HNVL 4OUUB 5HI3C 5I17B 1N7MH 4J4PD 4EI5B 35C8H 3VRIA 3B6SA 1E6OH 1F8TL 4LLUB 1JHKL 4JY6A 4CN4A 2MHAA 3ROOB 2YZ8A 3VRJB 5TFSH 3CZFA 5IW1B 3VFWA 4BSVB 4ZSOE 4MJ5B 4L4JA 3K4ZA 4FTVD 2MQ0A 4OCWL 1OM3L 1CF8H 3NZ8A 3D6GA 3INUL 4HGWB 1DVFD 2QQKH 2XA8H 4AH2B 5JQ6L 3QIWC 5JHLL 3TYFB 3F8UB 1LILA 5D6CA 1KJMB 3QDJE 5D5MB 4WWKB 2DD8L 4F33A 3A67H 4QXGL 4LSSL 1EJOL 4R96A 5I19H 1UGNA 4XPHH 3MRGA 4RAUB 4XP4H 1A21A 4AM0B 3L5JA 2BK8A 3LQAL 1WC7B 1YDPB 2KBGA 1IAIM 3OPZH 4IHOB 1JCKA 4KK5D 4U7KA 1S7RA 3UTTA 2FHBA 4CVXA 2F5AL 4PS4L 4TNVK 4LNRB 3TT3H 3ARBC 3VWJA 2XQBH 4LRIC 4RGOL 1J1PH 4HK3J 1D5IL 3DV6A 3UJJL 2F15A 3G5XA 3ZTNH 3NABL 4U1SA 2V6HA 3OKKA 2I24N 1DLFH 1A6WH 1NGWB 4PRHD 4WW1A 1CD8A 7CGTA 4XNYL 3VG0L 5E2VH 4EN3B 4JR9L 3DGGA 4KQ3L 5TH2B 4E42A 2IANA 4OV5B 3BGMB 3P0VL 3DUUA 4WJ5B 5HYQB 1A7QH 5CIPA 2AQ1A 1WAAF 4GRLB 5MEND 2Q3ZA 2ICWJ 5E4EB 5DC0A 4P5TC 4FFVD 4QRSB 1FFPA 3GHEL 4GSDL 1EK3A 5DUML 2CIKA 3EO0B 2WAHA 4RX4A 2YUXA 4LQFL 4OLYH 4WHDA 3GHBL 3ZSSA 3IAGC 3RGVA 1J8HA 2QADD 2MOVA 2RGSA 5F96L 4I3SH 2IPTL 3FQRA 3MROB 1Y6KR 5J13B 5I8EB 1U8HB 4IDLA 3VH8A 5C08D 4NNYA 5I66A 4IJ3C 4HAGA 4XNXH 3HCVB 1WLHA 3VCLA 1J05B 3VRLE 4LLDA 5D2NE 3HLAB 4ZOAA 2HT3D 4OSUH 1J0HA 1HINH 4HS8H 4NQEB 5C0BE 2RBLA 5IHLB 4XI5C 1IGFL 2Y07H 1QSZA 3LKQA 5DMIH 3MRRB 5CGYD 1F11A 5EU7C 1IM3B 1GIGH 5FM8A 4OF0A 2B7DT 1HXMA 5DD0H 3B2VH 4J8RA 5GRJL 4HH8A 4ODTH 2W91A 4BQ6A 3WS3A 4DVRH 5AZ2L 3ZL4H 2A74A 1IJ9A 2YA2A 2FGWL 3TO2B 1UKSA 4KC3B 3BQUB 4XNMA 1GOHA 4RGNC 5ECJE 1W0VB 2WBJB 2PTUA 2CR6A 3K8MA 1F4YL 2CLRA 2X4QA 2JJUA 2D7TH 5F7DA 3CMOL 4Z7UB 2XN9B 4U6YA 3U9UB 4JN2A 2EEDA 1ZTXH 2WP3T 3G5VA 3QUYD 5DF0A 3WYRA 4YXKL 1YEJH 3ZZ1A 3MUHL 1CK0H 1A7BA 4L1DA 1UH3A 4WU5A 2PW2A 4JO2L 4I18A 1AGEB 3MV7E 3VXOB 4TRPL 2ATKA 3VFTB 1QSEE 2IPUK 5K9QI 5J11B 1H9VA 2BNRA 4PJCA 5CBEA 3HG1D 2DWDB 5I75C 5IJKA 2DJSA 4ZS7L 1BLNB 1GHFH 1CTOA 1N6QH 3PWPD 3C6LC 4RGMC 3JTTB 4WY7L 3HAEH 3TLRA 3WSQH 1AO7B 2AJSH 3TF7C 3SQOL 5IVXB 1HKLH 2YPLB 3HE6C 6FABH 3C60C 4K7PL 4M6OL 2YUWA 3J8F7 4K94H 2X9WA 4X7EC 4PD4J 2FHCA 5ICZB 3DYMA 4H8WH 4UUJB 1XT5A 5EO0A 2JELH 4XMPH 2CMRH 5AYUH 3TZVA 1WK0A 3MC0A 3FB7A 5IFJA 3WCYA 4TVPD 1CT8A 3N1PC 3L9RB 3N9GL 4PRNA 3D85B 3P4MA 2AJ3A 5J1SC 2APWA 1F6AB 4O00A 3TJHC 4U1NA 3O6LL 3H0TA 3QHZL 3VGHA 1MJJA 1KB9K 1P2CB 4HKXB 4FQ1H 2IH1A 3DVGB 1TQBB 3PWNB 1AXSA 4XX1G 4NNXA 1MEXL 5F8RC 1TVHA 1MCLA 4WHTA 1DTUA 4WUUB 5IOPB 4MYWB 2R29H 5CEYA 5DURB 3BZDA 5J4MA 4M7LT 4UQ3B 3D2UD 2GSGB 2EDJA 2GHWB 2VLRB 5B3JE 5GRVK 3PQYE 3KPRD 2ZCLL 5GJTH 5D1XB 4OZ4A 1GZPB 1UVQA 5BJTB 5C2BL 1OCWH 3MA7A 4MXQC 4AL8H 3IGAB 4NBXB 4NKDA 2DQDH 3KYKL 3VFSB 1OSZA 4HUMB 4UTBL 2FL5A 1QLRA 1S7QB 3LPGA 3ARPA 3O4LE 4U6TA 4FXKA 1AGCB 2LAAA 4LVHC 1W8OA 3DX8A 2DQCL 4ACPA 5HI5C 5I16A 4XBGB 5CGTA 4R7DA 4HPYL 4I1NB 4L29B 3RRQA 3W9EA 1CS6A 2OI9C 1RVFL 4H5SA 4MNGA 4PRDA 2DMBA 4OZGA 5I0ZA 2VDPH 3QEHA 1CFNB 4ZUTA 4HK3N 4XBPA 1P7HL 4OZHF 2RHEA 5E95B 4KZDH 4RAHA 2MHAB 2UUDH 3LY6A 4O2EA 4X5WA 3CZFB 5IKCA 4LCWD 3VXUA 3VFWB 1JNJA 5ADOH 1VFAA 1KEGL 3B9KC 1LEKA 3BZFB 4QTIL 5JORA 3B9KD 4EI5C 4NRXB 1X5JA 3H6JA 1DCLA 1I9RH 4EI5D 4MNHA 4YHML 5D6CB 1T2QL 1YY9C 4R96B 3BGFB 5IQ9B 1YY9D 3MRGB 1PLGL 2I60H 2VDKH 5C71A 4KI5C 1G6RA 4OFYD 4LCCA 2JK5A 4KZEH 1CDCA 4P2OA 2VZSA 3QPQD 3RWEB 1CBVH 4Z7WA 4XP6H 5IGXL 1S7RB 4XHQA 4LKXB 4N1CA 3SJVA 1Z2KA 3OGCA 5EOQH 1NBYA 3JWDC 1JV5A 4WWKC 3VWJB 1A1OA 5DQ9A 2FR4A 3RHWF 4JDVA 5I8OL 4EJ1C 1INDL 4Z6AT 3L95B 4LBEA 4ALAL 3CVHH 1A7PL 1LP9F 3QNXA 2BY2A 4WW1B 2OZ4H 1YPZE 4WI9A 3EJZC 2KH2B 3UTQB 4KI1A 4ODXB 5DUPH 1HQRA 2IANB 5AUMA 1PFCA 3QHFH 4NCC1 3GNMH 2W65A 4YHZL 5CIPB 5ANMB 3SE9H 5C0FB 4GLRH 1QFPA 4QNPE 5CILL 3S35L 3P11H 4TUJB 4B7IA 2FX7H 3EDJA 1BD2E 3TV3H 2CIKB 1MCFA 5EU6A 4PJGE 4FQ2H 4EN3C 3PXJA 5DEFA 4M62L 3P9LA 1HHJB 5IBLC 5BVPH 3T0XA 1IEHA 4JO3L 4R4NC 1F2QA 5KZCD 2Y36L 3BT2L 2OSLA 4G6AC 4GRLC 1H3PL 4UV4H 5E4EC 3VH8B 1SJEA 4F7CA 4G6AD 3FN9A 5I66B 2NY5H 1EMTL 4NQUA 2PCPB 3O6MH 2XWTA 1L4IA 4W6YB 3VCLB 3WE6B 5J13C 1URLA 1J7VR 4RMSA 1NC4B 3UP1A 4BZYA 5CD5C 4L3AA 3H9SE 4LLDB 2VDNL 4MDIB 4MWFA 1CXIA 1R0AH 1UACH 2VXSL 2CKBA 5IVZA 4HZLB 1T04A 1JNNH 3CFKA 1XGUA 1XF5A 3MO1A 3U30B 3WFBL 5T5FH 4AMKL 1FL5A 1U93A 4FQIH 4E5XB 3X11A 2Q6WB 3TP4A 4AG4L 1AY1L 4U0QB 5F7EH 3RU8L 2H6PA 4JAMA 4LLYB 1GJIA 3R0NA 1RHHA 4HIEB 3Q2CA 4J8RB 5L2JA 3WS3B 1MF2L 1QLFA 4EOWL 3O45A 2NZIA 1CE1L 2A74B 4RA3A 2XT1B 1JGEB 4NQED 5I1HH 1OGTB 5FDYA 1TETL 5EBWA 3NIGE 2E7MA 1CFSB 4AQOA 2DKSA 3VI3E 4LSVL 2BNUA 4YHKL 2J4WL 5CEXA 5TQ0L 1QKZL 2F19L 1T89C 3FFCD 4NQDB 1KJ2L 1I8IA 4U6YB 2AK1H 1D6VL 3G5VB 4Y2DD 3HC4H 1JNHA 1NMBL 5E00A 3VDAA 5I1AB 3BQUC 4FFYH 4ZYKA 1C8PA 5ID1B 5C0AD 3UYPA 3PL6A 1WZLA 2PW2B 2WBJC 3VFPB 1KCVL 1E4XH 1VGKA 3QRGL 3V0WL 2P5ED 3MZTA 4FTVA 3SDAB 4X5XA 5EO9B 1DVFA 5M7QA 1E6JH 2AEQL 15C8L 1KCRL 4M00A 3VWKD 1XGTA 4XPFH 4LCIL 1IAMA 3CMGA 4JRXE 1T7ZA 2UUDK 2ITDA 2NY1D 4P5KB 1JBJA 5D1ZB 2BJML 2P24A 3QZWA 5J11C 1AP2A 2EXWD 3CSPA 2Y1VA 1A5FL 2CQVA 3OJVC 2F53A 2J8UE 3DVIA 3ESUF 1F42A 3VFRB 5DWUH 1A7OL 4PRNB 5CUSH 4AEIL 3P4MB 4WO4D 4U1NB 1RK1B 4YAQB 2MCPL 1A1MA 4RAVA 1MLBB 3SKJH 5J8OA 2IH1B 3C08H 2X6MA 3C09B 1AXSB 4PJFA 4ZTPH 3CLFL 4QHUA 3DECA 3EYQD 4QOKD 4NNXB 4M8QB 1LWRA 4FHBD 4PJ9A 4M5ZL 3MXWH 3NCYS 1IC7L 5CEYB 4GXVH 3DMMD 1ACYH 2AEPL 3OKNB 1FL6B 5E8OA 1NH6A 3DROA 4CVZA 1JF1B 3C5JB 2FX9L 4OZ4B 1TQBC 4UIKH 4Y8DC 2XWJB 3F7RA 3MLWL 1JHLL 3SPVA 3MA7B 4X9BA 5E8DL 5KSBB 4NKDB 1CD0A 2WUBH 5GGTH 3TNNB 2CUIA 3VGBA 4BQCA 3EDEA 3SE8L 4Q9QL 1CDJA 1OSZB 5FDWA 3MR9A 2FL5B 4BK5A 5JUEH 4G42A 4PG9A 1HEZA 3B5HA 1MUJA 1P4LB 4I48A 4HWBH 4PJ5E 2X4TB 1IEBA 5C08A 2CKNA 1HWGB 3L3JB 3QO0B 4N5EC 5D1XC 5DI8A 3KYOA 4XT1C 1ZHLA 2AERT 3D69A 3QXTA 4WCYL 1X5LA 2CRIA 3I6GB 5DFTA 4MD4A 1SY6A 2CDGA 4OZFH 4ZUTB 4KJQC 4YHNB 3RWDB 1ZGLA 4GAGL 5CSGA 4ZPVA 25C8H 4PV8A 3MV9D 3VG9B 4X5WB 5IKCB 4K7PY 4Y5YB 2ZCKH 5GZND 4K3JL 1DFBL 4P59H 3SO3B 5SV3A 1RZJC 1CG9B 3KPLA 1JRHH 5JW4Q 3PGCB 1DQJA 4NFCA 1X7QA 3BE1L 5H35B 3KS0H 2XPGB 1B4JH 1R3IH 2LVCA 1FYTB 5I0DA 2ZJSL 3TBTB 2YBRA 3WFEH 2JK5B 4P2OB 4QWWC 5DJ6A 3EJYD 1GGIL 4Z7WB 2QBWA 4H20L 3QG6A 3UO1H 3O41B 1CR9L 3GBNL 3OGCB 1S5IH 5D9SB 1QLEH 4BFGA 3QUYA 3QBTB 4MNQE 1MRDH 3BGFC 4OI8A 1RFDL 5DQ9B 1YEGL 4JDVB 1M6OA 3NAAH 1M1SA 1D5ZB 4GKZB 3WFDH 2VDMH 2XZAH 2EE9A 4GBXD 1ERNA 3KHQA 5GGSY 1ZLSH 1ITBB 1N4XH 4LAJH 5KSVA 3ZYZA 5ESVA 4RBPH 4JG0H 1DQML 5AUMB 1IAIL 5DC4B 2C3WA 2W65B 3VWJC 3EYOB 4K3HA 1KFAL 5D7JB 3K2MC 3PWPA 2NY3B 4ETQA 1KYOK 2QQNL 4D94A 1Z9LA 4OD1H 1BZ9A 5EU6B 3DLQR 5HHNB 2PTTA 4N0YL 3CXDL 2LU7A 3SE3A 5MEPA 4XHJC 4EKXA 3VFMA 4XB8A 5GSVA 3KLDA 1N0XH 5K9KB 1EXUA 1QOKA 2UYLA 2XG4A 1C5CH 4M1DH 1NEZA 4OV6F 3VRLF 5EC1A 3WDIA 5DJ0B 4JFDB 7FABH 2B1AL 4JJ5A 3TH4T 1D5MB 1UQSA 2FLBT 3H42H 1UEMA 2YXMA 4JPKL 2AI0L 2CKBB 4HXAH 3IDMA 1NBZB 2EC9T 4KK8D 3LN4B 3CFJB 4PLOB 3ARZA 1RU9H 4ZPTA 1XGUB 5E9DA 3ULVC 2HTKD 4MZ3A 5D70L 3G6AB 3ULVD 3KPRA 3D1MC 4HT1L 1A7NL 1C7TA 1U95A 5E2JA 2X7LA 4JAMB 2ZKHH 4D9RD 5FO8A 5L2JB 5DLML 1OQXA 3O45B 3VH8G 1FAKT 2W92A 2F8OA 4GUPA 4ONFL 1FO0B 4Z0BL 4ZFZB 2HVJA 3PJSA 3D39D 3M8OL 3QULA 4LSQL 3U30C 3TH2T 1L6XA 1HCVA 3I75B 3OZ9H 5DJAA 2ILLA 4F7EA 2FJGB 3NFNA 1HIML 3BSZL 5CEXB 1RMFL 2I9LB 4JCMA 4OGXH 1DP0A 1IZKA 5JR1H 1K6QL 1QBAA 2DLHA 3VXRE 1I8IB 1WZ1L 1QPPA 3IFNH 2HTLD 3ULUE 1F4XL 2HRPH 4OAWA 5E00B 5LAXB 1FNSH 2C4FT 5K93A 1LEIA 1BFTA 3O6FB 1FG9C 5D1QD 1MFAH 3X3FH 4A2LA 2GTWA 3BZEA 3GMOB 3GJFB 3GK8L 1RZGA 2MWCA 1KC5L 5FO7A 4HMCA 2ZCHH 4N0RA 1CWVA 1XGTB 1Y18A 3RPIA 4CBPA 5FYJH 1M71A 1OTSC 2BSTA 2ITDB 1N64L 1YJDH 3UTSA 1SVCP 3NIDF 1MPAL 3QZWB 1WISA 3RWCB 4Z78A 1YYML 1AP2B 4LLQA 4OFYA 3UDWC 2YRZA 3WIIL 3GMMB 1QG3A 1U3HA 3SDAC 4QRRD 5GS3A 3GZKA 2FO4B 2F53B 2K7QA 4XVTH 4AQ1B 2FO1A 3ARFD 3VGGA 3V4UL 1GGBH 3CDCA 3PIQB 1OWRM 4Q2ZA 2C3VA 1U8JB 1X5FA 3JV4B 1IQWL 5D1ZC 5DA0B 2BOBA 5L2KD 4JFXA 2VZ1A 1KCUL 5FKPA 3V4PH 4TSCL 4UT9H 4MX7A 4RAVB 1NDMA 3EFDH 5CAYB 1KB5H 5EO1A 2H9GB 1KBGL 3OKMA 4EIGB 5B3JF 4TVPH 4PJ9B 3I02A 5EA0L 1FDLL 2X89D 3CCHB 4XNQA 4OGAD 1VFBB 4PJIE 3S9DB 5E8OB 4E0RA 2Z93B 3S5LA 4CVZB 3ARGA 5F9AC 1EEYA 3KPNA 2BVQA 1FG2B 1O5DT 4TOYL 3RNKA 1YMMB 4YDIH 2HKHL 3UPCA 1FVDB 4S1RL 3C09C 4UMGA 3EYSL 2LVEA 4KXZH 3RKPA 2AABH 1S9WA 1U8MB 4KHTH 2XIDA 2VXTL 4K3GA 2HH0H 1UM5L 5IJVA 3LIZL 4RBPK 2YR3A 2JF1A 5T1KD 1QBBA 4G42B 5KSAB 3CFEB 1F4HA 1MUJB 4OB5L 1K8IA 2BVPA 1T03H 1ZV5A 4I48B 3EW3B 4Q6IA 2ORBH 4MHHG 3LPWA 1JWSA 3D69B 3OJDB 4QO1A 1OAXL 3HRZA 2R1WA 4UOJA 1ADQH 3M45A 3MNZB 1KT2A 4MD4B 4QXUH 3DSFH 5DFWH 1IKFH 1CFQA 2LU3A 4FZEH 4O4YH 1FNAA 3F62A 4JVPA 1G6VK 4P2CG 3WV0A 4PV8B 3MFFA 3UAJD 2MPAL 3RVXD 1XIWB 4PV9A 5L8LB 3KPLB 3LKSA 1YEKH 4KTEL 4KJPD 1IMHC 5IIEA 3SGEH 1G7QA 3A0OA 5IB4B 1PX3A 4NM4H 4YDKL 3HUJE 3FT2A 5TDNA 1EHXA 3VG9C 4Y5YC 3SO3C 5A1AA 5C09A 5ACMA 2E9WA 4WFFD 1AGBA 4Q58C 3ZKQD 1TNMA 4NM8H 4G43A 3FFCA 1UYWL 1IARB 2VISA 32C2A 5F9JA 4H0HB 4Y2DA 5CLWA 2HFEB 4P9HH 2VAJA 4XCNB 1OSPH 4CKVX 1M6OB 1TCRB 2AXFA 2MNUA 1YPZF 3PWVA 1I1CA 3QFJD 5C0AA 4TPRL 4UNVA 3RFZC 4LLAA 3SDYH 3A6CH 4P2OC 3S34L 1HHHA 4JPIB 2DQFA 1I7RA 1TZIA 5J12B 2P5EA 4F37K 5KSVB 4QNPF 2HJFA 3FO0L 3TN0D 4XP1L 4K9EL 4HD9A 4N8VA 5T3ZH 4PJGF 5E2TH 4ETQB 4K23L 3S88H 3G04B 2OR9H 1R5IB 1G7LB 1BZ9B 1G1YA 1NGPH 3V6OC 2EDNA 1KTDA 1T2JA 3GMPA 5MEPB 4P3DB 5ITFA 4LIQE 5D7JC 3VFMB 5GSVB 2ZP0T 3EO1A 2O61B 3F7PC 2NY3C 5FHAL 1WZMA 4E41B 3LCYA 2JJWA 2ZZUT 3FB8B 4J6RL 5BVJB 2VNCA 3NGBB 2GI7A 3G6JA 5EC1B 2XNAB 4I3RL 4WO4A 1HYSD 1W8NA 4ZNCD 4ZD3H 3BP5B 2Y06L 1WVZA 1MREH 4LLWB 2HVKA 1NMCB 3GBML 4QOKA 4UINH 4PRBA 2XRAH 3ZSTA 3QCVH 2H32A 4WFHE 1LP9E 4F2MA 2D4FA 3VXPA 2Y25A 4ZPTB 4JFFE 5E9DB 3DMMA 1AE6L 2XXMB 1FFNA 1AJ7H 4P99A 1YEEL 4JFDD 4KAQH 4DGIH 4NHCL 5HI4C 3NIGF 4U1KA 1UJ3A 3QUZD 5CWSA 1H15B 5DMGC 3VI3F 4HXBL 4U1IB 2P5WE 4JGUA 3PJSB 4NJAL 3QULB 2VZUA 2F58H 3WFZA 1U6AH 4JQIL 5JLZA 2YPKB 5DRZA 4MQXD 1XR9A 2GITA 3GSUA 4NKOB 3SCMD 3VMPA 1XH3B 2PW1A 4MJIE 3U0WH 2C7UA 4RIRB 4YR6A 3CNKA 4F15B 3MBXL 3OV6A 3FB5A 3RTQD 3AMLA 1P1ZA 3HC0B 1AKJA 3GKWH 4LU5L 3AFLA 3BZEB 3QPXH 4GS7B 4PP2B 3BD4A 3RGHA 2I27N 4PBXA 1JWUB 4M43L 4QHNA 3MOQA 1TZHB 5F3HA 1DBKL 3QXAA 4NC0B 1BQUA 1KJ2A 4KMTL 5FO7B 2D0GA 3S36H 4M02A 3NCMA 3WIFB 1ZWIB 4YBLB 2AXGB 1M71B 3NFPB 3O6FC 2BSTB 4HHAB 3UTSB 4ONOA 2LU4A 2J8UF 4JFEE 5J7CC 1I9JH 3BWAB 3RUGA 2YWZA 2UWEA 5IHUL 1MI5E 2DQUL 2WUCL 5C8JA 1WAAA 5DVOA 2FIKB 4IDJH 1DSFH 1LE5A 5AG8A 5KANI 5C0DB 4O9HH 3TGXA 3WO4B 4YDLB 4Q2ZB 2C3VB 2FJHB 3NH7L 3P4NA 2EDYA 5BO1L 1XGYH 3V6ZB 3BXNA 5D7LE 1W72L 1T1ZB 1LO0L 4JO4H 1NDMB 4NUJA 1CLYL 3SKMB 1WFNA 2IADA 4L3EA 5EO1B 4ZUUB 3MCLL 3OKMB 5EOTB 3R1GL 2NXYD 5IB3A 1JPGA 1FE8L 2MQ3A 3BRGC 3RWJA 4GW1A 4PRIB 1BX2B 1NGYB 4IS6A 1UZ8A 4R8WH 3U82B 2W0PA 1DBJL 1SBBA 2X42A 3MPCA 4W68A 2NNAA 3HI6L 5I1KL 3QZWG 4KKAC 3S5LB 3ARGB 1NKOA 2FEDD 1D7FA 5E94B 4YQXH 4N0UA 4GG8A 4KTYA 2JB5H 3R0MA 3RNKB 2VL4A 3P4LA 1AIFA 1BOGA 5JNYB 1S9WB 1LEGB 3WIHL 1CFTA 4PJ9C 3V8CA 3RVWC 5GGVL 4G7YH 4NFDA 3U9PH 5IMLB 1DEEA 3BN9D 1YYLH 4EI6A 5ISZE 5HYSB 2DLFL 4ZO7A 4HWUA 4Y19E 5FM5O 4Q6IB 3ORJA 3DURB 4OLZL 2IFFH 1JWSB 4BH7A 1QRKA 3BPOB 4IOFC 5IFAL 5EZLA 3HRZB 1JL8A 2WLZA 5GGSB 2AXJA 4J1UB 5DRNB 4L4TA 5GIRA 1RUKH 5KSAC 1NAML 4L4VE 2XXCB 2BXYA 1U8OA 3BVNA 3ILQC 1JMZA 5IBUB 5IB1B 1A4KA 3MFFB 4YE4L 2BMKA 2X1QA 4FFZH 1P9MA 5IR1B 1JVKA 1NC2B 1R3HA 4RQQB 1P4IL 1FVCB 3SOBL 2QQLL 3LKSB 3UTTE 2E7LA 5HHOA 4GW5A 4W6WB 3MJ7A 4FQXA 5D2LB 4Y1AB 3EHBD 1XIWC 3D39A 4ELMA 3MJGX 3U2SA 3MNWA 4LP4A 5A2JH 3VD4A 1S9XB 5C09B 4P4RA 3QEQD 1AGBB 1F97A 1H3GA 3U0PA 3CIQA 3UJTH 4JRYA 1H8SA 4F58L 1RZJH 3IT8D 4NSKA 1HYRC 2VISB 32C2B 5HHME 3K8KA 3O9WD 3U4BH 4BZ2L 4I13B 3PWVB 4F9LA 4H26B 3X17A 2R8SH 5D8JH 1PSKL 4NZUL 4KDTA 4PRPD 2XY2A 5JXAL 1IGIL 5BS0B 2HYMA 3UPAA 2DQFB 5D1QA 3L5XH 2LQRA 4Q0XH 5JDSA 2X09A 2HJFB 1Z6JT 1IAOA 5B38B 4PJBA 4EVNB 1IGCL 3SDDB 4N8VB 5FYLH 4JHAL 4FA8A 1MHHA 1LMKA 4KDVA 1I75A 3B8YA 1A8JH 1MJ7H 5C07E 2ZWLT 3KLHD 3KPOA 1VADA 3LQAC 2ZPKH 4O51B 5J12C 1A0QL 4PR5B 1I3GH 4GRWH 3P30H 2F54B 3L3GA 3M17B 1KTDB 1PKQA 5F71A 3FQTA 2ZUWA 5SWSD 2EDOA 4PJXE 1A7RH 4LGPB 3EO1B 4GQ9H 3MNVA 3C5ZA 3GMQA 4OGYL 4NQCB 2Q7YA 3HS0A 5ESQA 1MLCA 4JB9L 4KUCD 3V0VB 2IG2H 1MHPL 4MXWH 4S0TD 3SE3C 2W9DL 4OI9A 3VFUB 4WGWB 2HVKB 3MLVL 4C83A 3V52L 1OB1B 3BUYA 5J57B 3CDGB 2AV1A 4HX1A 5BOPA 1A6VL 4HBQA 1WWBX 4PB0L 4XP9L 3HC3L 3NGBC 4IIQB 4K71B 2EE2A 4E41D 1C1EL 3MRJB 2PXYD 3ESVF 4MLIA 4XP5H 3NCJH 4HPOH 5IFHL 1S3KL 1KXVC 3QI9A 2QHRL 5BRZA 3K3QA 1FRGL 5I1JL 4NOFA 5IW6A 1UB6A 1NMCC 5A43C 4OZHA 3VU2A 3TC9A 2GSIB 4CU6A 2V5SA 4HIJB 3W0WE 5MHSD 3F58L 4URTB 5I8CA 1NEZG 3DIFA 4IRJA 4PJHE 3MLXL 5JXEA 3H7LA 3O8XA 1JNLH 3BJLA 2VLKE 3ULVH 3ULUF 1CXLA 1NMAL 2BNRE 4JDZA 2GITB 1D9KD 2HKFH 2ZUUA 1Q72H 2C7UB 3TIEA 4YR6B 2HG5A 3UC0L 2A6IA 5IHBA 3PWLA 4U2ZA 3FB5B 4M7LL 1P1ZB 4LSUL 1NCCH 3MGTA 5D7SL 5F7HA 3S98A 2KKQA 4DK3A 4Z7QE 3V5KB 1CLOH 5I8KH 2A6JA 3O2WL 3R8BB 4MSWA 1KJ2B 4JGJA 5SWZD 2X4UA 4EUPB 4F15C 3OR7A 5J6GA 2XOTA 3I50L 4KHXL 4JM2D 2YKLL 4Y4HA 2Y6SC 3AS2A 3EDKA 1KIUA 5ICXB 1NBQA 3WD5L 2EH7L 1LP9A 1G0DA 3GSVA 1NBVH 2DM2A 2R23B 1T20B 2H8PA 4GS7C 2FZ3A 1QFWH 3MLTB 4P46B 4G5ZL 2HJKA 4H0GA 5C8JB 3CFCH 3B9AA 4CADA 3C5SA 4FQPA 1DEDA 4JZNA 4YUEH 2BX5A 4TNWF 4YBLC 2AV7A 1N2RA 1NGZB 1DR9A 4QRUB 3P4NB 1J0KA 4OKVB 5ALBL 3HZVB 3BKYH 1Y0LB 4XCEB 3MRMA 5GS0L 1NCWL 3KHOA 1KENH 1RK0A 4G8EB 4L3EB 1C5BL 1EPFA 3H3PH 3QDGD 4PJIF 3MUGB 5DJCB 5IB3B 1JPGB 4R90L 5KVMC 4G6JH 1UM6H 4GW1B 3WO4C 4WI3A 4YDLC 4P2RB 1VEOA 4P2YA 2HAZA 4LKCA 1MRFL 4JFYB 3BP4B 4YHOH 2ITCA 4YPJA 1A1NB 1QACA 1I8MB 4W6XB 3BAEH 5EWIH 2EIZA 1IEAA 4TNVF 2IBBA 5BW7A 3GO1L 1UB5A 3ELAT 2Z4QB 3LMJH 3CDFA 2D7OA 4Z7VA 3BYTA 4LPUA 1DBAH 2RFXA 3KLSA 4PRID 4L8CA 2DQGH 5HVWA 3ZYJA 4EI6B 3ARGC 2FBOJ 3RWFA 3FMGL 1KG0B 3B9EA 5CP7A 5FUZL 5J9PA 1UC6A 3VXUE 3RZCD 1JK8A 4I9WE 2EEAA 3QT2A 4MXVE 5C6TH 5EZLB 3P9MA 3C2AL 3TBWA 1YEFH 1AQKL 1JZ3A 4FQJL 4L4TB 3BHBA 3I6KA 5HYJA 5GIRB 2VABA 5E6IA 3S5LG 1RUMH 1X6NA 3BVNB 2FATL 4Q6IC 3L7EA 4HSQA 1H0DA 3GM8A 4HKZA 5CD3A 1A4KB 2DN7A 3BPOC 3NIFF 4M5YL 4Z7OE 1EO8L 3QXDA 4HCRA 4KJWC 3IFOA 2JCCB 3V6FA 3GSRA 5I1LA 3HUJF 1JGDA 3DETD 3SJVE 5LBSL 5HYSG 4KMQA 3FCTA 1OP3H 3TJEL 3RIFF 5DQDL 4ZS6C 5HHOB 2DDQL 2EDXA 3NBNA 1RIHL 4HAFA 3MJ7B 4FQXB 5LGHH 1T5XA 5EBGA 3MNWB 4PUBH 5KOVC 2VDOH 2IEPA 3BP6A 1BD2D 4XAWL 1S7VB 4ODUB 2R0KH 1NFDF 1B90A 4V1DA 1KTRL 3SCMA 4X9FA 4YWGL 4DCQB 5IBUG 2P8MB 2WV3A 3HA0A 2NY2D 5DMYA 4Y1AD 2QSTA 1N59B 3RTQA 1JYVA 3KNBB 1PEZA 1V3LA 3DBXB 1VFOA 2AK4D 5TE4H 4LCYB 2A38A 1RURH 3IFPB 3W5MA 1S9KC 3TYGH 4MS8C 4KY1H 4YXHL 3H9SD 4XPBH 2YHGA 3TCLB 1FJ1B 4N90E 3W11D 5MP6H 3NACH 4K8RD 1MHHB 1QSFB 4DN3H 5KVGH 4G8GE 4FABH 2FBJH 5C7XH 3LH2H 3BKML 5DYOA 1B0WA 3ZMRA 4UI2A 1LO2H 2O5ZH 3P0GB 1OAYL 2AJXL 3MLYL 4EQ3A 3MLSH 3SDDC 3C5ZB 1OPGH 5KS9A 3GMQB 1FZJA 1T1YB 3KPSD 2VL5B 2Q7YB 3FN0H 2IJ0C 3SDDD 3TBSA 4AT6B 5FIEA 3EOAA 4KRPD 2AJYH 3VGAB 4PJ8D 5DVKA 3EJJX 4PJ7B 4U0RB 2E7BA 1UEYA 5B38G 4RMVA 4N8VG 4HX1B 2AV1B 4OCRH 2A6DA 3LN9A 4WI8A 4NQCD 4I0PA 3C9NB 1UM4L 3QI9B 3E6HB 4O2FA 4EDXA 5BRZB 1I7TA 1NCBH 2VKWA 1IC4H 5DT1L 1OLZA 4GW4A 1KLGA 1NJ9B 2R0LL 2ADJA 5FKAA 4OZHB 4ZSOA 2BP3A 3DO3A 5HHVL 4HKBA 4IIQC 4K71C 2JKXA 5I8CB 1OGAD 1E4XI 2X10A 1YQ2A 3HI1A 3J7HA 3O8XB 4HFWA 4HIIA 3QDJA 4OD3L 1AFVL 3HZMA 1SYSA 3IF1A 3G5YB 4FTVE 1S7XA 1R3JA 5CS7A 1MIEL 4KVNL 2Q8AL 1RUPH 3Q5TA 3QQ3A 3TIEB 2HG5B 2W9LA 3OTTA 3PWLB 4XXDB 1X5KA 2CLVB 2XWBB 5CBAB 4YPGA 3HMWL 4GT7A 3V79C 4UZGA 4YNYB 3CC5A 5IESL 4XGZB 3JWNC 5CMAB 2OK0H 3TIDB 1FGNL 4PP1C 3WUZA 5EG6C 2Y7QA 3IU3B 4NO0D 2FYYA 1FO0H 5IM7A 3QWRD 1PZUB 4PJEE 2CDFB 4Y4HB 1MIML 2VQ1A 3A6OA 3C8KA 2X9YA 5DVNA 4X98B 1ZT1B 4L8SA 1CDUA 3BP7A 1OTUD 1QFWM 2FZ3B 2BRRH 3F5WB 5I73B 4RFEB 3LSOA 3P9WB 4PLJC 3MMEA 4PRHE 2HJKB 1NSNH 1AXTH 1XF2B 1DL7H 1L7IL 4CMHB 4RRPA 4LSTL 4PLJD 3T4AA 4FZ8L 4UQ2B 4CADB 3C5SB 5GRUH 2XY1A 3F12B 1OP3K 2AV7B 5A2LH 5MENE 1KNOB 3Q6FB 4XVJL 4OCSL 4JY5H 3ARDD 2Q7NA 4U6VH 1ORQA 1N5AB 4P46C 5DVLA 5D4QA 4PRPA 3QIUD 4WIQA 1J1XL 2VTFA 3HTLX 3GJFH 4EUPG 3LKRA 3GGWA 3QH3A 5I74B 4G3YL 3MV01 5HGBA 3HPLA 5D2NA 5LCVL 1P7QA 4NRYB 3I2CH 1W72A 5F7WC 4Y4FA 3GIVA 5B8CA 1FZMA 2DJUA 1FHGA 1JGVL 1IEAB 3BH9A 4OQTA 2DLGA 5E4IA 1T1WA 3MOBH 4X83A 4M7JH 3GRWH 1B9ZA 1NUDA 5SWSA 2RFXB 1U3YA 1ZMYA 5DSCA 4KK6C 5KSUA 2NYYC 1GOGA 4QY8A 3RWFB 3ULUL 1GGTA 1QSVA 3PDOA 2NYYD 5DRXA 1T2XA 3EYFB 3VDCA 2H41A 5HGHB 5EU7E 4LPXA 3P9MB 3Q3GA 5DD1L 3TBWB 5ACZB 4KKNA 1T1XB 1VB9A 4WENB 2WW8A 4O58H 5HYJB 3WIHA 1L7TL 2VABB 5E6IB 4PY7B 4OLXL 4UT6H 1M4KA 3L7EB 3V0AC 1A9EB 1H0DB 4HKZB 2HFGH 1RQ5A 2WWKT 2GK0A 4MNQD 2WZPD 1I1YB 4ENEC 3ARRA 2BNQD 1XR8A 4KFZC 3TO4B 4JZOB 3TPUA 3K4AA 4U33A 1HQ4A 1JPSH 3V6FB 5DJXA 5I1LB 3DHJA 3N85L 5F21B 4UV7L 1JGDB 5HGDA 3GSOA 5I18L 5SWQB 4DEPB 3MRCA 4N8CH 4UILH 12E8L 5FYJE 3PWJA 1T5XB 1KJ3H 2G75B 4J12A 2BVEA 3BP6B 2YD6A 5C0RL 1NLBH 3RY6A 1MCIA 2V2XB 4Y5XA 1D9KA 3HG1E 4LARL 3ALPA 3GSNL 4IMLB 1T4KA 1JN6A 3TWCH 1MCPL 5FOBB 2DQIH 3FOMA 4HWZB 5EU5A 3BO8A 4RMRA 5FF6A 3DGCR 3PWPE 4FQXC 2VAAB 5F9OH 1TVDA 3U0TB 3H2WA 4M4PA 4B41A 4XCFH 2K3TA 1XZ0B 3BIAX 3S37X 2ARJQ 4K07A 1A14H 4W81A 1HZHH 2DQTH 1WWWX 4MA8L 3ZLQC 2CLZA 3WKML 1IGTA 3IETA 1MY5A 5IWLA 2H3NB 3HNVH 1ZVHA 4MQ7B 5FA3A 3AB0B 4TVPE 5TQ2L 2ZOLA 4PGBB 1EH9A 1F8TH 4F9LC 5JW5B 4CW1A 4JM2A 1JHKH 4BYHA 1KUMA 1SBSL 4XBEH 5ETUA 2EYTA 3NZHL 1I1AD 2XTJB 1DQQA 3EYUL 5KVDL 1KN4L 4OCWH 3QA3A 3VGEA 3INUH 1VKXA 3T77B 1K2DB 3QHTC 5E7BA 4F57L 4KKLC 4JY4A 3PGFL 4M7KL 4X80L 3UYRL 2OJEB 4J3UA 2DD8H 4KKLD 4LSSH 1EJOH 1QSFD 2R0ZL 3FQWB 3EOAB 3KPRE 4XC1L 4MCYA 1OY3B 4F7PB 1A4JB 1K5NA 3MRPA 4YC2B 3LQAH 1M05B 4OM0H 4XC3L 5DZNA 4NQVA 5JOPD 3O2VL 5F3BB 3QDGA 3C5ZC 2A6DB 4PS4H 3ROLA 4OFVA 2W60B 3QDMB 4BZ1L 3BDXA 4I0PB 1YUHA 4RGOH 5H2BB 4NP4H 5ENWB 3UJJH 2FX8L 3VGAC 4O2FB 1KIQA 1A3LL 2GUOB 1UWXH 3KVQA 3TBVA 4U0RC 1KLGB 3GJFK 1KTKE 1FIGL 2EIEA 3MACL 1CDBA 2I5YL 3VG0H 4PJHF 5DR5H 4JR9H 4ZSOB 4KQ3H 3EFFA 3WLBB 1EEZB 3VE0A 2OL3A 1TENA 4HKBB 3TVMA 2CRZA 1G7PA 1VSCA 3GB7A 1ODAA 4PJCF 3RNQA 3QI9C 1Y6NR 5IG7A 3AU1B 4HWNA 4HIIB 4ORGA 5A40E 5GPRA 2BSRB 3GHEH 1B3JA 3QDJB 4GSDH 4LCWE 5DUMH 1SYSB 1U92B 3IF1B 4LQFH 1S7XB 3PNWB 1BIIA 1DBBL 5F96H 2C9AA 2IPTH 3BISA 1G7IA 4EBQH 4KU1A 1VESA 3O2DH 2NXZD 2W1NA 4CNIB 1B0GA 2JJVA 5JXEC 3B43A 3LZFL 4DFHA 3O8XC 4Z7QF 2ADIA 3EOBA 4J3TA 4U1MB 4ZQKA 3Q6GH 4Y5VA 4D3CH 1AC0A 4X5LA 4DUWA 4Y4KB 5J1TC 3LEYH 3ECBB 3F7VB 4NPYB 1ZT4A 2ZSWA 3NFSL 4X8JA 3S7GA 2ICWB 2QSCH 1JI1A 5DMKA 5IK3A 3KPQB 3WXVL 1Z9SA 5IM7B 3KJ4B 4Z95L 4LIQL 1IGFH 5I1IL 3CXHJ 3MCKA 2OBGA 4JZJA 4WEMB 3BP7B 4NO2B 3DARA 4OQ1A 1JGLH 4OFIA 5J1AB 2P45B 1BVLA 4OLUL 4WVRA 4HS6B 3BIKA 1XGRB 2DMKA 4FG6C 5IMOA 1BD2A 2NX5D 2AKRB 3T4AB 4QHMB 4PJGA 1MVFA 1FH5L 5ALCL 1AQDB 5AZ2H 4Y4HC 5JIPA 5LKNA 5ADPL 4YHLL 2FGWH 4DQOL 4G6KH 4QCIA 1N7ML 35C8L 3MA9H 3V5HA 1CVSC 5I73C 1U8LB 5DHYA 4NKIH 1E6OL 3P3YA 4CMHC 1F4YH 1FSKB 5TFSL 4AEEA 5GGRY 3X13B 3CMOH 3ZHLA 3LN5B 4HJGA 1QR1B 1B6DA 1CF8L 2ZG2A 3MV8D 5HGBB 4YXKH 3H9SA 1FLRL 1S78C 3AMKA 4D0CA 5DO2D 2XA8L 1KTLA 3GIZH 5DRWA 2DWEA 2VUOA 3OAZK 5C0BB 1S78D 3DYPA 1ZLUH 1G0XA 3L3KA 4OZGF 4TRPH 3KWWB 1W72B 1Z3GL 5MERA 3GIVB 4XWGH 3MJ6A 4JN1L 1TITA 1C08B 1PG7X 1T1WB 4XPHL 5I74C 4PGJA 1FV1B 5F1IB 2NY7H 2V2WA 2HMIC 1DQTA 1VACB 2Z91B 4MXVF 3RJQB 2HMID 1MCNA 4NHUA 2DTMH 3K4DA 3KPSA 1T6WA 2ESVD 2X41A 3TT3L 4L5FH 4L9LA 3GMNB 4M6OH 4D0BB 1J1PL 3Q3GB 5T3XD 1I3RA 5D72H 4PJ8A 1GSMA 1ZLVH 4XXCC 4YDJB 5KTEL 5A3IC 4RNRB 3FRUB 2VDRL 4Z7OF 2ADGA 1X5GA 4NQEE 3AAZA 3HMXL 5E2VL 3IDNA 3JSSA 4C4KT 1MVUB 4Y0GA 3S37L 3G6DL 3ZDZE 5IP4A 1A7QL 4NN6B 3V2AR 4PY8J 4GG6A 1A6PA 3IKCB 3ULSA 2R1XB 3TPUB 4N0CC 3O6LH 3QHZH 1WIPA 1EHLH 4M8VA 3GEWB 1U58A 3MV7B 4WHYH 1BZ7A 3FFCE 2R2EA 3LQZB 4X99A 1QSEB 5E6IC 2IMNA 4NWUL 1NAMB 1JWMB 4OLYL 1FFOA 3SY0A 3N1FC 2SEBA 2YEZA 2EKSA 2YK1H 5F97E 5C0AE 2DYPA 5CJBA 3TO4C 3ZO0A 3QQ4B 2P5EE 2WINA 4JRXA 3TO4D 1UWXK 4R4BA 2LABA 5T33L 5C2BH 3L7FA 4Y5XB 4G6FD 3FT4B 3IDIA 4X6CA 1T4KB 3OB8A 5CSBA 2FD6H 4XTRC 4Z7UE 2YC1A 3KYKH 2XN9E 3FOMB 4DEPC 4LHUB 4OZIA 5JTWA 4ONGL 1MCWM 2J8UA 1ZHNB 1TNNA 1HINL 1GPOL 4DKFL 4HS8L 2VN7A 1M7IA 2DQCH 3UTOA 3NTCL 2F8VA 2NY0B 4HPYH 3IETB 1FNGA 1J8KA 4U1LB 1R3KB 4DJMA 1RVFH 4DAGH 4S2SA 1KCKA 4PTUB 1KLUA 1PYWA 3B2VL 3CH1A 4GAFB 4Y8AA 1OP5H 3QWRA 4ODTL 4CW1B 3T0BA 3G6JE 1TPXB 2XQYK 4HH9A 4DVRL 1AO7E 3ZL4L 1C16A 5ETUB 1CL7L 5I1CL 2YPLE 5C92A 2CJUL 3QA3B 3GSQA 3PQYB 2QR0A 3U36A 2PYFA 4AJ0A 4QOKE 1AGFA 3AB0C 4S1QH 4HUVA 3GDBA 4YHMH 4JY4B 5IROC 5DDHA 3SDCA 1IKNC 4HUKB 2D7TL 1P84K 3FKUS 4UIMA 1E28A 4EDWH 5JZ7C 1YEJL 2XTJC 1PLGH 3ARDA 5KVEH 2X5PA 3O4LB 4NO3A 3MRPB 3DRTB 3PHQA 4NRZA 2XTJD 3QIUA 5HPOA 1J1OL 4W70A 4JQXC 3MBEB 4LEOA 1EUTA 4K9EC 4QHKJ 1NL0L 3L3IA 4YBQC 4UBDC 3GMRA 3GMLA 4WUUE 5J6HA 5I8OH 4YH6A 4LAQH 4IMKA 1GHFL 1INDH 4XNUH 1N6QL 2FECL 1LE9A 4ALAH 4YC2C 4U3XA 2AJSL 5DS8A 1HKLL 6FABL 4JCLA 4LHQB 2QSVA 2Z31D 3STZA 5LJYH 3HZKB 4K94L 1KIPB 3WDHA 4YHZH 3QWOA 3TVMB 3CGTA 4I0PC 2X4PA 5AYUL 3GJEB 3E2HB 4JFZL 3S35H 1AGDB 3QDMD 2FEEI 4MAYA 3MV9E 1KJVA 4MDJB 4U1HA 1ZLUK 4UDTA 1KN2H 4OGZA 1MJ8L 2OTUB 1YECH 4JFED 3BW9A 3CXHK 3DHMA 4M62H 1IGYB 1G7IB 2JB6A 4JO3H 2IPKA 3BT2H 3QUXB 4P23B 4FQ1L 3W9DA 4JVUA 2VXUL 1H3PH 2WWMC 4XZUA 1OAUL 1RY7B 1V7NH 2GAZB 3VFOB 1T66D 3PP4H 3E8UH 2YN3A 4MNQA 3OGOE 3DXAD 3RUGE 3HE7B 2UWEE 4OIAA 5D7LD 1DE4A 1LO3H 1A6AA 4PJEF 2C1OA 4Q97A 4WW2F 1ZLVK 2VDNH 4ZFFA 3D9AL 1WBXA 9CGTA 1YPZB 3EOYG 5HDQL 3QJFB 2VXSH 4AL8L 1HNGA 3GUTB 3K81A 2DQDL 4U6XA 3AVEA 3ISWA 4FFWD 4PJFF 2Q86A 3MCKB 4Y4KC 5CKGA 3WFBH 2YD2A 5DK0A 4NUGH 4DZBA 4Q9RL 4AG4H 4Z8FH 1VPOH 1AY1H 3VXNA 3RU8H 2V7NA 1JYNA 2WP3O 4GRWE 4I2XA 5JO5A 5IMOB 2A0LD 5LVEA 3VMNA 4PJGB 1MF2H 3KJ4C 1CE1H 3FQUA 4APQD 5BV7H 2DMCA 2Q76A 1LO5A 1TETH 4N0UE 2VDPL 3V5HB 1HH9B 1CFVH 4Y19D 4IM8A 4YHKH 2J4WH 5FM5M 2Z92B 3L5HA 3JXAA 3BEWA 1GL4B 2F19H 3IB4A 3LKPB 4LVNB 5ADOL 5C9KA 5I1EL 4EUPH 2QKIA 4JPVH 2Z9TA 3WNPA 1W0WA 1RJYA 1NMBH 4LMQE 4P5MA 1KTLB 5DRWB 1OAQL 1QNZH 2DWEB 3MXVH 5HJ3A 5IB2A 3L3KB 3TESA 1IT9H 1HHIA 4WI7A 1KCVH 3QRGH 3BPNB 1DLHB 4M6AA 2O93L 2OM5A 4RRPG 5FUOL 1FSKC 3V0WH 4XRCA 2E9JA 1ZHKB 4G7VL 2V9TA 2V2WB 1KCRH 2BVOA 1CBVL 3W5NA 1FNEA 1OP5K 3RJDA 5LQBH 4LCIH 3S3SA 3O3AA 5D7IE 5EOQL 1DQLH 3FZUC 2ZOKB 2BJMH 2R1YA 3ULVE 4R4FH 2JIXB 3QNYA 1I3RB 4D9RE 1A5FH 2C1PB 4QXWA 4ZODA 4JKLA 2P8PA 3JWOL 3CVHL 3REVA 2BHUA 2OS7A 3RQ3A 3AAZB 1A7OH 3D39E 4AEIH 4ELME 2D9QB 5DUPL 4PLKC 1U8IB 2AGJH 4NCDA 5F1KC 2GEEA 2MCPH 4OD2A 2R2EB 4X99B 2J5LB 3T0AA 3UBXB 5FYKU 4FQ2L 5CP3H 2SEBB 5BVPL 1OAZH 4NN6C 1NCDL 5JHDB 3OBAA 4FQQA 4QRPB 5B39A 3QIBA 4UV4L 3PXHA 2X70A 2FX9H 3L3OA 1S5HA 4R4BB 2NY5L 1JHLH 2V5TA 3O6ML 5E8DH 4NQDE 3IAQA 5GHWH 4PJBE 4Q9QH 3IJYB 1RZ8B 3C6SA 1GRWA 2FH8A 2OR8A 4U4BA 2J8UB 1ULVA 3SE4A 2YD5A 4MCZB 5F6HJ 5H94A 1SYVA 4UB0H 3K80A 2H2SD 5TE6L 1M7IB 4Y5XC 4ZFGH 4MVBD 5T5FL 3GFUA 4FQIL 4QRRE 2E7HA 2Z8SA 3GSNA 3O3EA 3VFNA 2YWYA 4KUZH 4S2SB 5EC2A 1ZHBA 4D8PA 1QQDB 1PYWB 3FB6B 3K0WA 4GAGH 5F1NA 2EO1A 4RMQA 1LO4L 3GSXB 1MCDA 5MEQA 4WV1A 1NLDL 5L2KE 2DOCA 2H45A 2GY5A 4PJIA 3VXSD 3WJLA 5K9OA 4K3JH 3IVKA 2NY0C 3D3VD 4X8XA 3TFKD 5IWLC 5J3HC 3GSQB 4G8FB 4LHUG 1KPVA 2NY0D 5DJ8A 2NX5A 3T0ED 4R26L 2F9BT 3WHE0 5DDHB 3SDCB 3BE1H 1TPXC 1QBML 2X9XA 1V5JA 3IFLL 2ADFH 1E28B 3HC4L 4PB9L 1OTTD 2ZJSH 4UOW1 3KYMA 1ONQB 4M6ML 4PJ5B 4NO3B 1BEYH 2NLJA 4NRZB 1G6RL 4CJ0A 2P1YA 4FP8L 1GGIH 4LEOB 5JOFA 1FFQA 1G7MA 2RIKA 4L3CA 1CR9H 3GBNH 1LDPH 3L3IB 2BC4A 3GMRB 3MV8A 2XFXB 5EZIL 1RUQH 5J6HB 1YEGH 1G0YR 5HPMB 2NZ9C 4J3VA 4YEFA 3BH8A 1K8DB 1OD9A 4Y16B 3QG7L 5DS8B 3MBEC 3OF6A 4HUWA 4XVUC 5AAWA 4KK9C 2FWOB 3SGKA 2GJ6D 5KSBE 3MBED 3N1GC 1IAIH 4JFHE 3QWOB 2XKNA 4M61A 5KVFL 1NFIB 4JFOA 4MAYB 5DJDB 1KJVB 3CUPB 1JFQL 2IQ9H 3MREA 3H7BB 5DWUL 3HUJA 1IZJA 1P6FA 1BF2A 1GAFL 3BW9B 3CXDH 4HDIA 5GGRB 2XG5A 1DBML 4LCUA 3TVMC 2IPKB 3W9DB 3C08L 4QRTB 3E2HC 5BXFB 1T0NB 1QFWI 4CMMA 1ACYL 4WFFE 2AEWA 2ZG1A 2B1AH 5IEKA 4CU8A 2C1OB 1SM3L 4ZO9A 1D5BB 4ZFFB 3QUXC 4P23C 4GAJH 1KXTB 1PY9A 3FFDA 1A64A 3F65A 3QQNA 5HDBE 3TBYA 4JPKH 2AI0H 2B1HH 1A2YA 4U3HA 1FCCA 4H88L 1F58L 2WUBL 5GGTL 2Q86B 3QFJE 5JUEL 3DX9A 3HE7C 2C3XA 3S4SA 2V7NB 3T2NL 4FMKA 2V2TB 5JO5B 3QQ9C 1F3DJ 4OBRA 5DLMH 3CFBA 3R8QA 4KWUA 4ONFH 4Z0BH 3ARXA 4MA1B 2CPCA 4UU9A 4UT7H 1YY8B 3QUKB 3WXWL 1ZE3C 3M8OH 2GTZA 4LSQH 5ITBH 2A6KA 5HYEA 3BPCA 1Z5LA 1HILA 3BSZH 3QUMA 1RMFH 3B3IA 2AJZA 2P8LA 5EN2A 5AD0B 3MRFA 5JMOC 1WBYA 2EXYD 3V6OE 1K6QH 3AY4C 3E1F1 4Z7VE 1WZ1H 4P59L 2QKIB 2IALA 1F4XH 4QEGA 1W0WB 3L3HA 1X6LA 1JRHL 4P5MB 3JV0A 5HJ3B 3M1BA 4MHHI 1WIOA 3ZKMD 1HHIB 1B4JL 4ZUVB 1R3IL 4QYOB 4XRCB 2DQHH 2VUYA 4LVNC 2VYRE 1KC5H 1OARH 4C56B 2PYEB 4PGEA 1YN6A 1OAKL 3BMWA 2WK2A 5CZVH 4G8IB 2NW2A 3GSWA 3TCXA 3UO1L 5GS0C 3LS5H 3BPNC 2P5WA 1N64H 2OCFD 1QLEL 1MRDL 1MPAH 5FB8B 5JPMA 1JPTL 3EKCA 3QNYB 4JFDE 3WIIH 2P43B 5DJZA 4TTGA 1NDGA 3WFDL 4KTDL 4IOIA 3ZDZF 3OHXB 5TE7L 2EC8A 2B20A 1CDHA 1LDSA 43CAB 2JJSA 4LDOB 5DC9B 3ALXA 3VXRB 3LEXA 4YX2L 4MJIA 4DZ8B 4BFIB 1QVOA 4G9FD 5C9JB 3VGDA 4QGTA 3O6KL 3KXFD 5TDPA 1FORL 4M48H 5T3XH 5KOMC 1K4DA 1XF3A 1ZK9A 3AREA 5HDLA 4NJ9L 4OD1L 1KBGH 4P9MH 3T2PA 2MQCA 1EERB 3ARTA 2R2CA 2P7TB 4NDMA 4HV8B 1I8LA 5T1LA 1TJHL 1Z9MA 4NC2B 1FDLH 2EYSA 3V7MA 5C0NC 3ES6B 3BGAA 3U1SH 1DZBA 5HHPA 1UXWB 1ZS8B 4N90D 1N0XL 5E99L 3QIBB 2JLLA 1GZQB 2EDLA 5B4MC 4TOYH 4JRWA 1LVEA 1RZIA 3EYSH 3RWIA 2J5LC 1YNKL 4UTAL 4M1DL 2IGFL 4JFEA 2VXTH 1UM5H 5IQ7H 4BFBD 3LIZH 3K1KC 5CJ8A 4G80B 3C6SB 4FXGA 1JP5A 1MI5A 4OB5H 3H42L 3Q5YA 3RBSA 2ID5A 4XWOD 2DAVA 1WBZB 4P2QB 3RDTB 3S96A 4X6EB 2H2PD 5CSZB 5JHDD 3LPFA 4L8BA 5CCKL 1CICD 3OSKA 2IAMD 5BZWA 4P57B 3DXAA 1OAXH 1QRND 1RU9L 4ZXBB 1OF2B 1ZXQA 1KXQE 5D7LA 1PVHA 3IXTA 1ZT7B 3GSNB 3O3EB 4U6HA 3G6JF 3SO5A 4K7PX 5EC2B 5H37H 5KS9E 3PWUB 2ZKHL 4NKMA 2F8XC 1C12B 1V3MA 1LK2A 2MPAH 3EZJB 8FABA 1Q9KB 5E2WL 1KULA 2ARJA 4PJIB 5GZOD 4MD5A 4WNQB 2OTWA 3OZ9L 2PO6B 3MGAA 1MFDH 3RKDD 5EPMA 2VR4A 2YZ1A 1GC1L 2V7HA 1U8QB 1EHAA 3THML 3T0VA 3HB3C 3U46A 5JR1L 3L6FB 1KIRA 1R5WA 3GI8L 5HI3D 4APQA 1IVLA 2HRPL 3DI2B 3KYMB 5DJ2A 5ISZA 1FNSL 4K3EL 1VA9A 2NW3A 4Y19A 5FFLA 4TUOA 3FO2B 3QCTL 5T1MB 1MFAL 5JOFB 4ODWA 1FZOA 1UYWH 4L3CB 3SDCC 3BRFA 3PV6B 4OF6A 5EIIB 2ZNWA 1DUZA 2BC4B 2X44D 3F7YA 2DL2A 3RL2A 4L4VA 4RMUA 3QIWD 3CVIL 4TPRH 1FGVH 2FJFA 2VDQL 5EU3B 3ZDXE 1EGJH 4LVOB 1JZ8A 1YMME 4WTZA 4P4KB 1ZA3B 2X4OA 1YJDL 4N9GA 1QEWA 1ZLWH 1E27A 4M4RA 1UZ6E 1K4CA 3RHWK 3CDYA 4D9QD 3UPRA 3QCUH 3EYVA 4M61B 4K9EH 1KPRB 4XAKD 1UXSA 4ONHB 4XVTL 4K23H 4GMTL 5TPWH 1FAIL 2GT9A 2X4RA 4KJYA 5C0CB 3LRGA 3HUJB 4Y16C 3ARBD 3HAEA 2J3SA 3CAFA 2AJUL 4JKMA 1X4XA 4XPTL 4LCUB 4UT9L 1NUNB 2VLJD 1KB5L 4O02L 5FHAH 4MAYC 3RUGF 2NTSP 3EGSB 4D9LL 3GBLA 2UWEF 4J6RH 2DLEA 3L3DA 4TVPL 4GMSH 3LOWA 3KDMA 4H25A 1EFXB 1NFDB 3QEQE 1CXHA 5DEGB 2Y06H 4P5TD 4YFLF 4HLZG 5IEHA 3OL2A 2JJTA 3GBMH 3DX7A 2AABL 3Q48A 4KHTL 2HH0L 5DHVB 1CQKA 2F5BH 1F90L 4GRWF 2EDFA 3HHRB 3AM8A 4ZAKA 3DX9B 4PRPE 1QR4A 2GCYB 2APBA 1MH5A 4OI7A 2XZQL 4ZUSA 5C07A 2D2OA 2PF6A 4OF8A 3QP3A 1RJZB 3O3BA 1S8DA 3CFBB 5CJXC 5K9JL 2NTFB 4LFHG 4LF3A 5A16A 1IKFL 4PJXA 2A6KB 3DI3B 3MX0A 5E8PA 3BZ4A 1I4FB 3O3DB 1Z5LB 4RDQF 1TIUA 4RA0C 3B3IB 4XI5D 4JLRA 3SBWA 3S35X 4NZDA 2LFGA 3P73B 5SWSE 4MA1C 4PYHA 4YEEA 1C7SA 1CLZL 1YEKL 2UZXB 3MBXH 3MRNB 2ZUQB 3V5DA 1XAUA 2HLAB 2PETA 2E6PA 5HHQA 4JFFB 3VXSA 4F9PA 3D3VA 5EIVA 2C5DC 1RJLA 4RGND 1INQA 1CD1B 1DBKH 1MHCB 1N0LA 4KMTH 4PGEB 5E8EA 2IFGA 3HNTL 5D7IF 2CRMA 3ULVF 3WLWC 4E41E 3OX8A 1BAFH 5JW4N 3W0WA 3WLWD 1U41A 5FYJD 4R0LA 4U1JA 4P9HL 2XICA 1OSPL 4PJHA 3SKUD 1CXKA 1MAJA 3UMTA 1U8NA 4PGCA 4F7MB 1NDGB 4H1LH 2VLKA 3SDYL 4ELMF 4F7TA 3A6CL 4X4YB 3ZTJG 5TF1H 1LK3H 4O2CA 4YO0B 4XMKH 5ELIA 3WHXA 5MHSE 2LTQB 3UJIL 4O5LL 2OTPA 3LEXB 4MJIB 3VXMB 1ED3A 5TDPB 4I77H 3C6LD 3IDGA 3I3BA 1CLYH 4IRSB 4DUVA 3MCLH 4K7FB 5BZDA 3R1GH 2IH3A 3HE6D 3NCEB 3CVHA 3QNZB 1FE8H 4KQ4L 3C60D 5I76A 5ID0A 1UWGH 2GJ6A 5T1LB 1E4KC 3PP3H 2OZ4A 5BQ7A 3ULUC 1DBJH 3STBA 1CGYA 2EYSB 4RZCA 3TA3A 1FL3A 2NCMA 5I1KH 3T4YA 1TVBA 4PG2C 1RZIB 4PJBF 4GAYB 3IRZA 1NFKA 1Z0MA 1L0YA 3HKFA 4V2BA 5F89A 3OXSA 1ES0A 2H1PL 4HMDA 1ZLWK 2E27L 5SWZE 3TJHD 3MODH 5GGUA 1MAML 4N8PA 1R24B 5GGVH 4MD0A 1BECA 4BFEA 3QIBC 4UINL 3S96B 4OKDA 3DUHA 4YHIA 4BSWA 4OUOA 2G5BA 5F44A 1MWAH 5IFAH 3CSYB 4OLWH 2A73A 5MEOB 1U91B 5F7YC 3IXTB 2NMSA 3D0VA 4PGDB 3NPZB 1OW0A 5CKAA 5E5MB 1NAMH 2CXKA 1WEJH 4M3JA 1WCQA 1IGJA 4MB4A 4QTHB 4DGIL 4MXQD 4B0MM 3RDTC 4LLVB 5FK9B 3AS3A 1T21A 1YEDA 5C0EB 1TJIL 5DK2A 4P2QD 3NOIA 3A6BL 1Q9OB 2ARJB 5EOCJ 4ZXBC 5KN5B 1YN7A 4WEBL 2F58L 1P4IH 3SOBH 3U6RB 1U8KB 1V3KA 2QQLH 5D7KD 3QDGE 5JW4M 5FGBA 4ELKA 5GGQL 5HI5D 2W9EL 3IDXH 4GRMA 3T09A 3KAAA 1K9TA 3RPKA 2Y5TA 2OMNA 4LDLB 1MY7A 5HVHB 3VRIB 3B6SB 2KQMA 4PBWD 1F4AA 3WJLC 4JY6B 5ISZB 2PO6C 4WDIA 5C6PB 1G9EA 3GKWL 3D0LA 5HGAA 4Q7DA 5ERWA 4F58H 4S10A 3NZ8B 3QPXL 3V9FA 1IM9D 4PRIE 2KZ1B 1IQDA 4HG4J 3S36L 1HKFA 4L4VB 5DUBA 5L9DH 4JHZA 1G9ML 1PSKH 3BMVA 4F33B 5JXAH 1QFOA 3IJSA 5KSBF 2A9ML 2NY6B 4N9GB 1QEWB 1E27B 3OJ2C 4KI5D 4AY0A 1Q0YL 1CQYA 2R4RL 4XVSH 3EYVB 3UTTB 1IGCH 1V7ML 4CVXB 4JHAH 4IDJL 1DSFL 2PKDA 2GT9B 4KJYB 4LVOC 5T3ZD 3CK0L 4P4KC 3DV6B 4WWKD 4W4OA 3G5XB 4U1SB 4XCYA 3OKKB 5IVOA 5IB5A 1ETZA 3VFVA 4JO4L 3DGGB 4E42B 1TZGL 3DUUB 3EJZD 4CRPA 3CPLA 2P46B 5HHMB 3DVNA 4G9FA 4R8WL 1RPQA 2MTPA 4H25B 5C0CD 5HDBF 1K3IA 1FFPB 1MHPH 2W9DH 4GO6B 3BN3B 1HXYA 2JB5L 5FEBA 2OP4H 5CFHA 3RGVB 1J8HB 3V52H 3FQRB 4JQVA 4EN3D 5GRXG 4XP9H 4N68A 5IBLD 3HC3H 4TSAH 4XMLL 1WICA 1C1EH 4R4ND 4Y1AE 4ZAKB 4G7YL 4HGMA 4NNYB 2R9HC 4GRLD 2Q87A 2VWEE 3HNSH 3MRDA 1MH5B 1FRGH 1EFXD 2AK4E 4X6BA 4G8GA 4ZUSB 5C07B 4LGRB 2WQ8A 4NN5B 1RSFA 4LPTA 4JEGB 3PP3K 5A16B 1RJCA 5CD5D 5GGTA 3LDBB 3KPTA 1GGCL 1YQVL 4Z7VF 4N1EA 3KPMA 3LKQB 5FGSA 1H5BA 3DRQA 1F11B 1NKRA 4HWBA 1NMAH 2I9TA 1CICA 3SGJC 4FFZL 3MJ9H 1PJ9A 2J8OA 3KYNA 4N9OB 2P48B 1HXMB 1LQSR 3D25A 3BWUC 3UC0H 3LKNA 1YMHA 5I2IA 3OKLA 2VLMD 4Z7NE 5A2KH 3KPSE 1LNUA 1VHPA 1GH7A 2VIRA 2B2XL 4M7LH 4OZFA 4PBVC 3SKNA 5KANG 3KPPA 5HHQB 4XNMB 4OM1H 5GXBB 2APXA 2QSQA 4ZMAT 3VW3H 1BFVL 3O3UN 2CLRB 2X4QB 5ABDE 4WI6A 3IXAA 5F7DB 2ZUQC 1JGUH 4JN2B 4BQ9A 4KHXH 4J4PA 3OX8B 4NQCE 4PD4K 1NUGA 5FV1L 2EH7H 4U1GB 4GG6E 3LKOA 3O11A 4WU5B 4U1JB 5FOJA 4I18B 3BQUD 1EFQA 2VJXA 4C59B 2ATKB 1EX0A 2R8SL 1U8NB 4G5ZH 4PGCB 1WIUA 5D8JL 2WBJD 4F7TB 3LS4H 1S9VA 1T0PB 2RCSH 2BNRB 4PJCB 5E5UB 5CBEB 4Q0XL 1BQHA 1OGAE 3K8LA 2XN9D 3TM6A 3G08A 5EUOE 4A6YH 4XNZB 1ED3B 3FHQA 2K1MA 1GVIA 1OWWA 3OG6B 4JKPH 2HT4C 1WUNT 4KROB 3QIWA 5GS0H 2VC2H 1NCWH 4HBCL 4FNLL 4X6CE 1C5BH 4NNPL 3CVHB 2VQTA 2LTQC 4OZIE 2JJSC 4JANA 3ZE1E 3P30L 5EO0B 3TZVB 5I71B 3X12A 1N3NA 2APVA 3FB7B 1EBPA 1KEML 5IFJB 1MFEH 4RZCB 1CT8B 2ERJB 1QA9A 1MRFH 1CE6A 2A2QT 2AJ3B 4YHPA 4AEHH 3ILPA 4PJEA 1M7DA 3SDXE 4IRSC 4HWEH 4WW2A 1AO7D 1FVEA 5JIHA 5E2UH 4G6ML 1MFNA 1G1CA 3ARBA 3H0TB 2YPLD 1MJJB 2AJVL 3KYAA 3RZWA 1ES0B 5GGUB 1KSRA 1I8LC 4JO1L 3JTSA 3MRBA 4PRHA 4K3DH 3GI9H 3JV6A 1TVHB 4WHTB 1T80A 5FUZH 2O5YL 5E03A 3B5GA 5GRWA 1X5AA 3D85D 1IFHL 5MENA 2G5BB 3G9AB 5KS9F 5DA4A 3C2AH 1TXKA 2OXGA 4HPOL 1AQKH 4YIQA 1E4WL 1OHQA 3D0VB 1UVQB 4FQJH 4P5TA 1BJMA 1IGMH 3IDYB 4RMTA 1BVZA 1QBLH 1JHTA 3FO9A 5B22A 1G7JA 3O0RL 3RVUC 1QLRB 2X4SA 1KOAA 4WUUD 4M5YH 5DURD 1RZKH 2I07A 4FXKB 2VLRD 4OJFL 5HSFA 4FQCL 3DX8B 5J06A 5I16B 4N5ED 5D1XD 5DFVC 4R7DB 3W9EB 5LBSH 1U36A 1VCAA 2OQJA 4MNGB 4H5SB 2HKFL 4MA7H 5JMRA 3DO7A 4PRDB 4OZGB 3QEHB 2DDQH 1Q72L 1RIHH 4XBPB 5D93B 2VDLH 4E9LA 2DKUA 2I25N 4KJQD 5A2IH 5CJQH 2DB8A 3PHOA 2BERA 4O2EB 3VXUB 1NCCL 1UWEL 1VFAB 4XAWH 1LEKB 3D0LB 3U7WL 4HKJA 5HGAB 2Q8BL 5JORB 4ISVA 4YWGH 5FO9A 3FQXA 2P49B 1CLOL 5HVHC 2AAVA 4MNHB 5DUBB 2HWZL 4NZRL 1UCTA 4YK4B 1HE7A 2MMXA 2YN5A 2ENYA 5JW3L 1MCQA 4OIBA 3STLA 3SKOA 1UZ6F 5F7KC 1HN1A 1NCTA 1G6RB 3CFIC 4LCCB 4N0FA 2EYRA 4P49A 1X5XA 4YXHH 1N8ZA 4HUXA 3DV4A 5EBLA 4QWWD 3VXTA 4EQ2A 1HI6A 3CFCL 3SJVB 4QHKI 1JYWA 3KR3L 1NBYB 1JV5B 3EBAA 1A1OB 4XPAL 2FR4B 5FYLD 5FYKD 2BNQE 5HY9A 5CHNA 2NY6C 1D6EA 2E8ZA 4NQXA 4LBEB 1DANU 4RFNB 1CGSL 4C55A 4ZUWA 4YDVA 5IB5B 2D31A 3CLEL 5EBMA 1ETZB 1JIBA 5LXGH 3QNXB 1UH4A 3MLYH 3M07A 2J6EH 5D96B 1HQRB 3HG1A 3IKKA 2D7PA 1UM6L 3AXLA 4WTZG 3NA9L 1A6UL 2X1PA 3QDHA 2PR4L 3VWJD 4DN4L 5E6YA 2R15A 4I2XE 3UTZA 2L0DA 2JCCE 4JKWA 1QD0A 4YHOL 1MSPA 4K94C 2UZYB 4U7SA 3ET9F 5EWIL 5DEFB 3P9LB 1UT9A 1KB5A 3C60A 4LASH 4HLZH 1XGPA 2OSLB 3LMJL 2IAND 4HS3A 1EAPA 4XHJD 4OT1H 3FOLA 1SJEB 4F7CB 1UM4H 2DQGL 3IU4L 3BKJH 3MRDB 1NCUA 2XWTB 4X6BB 4G8GB 5DT1H 4POZC 3D5OF 2ZUYA 3RGVC 1J8HD 1NANH 5HHVH 1T7YA 1EO7A 1KGCD 1BREA 4K55A 4LP5A 4MWFB 5CZXC 3AM8C 4ZAKC 5IVZB 1T04B 5CZXD 3CFKB 4Z9KB 4OD3H 1H5BB 1XF5B 3MO1B 4ZDHA 1FL5B 1U93B 3D2UA 3X11B 4LEXL 1SQ2N 4NN5C 1MIEH 2Q8AH 4ODHH 4GXUN 3KYNB 2H6PB 2ICES 3CZJA 1RHHB 1HH6A 1NC4D 1CYGA 1PZ5A 1ADQA 1QLFB 3OKLB 1OQOA 4KUCF 2NR6C 2OJZH 3LDBC 5IMMA 2VIRB 1UKTA 4OZFB 1QSFE 2OX5A 3HMWH 4F3FA 3KPPB 5EBWB 2B0SH 5IESH 1BBDL 5LGHL 3ABZA 2WM0A 2BNUB 4R9HA 4OBSA 5JOPE 2BCKA 2VDOL 5CEZD 5GRYA 3MOAL 2R0WL 3PGDA 2R0KL 1MIMH 1JNHB 1XCTA 4GOSA 2W07A 1A9BA 4ZYKB 3LKOB 4DW2L 3PL6B 1IAKA 4X7DC 3BD3A 2VB5A 1WSST 4IRZH 1VGKB 2IQAA 1L7IH 4LCWA 4LSTH 1S9VB 4PJ7E 4FZ8H 4HK0A 3MRQA 4FTVB 3SN6N 1R3LA 3B9DA 1ZEAL 4NQDD 1BQHB 1RURL 3B9KA 1IM9A 1DVFB 3OR6A 4X5XB 4X4ME 3ZTJH 5GSRA 4U1GC 1JPFA 3TYGL 4KY1L 4XVJH 5I17A 4EI5A 1QO3A 4HJJL 2XACC 4I18C 3RI5K 1Q0XL 5MP6L 4LLUA 5DD3L 4ZO8A 1OTSD 4QHLA 2P24B 5KVGL 3R06A 2FBJL 3LH2L 5IW1A 5AZEL 2DI9A 5IJKC 2IBZY 2OR7A 2J1KA 4BSVA 4MJ5A 5HD8C 5I6XB 1N3NB 5E6ZA 4BUGA 4XNZC 2O5ZL 4HGWA 3SDAD 5LCVH 1H3UA 1QA9B 4AH2A 4KROC 1CE6B 5LWYH 1OPGL 3ILPB 4PJEB 4V2CB 3RX8A 1KJMA 4KROD 4WW2B 3FN0L 1I9IL 5E56A 4WWKA 1JGVH 5IT2H 5D1ZD 4JM2F 3JWOC 1A1MB 1RIVH 4RAUA 1FN4A 3TZVC 5I71C 4AM0A 4PFEA 3JTSB 4PJFB 4B7LA 4QHUB 1YDPA 4IHOA 4HC1H 2ERJC 3VXQA 1RIUL 4OCRL 4LNRA 5MENB 1R5VA 3FONA 3DROB 3DYOA 4MJ2A 2B4CL 3OQ3B 2A77L 4ODVH 4YIQB 4TN9A 2Y9RT 2NX5E 2BVYA 5FUCE 4LOUC 3SPVB 1NCBL 2UZIH 1L7TH 2JE8A 1NGWA 3B2UC 4TSBL 4OLXH 2QADB 1T5WA 1G7JB 5FDWB 3MR9B 4EN3A 4PG9B 1HEZB 3QR2A 4OV5A 4WJ5A 1IEBB 4PJAE 5C08B 2NY5C 1MJUH 2I07B 1XMWA 3HR6A 5DI8B 4FXLA 1CXFA 3KYOB 4HCRL 2X4NA 5IW3A 1ZHLB 3N85H 4QRSA 4UV7H 5T1DL 3IDYC 3EO0A 3MGOA 1PG7W 1JTOA 3EIFA 3MV8E 5I18H 3DO7B 2CDGB 3ARUA 4DK6A 1RUPL 3MROA 4JFHD 3WFCH 3BI9X 4RISL 4X6FA 1ZGLB 4EXKA 4ZPVB 1U8HA 4LPYA 4NQTA 1BF8A 1MNUH 5C0RH 3PHOB 1TJGL 5FGBC 1IAII 4LARH 2DI7A 3HCVA 1MCPH 4ISVB 5FO9B 3CSBA 5E0QA 2BY3A 3OKYA 5D93C 1DQJB 1X7QB 3HLAA 2ESVE 4MAUL 4NQEA 4I0KA 3STLB 2N7BA 5BMFL 5T3XE 4MA8H 2YBRB 3MRRA 4N0FB 3WKMH 2EYRB 5DQJA 5I1DA 5KAQF 2BRRL 5DJ6B 1J11A 4NGHL 5L0QB 1DL7L 3DV4B 5EBLB 3QG6B 1T83A 1HI6B 1MRCL 5HXMA 4YK4C 3IJHA 1T89A 5GRUL 3QUYB 5KG9A 2OYPA 5I15H 5H8DA 5HY9B 1YNTA 3FAXA 2DJ4A 2YD8A 3QEGL 4WUKL 3TO2A 1FYTD 1BGXL 1BQLL 4LCCC 5KVDH 1KN4H 1BPVA 4JY5L 4I5BA 1S7UA 3N1QC 3G9VA 5EBMB 1U2HA 1W0VA 4P2OD 3EUUA 3WS6A 5ESVB 4F57H 1YEIL 3PGFH 4M7KH 4U05A 4X80H 1D3CA 4Z7UA 1AR1C 2XN9A 3U9UA 5C6WH 3PWPB 3VWKA 2R0ZH 1AR1D 3JWDH 2ZNXA 4RFNC 1HHGA 1Q1JH 1FNFA 2HRLA 4L9DA 4XC3H 3VXOA 3ZKNC 5F6IB 3VFTA 3O2VH 2PTTB 4GXUM 5D96C 1BP3B 2A9NL 3LEVH 1KB5B 3MOBL 3CSGA 4M7JL 2VERN 4HS3B 1EAPB 2DWDA 2VXVL 4BZ1H 2P47B 3FOLB 1BLNA 1EXUB 4S11A 5D7JD 4JHWH 5GJSL 2HT2C 4GKNA 1BVKA 2UYLB 2NY3D 1FLTX 3JTTA 1NEZB 3T3ME 4CVWA 1AO7A 1ZANL 1FIGH 2VMFA 1MFBH 3MACH 5IVXA 5EU6D 2YPLA 4AK1A 2I5YH 4JJ5B 4YLQT 4NYLA 4JQVC 1UQSB 2W38A 3MCG1 2J7LA 4UUJA 2VRAA 1T6VN 3IDMB 2FB4H 1GCFA 3L9RA 4ZDHB 5HVFB 3D85A 2HFGL 3V7AE 2W0KA 4Z7NF 3KPRB 4ODSL 5F9WB 1U95B 1INEL 5CJOL 2X7LB 4HKXA 1HH6B 2HLFC 5FO8B 1PZ5B 3PWNA 4GUPB 3LZFH 5DHVH 2CR3A 2DICA 5HI4D 2HVJB 1H5BC 1T3FA 4F3FB 5DMGD 1AD9A 4F7EB 5DJAB 4WUUA 4N8CL 3NFNB 4JM4L 5HBBA 5IOPA 1WF5A 2XTJE 4UQ3A 3S3JA 2GSGA 5D1XA 4GG6F 3WXVH 1GZPA 3QYCA 3C87A 1WTLA 3FN3A 3E3QC 4WI4A 1A3RH 1XCTB 4OAWB 1A9BB 3VFSA 1CI5A 5FV2A 2DF3A 4FQHA 1LEIB 4L8DA 3P40A 2IQAB 3MV9A 4OLUH 2GTWB 5F72S 1AGCA 4LCWB 5E7FA 5EUOF 2DQTL 1RZGB 1IILE 4XBGA 3ZT7A 3DTXA 4OZFG 3U7YL 3OR6B 5ADPH 4YHLH 4DQOH 5FHBL 1UCBL 4X6DE 4PJDE 3QDME 4WFED 1Y18B 4X6CF 3PL6C 3RPIB 1QO3B 1CFNA 3ARWA 1PY4A 4DWHA 4TYUA 4YZFE 4OZIF 3PL6D 3ZE1F 3O6FD 4QHLB 1QYGL 3R06B 4TNWK 4Z78B 2HN7A 4XBEL 4HIXL 5IBTL 4LLQB 1U3HB 1DVFC 3BZFA 3SDXF 1JZ4A 1FLRH 4NRXA 2J88L 3EAKA 4DKAA 4CN1A 1N26A 3TNMA 2UV3A 2BOBB 2M2DA 1Z3GH 3DXAE 4JN1H 1AHWA 4JFXB 5FKPB 5CLTA 5IQ9A 5I9QB 1YC8A 1QFUL 4MX7B 4OQTL 4LLMA 1BQHG 1FN4B 1OD7A 5DK3A 5I6XC 4KK5C 4GBXA 1I8KA 3NCFB 5DD5L 2WWKO 4OM0L 3RWEA 2R56L 2F53D 3V95A 1K85A 3I02B 3VXQB 1F6LL 4LKXA 4XNQB 3CJJA 1QP1A 4WW2C 1R5VB 3FONB 4E0RB 1EEYB 3KPNB 2BVQB 4KKAD 4NP4L 1FC1A 4OCLC 2EECA 3L95A 1RUAH 3N0PB 5KTEH 5IJVB 2VDRH 1T5WB 4DVBA 4LSPL 2R69H 5C2UB 3L1OH 2BDNL 3UTQA 4DOHE 3HMXH 5DR5L 5KZCB 4ODXA 3S37H 3G6DH 4PJ9D 1K8IB 5E1HB 2BVPB 3RVWD 5ANMA 3IYLW 4FFVC 5C0FA 1PX4A 1NCAH 2F74A 5SX5H 4TUJA 2X4NB 5EZOL 1KF9B 1YMMD 1G9NL 2I26N 2R1WB 5F93C 2QADC 3MGOB 4NWUH 4IOFD 1KT2B 1Q94A 1CFQB 3QXVA 4WU7A 1HHJA 4EBQL 4X6FB 4RFOH 5KSAD 3O2DL 3P77A 3ILQD 4JJHA 3Q6GL 4PV9B 4PTTA 5T33H 5D7IA 4CDGC 2PCPA 4D3CL 4QT5A 3VJ6A 1A6ZA 3LEYL 3RIFK 1ZA6A 4RWYL 3WE6A 5IIEB 4ONGH 2HT3C 1G7QB 1NC4A 2QSCL 1JTTA 4MDIA 4BA8A 2YPVL 1GPOH 1MQKH 3FT2B 5TDNB 4DKFH 4C57C 5KW9H 2QL1A 5CGYC 4HZLA 1GC1C 1XIWD 3NTCH 1F00I 5DQJB 4E5XA 2L4OA 5I1DB 1MAKA 1JGLL 2Q6WA 1IC5L 4G43B 3FFCB 5AAMA 5EZJA 1BIHA 4LLYA 4HIEA 3IJHB 5F9JB 4TULL 4Y2DB 5KG9B 1JGEA 1YNTB 5D71L 4YXLL 2AXFB 4G6KL 1CL7H 4P3CH 1OGTA 5C0AB 5I1CH 1QTYT 2CJUH 1HHHB 3MA9L 3FJTA 1CFSA 4I5BB 1S7UB 4HZAA 4NKIL 1I7RB 5L0QC 3MLUL 1TZIB 2P5EB 3I6LE 5EOCL 3MFGB 3QUYC 4NQDA 3D18A 5CINH 2JCCF 5FYKH 3VWKB 4J3WA 1X9QA 5I1AA 1HHGB 5ID1A 1YJDC 3GIZL 2NY1B 3MRHA 3VFPA 1J1OH 5EIQA 5AYQA 5JDJA 2L7JA 4XWGL 3GMPB 2FCBA 5ITFB 4QRRA 1N5YH 3UDWA 1F4WH 1NL0H 3BKCH 3ARFA 3SDAA 2NY7L 4XPGL 5EO9A 1XGQA 3BFOA 4GKNB 1BVKB 2ICWI 3G6JB 2DTML 3S97C 1HK6A 4WO4B 5L2KA 5F6IC 4P5KA 5D1ZA 3WFHA 2W0FA 5DVMA 4L5FL 4PREA 1MQ8A 2Y23A 4NYLB 5FGCB 3WL9A 5D72L 4GFTB 4QOKB 4PRBB 1EO5A 3NIDE 2MJWA 3ALWA 2OL3L 4JFZH 2H32B 5CIPH 4F2MB 3VXPB 2X89A 1SEBA 3VFRA 3VXSE 3DMMB 4WHCA 1FFNB 3D3VE 3SGDH 2HJLA 1MJ8H 4NZTL 1JMXA 4R6UA 1RK1A 4YAQA 1EHLL 3T0EE 1MLBA 2DBJA 4U1KB 1UJ3B 2VXUH 2DIAA 4P48A 1TCMA 5CWSB 3MYJA 1OAUH 3NPSB 5T1KA 4M8QA 1T3FB 1AD9B 1BJ8A 1CIDA 3EOTL 3MQIA 2YK1L 5E9DD 4BQBA 3OKNA 1FL6A 5FCSH 5F9WC 5JLZB 5DMJB 5DRZB 1P4BL 3NCBB 1VFUA 1MCWW 1XR9B 4JPWL 1JF1A