3CFFL

Photoswitchable red fluorescent protein psrfp, on-state
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
58
structure length
58
Chain Sequence
LTETMPFRMTMEGTVNGHHFKCTGKGEGNPFEGTQDMKIEVIEGGPLPFAFDILSTSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GFP-like photoswitchable fluorescent protein
publication title Structure of Anemonia sulcata red fluorescent protein asRFP
rcsb
source organism Anemonia sulcata
molecule tags Fluorescent protein
total genus 8
structure length 58
sequence length 58
chains with identical sequence M, R, S
ec nomenclature
pdb deposition date 2008-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.40 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3cffL00
2A53A 2A56A 2G2SA 5EXCA 2G5ZA 2A52A 2A54A 3LF4A 2G16A 2A50A 2G3DA 2GW4A 3CFHL 3CFFL 3CFAL
chains in the Genus database with same CATH superfamily
3UK2A 3AG6A 4EFKA 2A52A 3IOEA 5HG0A 4G5YA 3IVXA 2I52A 3CFAL 4EF6A 3IOCA 1V8FA 2GW4A 3UA0A 2A86A 3N8HA 3CI0I 3MXTA 2IECA 3IOBA 4G5FA 3CFIA 3IVGA 3IMCA 1N2JA 2G5ZA 5BW0B 3COWA 1IHOA 2A88A 3EMOA 1N2EA 5EXCA 3COZA 4MUNA 3ISJA 1N2IA 2X3FA 4DDHA 4MUGA 2RETA 5G2FA 2G2SA 4MUIA 3IMGA 1UFVA 2OGFA 1N2GA 2A84A 4FZJA 4MULA 2A53A 2A7XA 2A54A 2A50A 3HL6A 4MUKA 4IXJA 4MQ6A 2G3DA 1MOPA 3QTTA 4DDKA 2GR7A 4MUFA 2A56A 4DDMA 2G16A 4MUHA 3Q10A 3CFFL 1N2BA 2GR8A 3LF4A 3LE8A 3IUBA 3MUEA 1N2OA 3IODA 4BHRA 4DE5A 3COVA 3UY4A 2LMEA 3CFHL 3AG5A 3Q12A 3IVCA 4MUEA 3CI0K 4MUJA 3IMEA 3COYA 5KWVA 1N2HA 3INNA 2EJCA 3IUEA
chains in the Genus database with same CATH topology
3UK2A 3AG6A 4EFKA 2A52A 3IOEA 5HG0A 4G5YA 3IVXA 3CFAL 4EF6A 3IOCA 1V8FA 2GW4A 3UA0A 2A86A 3N8HA 3MXTA 3IOBA 4G5FA 3IVGA 3IMCA 1N2JA 2G5ZA 3COWA 1IHOA 2A88A 1N2EA 5EXCA 3COZA 4MUNA 3ISJA 1N2IA 2X3FA 4DDHA 4MUGA 5G2FA 2G2SA 4MUIA 3IMGA 1UFVA 1N2GA 2A84A 4FZJA 4MULA 2A53A 2A7XA 2A54A 2A50A 3HL6A 4MUKA 4IXJA 4MQ6A 2G3DA 1MOPA 3QTTA 4DDKA 4MUFA 2A56A 4DDMA 2G16A 4MUHA 3Q10A 3CFFL 1N2BA 3LF4A 3LE8A 3IUBA 3MUEA 1N2OA 3IODA 4BHRA 4DE5A 3COVA 3UY4A 3CFHL 3AG5A 3Q12A 3IVCA 4MUEA 4MUJA 3IMEA 3COYA 5KWVA 1N2HA 3INNA 2EJCA 3IUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A53 A;  2A56 A;  2G2S A;  5EXC A;  2G5Z A;  2A52 A;  2A54 A;  3LF4 A;  2G16 A;  2A50 A;  2G3D A;  2GW4 A;  3CFH L;  3CFF L;  3CFA L; 
#chains in the Genus database with same CATH topology
 3UK2 A;  3AG6 A;  4EFK A;  2A52 A;  3IOE A;  5HG0 A;  4G5Y A;  3IVX A;  2I52 A;  3CFA L;  4EF6 A;  3IOC A;  1V8F A;  2GW4 A;  3UA0 A;  2A86 A;  3N8H A;  3CI0 I;  3MXT A;  2IEC A;  3IOB A;  4G5F A;  3CFI A;  3IVG A;  3IMC A;  1N2J A;  2G5Z A;  5BW0 B;  3COW A;  1IHO A;  2A88 A;  3EMO A;  1N2E A;  5EXC A;  3COZ A;  4MUN A;  3ISJ A;  1N2I A;  2X3F A;  4DDH A;  4MUG A;  2RET A;  5G2F A;  2G2S A;  4MUI A;  3IMG A;  1UFV A;  2OGF A;  1N2G A;  2A84 A;  4FZJ A;  4MUL A;  2A53 A;  2A7X A;  2A54 A;  2A50 A;  3HL6 A;  4MUK A;  4IXJ A;  4MQ6 A;  2G3D A;  1MOP A;  3QTT A;  4DDK A;  2GR7 A;  4MUF A;  2A56 A;  4DDM A;  2G16 A;  4MUH A;  3Q10 A;  3CFF L;  1N2B A;  2GR8 A;  3LF4 A;  3LE8 A;  3IUB A;  3MUE A;  1N2O A;  3IOD A;  4BHR A;  4DE5 A;  3COV A;  3UY4 A;  2LME A;  3CFH L;  3AG5 A;  3Q12 A;  3IVC A;  4MUE A;  3CI0 K;  4MUJ A;  3IME A;  3COY A;  5KWV A;  1N2H A;  3INN A;  2EJC A;  3IUE A; 
#chains in the Genus database with same CATH homology
 3UK2 A;  3AG6 A;  4EFK A;  2A52 A;  3IOE A;  5HG0 A;  4G5Y A;  3IVX A;  3CFA L;  4EF6 A;  3IOC A;  1V8F A;  2GW4 A;  3UA0 A;  2A86 A;  3N8H A;  3MXT A;  3IOB A;  4G5F A;  3IVG A;  3IMC A;  1N2J A;  2G5Z A;  3COW A;  1IHO A;  2A88 A;  1N2E A;  5EXC A;  3COZ A;  4MUN A;  3ISJ A;  1N2I A;  2X3F A;  4DDH A;  4MUG A;  5G2F A;  2G2S A;  4MUI A;  3IMG A;  1UFV A;  1N2G A;  2A84 A;  4FZJ A;  4MUL A;  2A53 A;  2A7X A;  2A54 A;  2A50 A;  3HL6 A;  4MUK A;  4IXJ A;  4MQ6 A;  2G3D A;  1MOP A;  3QTT A;  4DDK A;  4MUF A;  2A56 A;  4DDM A;  2G16 A;  4MUH A;  3Q10 A;  3CFF L;  1N2B A;  3LF4 A;  3LE8 A;  3IUB A;  3MUE A;  1N2O A;  3IOD A;  4BHR A;  4DE5 A;  3COV A;  3UY4 A;  3CFH L;  3AG5 A;  3Q12 A;  3IVC A;  4MUE A;  4MUJ A;  3IME A;  3COY A;  5KWV A;  1N2H A;  3INN A;  2EJC A;  3IUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...