3CFIC

Nanobody-aided structure determination of the epsi:epsj pseudopilin heterdimer from vibrio vulnificus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
115
structure length
115
Chain Sequence
VQLQESGGGLVQPGGSLRLSCAASGFAFSGYAMSWVRQAPGKGLEWVSGINRDGSTSYTAPVKGRFTISRDNAKNILYLQMNSLRPEDTAVYYCAKWLGGRDWYDRGQGTQVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nanobody-aided structure determination of the EpsI:EpsJ pseudopilin heterodimer from Vibrio vulnificus.
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Protein transport/immune system
molecule keywords Type II secretory pathway, pseudopilin EpsI
total genus 29
structure length 115
sequence length 115
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2008-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cfiC00
5C07E 1XR8B 1Q9OB 1S7WB 3Q1SL 4IMKA 4U1SA 3RDTC 3SJVB 2VZVA 2A6KA 5FFLA 5E00B 3QUYC 1H3GA 3QPQD 4LNVA 2XNAB 4HZLA 2OR9L 5J12C 1JMXA 4OCSL 5J6GA 3NTCH 3RI5K 3GSOA 1R3IL 3MJ6A 5FO8B 3IDNB 1R5WA 4MB4A 4N8CL 1PZUB 3QHFH 1O7VA 3TEUA 1K6QH 4FFZL 3U6RB 4IM8A 1OL0A 4KTDL 1LE9A 5EU3A 4ZPVA 1GZPB 4OFDA 1XF2B 4LLUA 4M6AA 3W81A 3T1FB 3ET9F 1ZLWH 2FR4B 4BELD 5TE6L 3FQWA 4G9DA 1JTPA 5LGHL 2BCKA 3NH7H 5TE4L 3T0XA 5GRWA 1ED3A 4OI7A 5T1KB 3QUXA 2V17L 1G7MB 5T3ZL 1WZLA 3ULUC 4G8FA 3P2TA 3CMOL 4GLRI 4K7PH 4QT5A 5JORA 2IG2H 2OI9C 3QDJE 5D2LE 1F8TH 3GSNA 3MNWA 5DYOA 1JHKH 5MP6L 2DYPB 5IFAL 1LMKA 3CSBA 3ARFB 1R3IH 4KK6C 3WIIH 3KYMB 5A2FA 5J57B 1CFQB 4O5LH 4P23C 4RDQG 1IAIL 5EA0L 4EI6B 3WO3B 4ODTH 2ZCLH 1AP2B 3QQ4B 3CX5J 1S9WA 2A9NL 4DVRL 4M7JH 5TE6H 3U79A 3DROB 1KCRL 1NSNL 3TA3B 2W9DH 4NNYB 3DMMA 5ISZA 1NMCC 1A6UH 4QF1A 3EGSA 2W0KA 3C5SA 3LDBC 2IQ9H 2D0GA 2FHCA 1GSMA 3G5ZB 4UILL 1CFTB 2EDNA 4JRYA 2V5YA 1ACZA 3S9DB 3V0VB 3BKCL 1YYML 3P4NB 5DLML 4FABH 2BVQA 4D3CH 2ICWB 2WINA 4IDJL 1QSVA 3QUKB 4CJ1A 1I1AA 2DQIH 4JDVB 4DGVL 4KRPD 3QDGD 3ARZA 2VLLA 2VN4A 5BVPL 2GY5A 4AEFA 1QFUH 3AGVA 3BPNB 1KJ2H 1NAKL 3MBEC 4ZUWB 3WIHH 5C0NC 1XT5A 5BS0E 4WO4C 5E5UB 5SWZD 3G6AB 4J8RB 5LXGH 5FYKL 3G5YA 3EKCA 2NY2B 2VABB 4NQCE 5DD6A 1EAJA 3W9EA 1F4YH 1JGEA 5D1ZC 4F3FA 5KVEL 4R6UA 1NGZB 3L95B 3P73B 1P6FA 4OD1H 4BUHA 4CU8A 4BA8A 2X2YA 3EDJA 4JB9L 3MUGB 4D3CL 2W38A 3TJHC 3MJ8A 2EXYD 1KPUB 4YAQA 3FB7B 4XNZB 3ZT5A 2VXVL 5EORL 3MOAL 2NY3C 1XF1A 2HLFD 2M1KA 4OM1H 2Q6WB 1NMBL 5E8EA 3UJIL 4ODSH 3LKRA 2I07A 4Y19D 3ZE2F 1N0LA 3MR9A 4F80A 2BSSA 3SDCC 1XGPB 4OCYL 1VEPA 5E9DB 4K71B 2B39A 5FYKH 1WFOA 2D0HA 4R9HA 4K7FA 4TULH 5BO1H 1A6TB 1XR9B 4MSWB 4X6BB 4E5XA 4QHMB 5E9DE 1YEDB 1S78D 5INCB 1CI5A 2NZ9C 3MO1B 2K9UA 5HJ3A 5I71C 3C08L 4XBGA 3HNVH 5JW4Q 1CZ8L 2VXTH 4HULB 2P5WB 4HIHB 1IMHC 5IKCB 2VITA 4QXGL 3A67L 3GMMA 1JPGA 1FBIH 2AJ3B 2VLMD 5L6YL 1JPST 3MV8D 4O4YH 4M4RA 4C58B 3K8KA 4QHNB 3M1BA 3ZTNL 1G7PA 4KKBC 5FGCE 1P6AB 2J8HA 4R2GD 1NMAH 4Z7UE 3P3YA 2XKNA 1HHIA 2DD8L 5DWUH 2JB5H 4NQUA 5MENA 1TENA 4TVPH 3MMEA 4NNXB 4M62L 4Z7NF 1Q8MA 4Q9CA 4X7SH 1IKNC 4MJ5B 3SE4A 4XX1G 3W9EB 1NKRA 3U46B 2WUCH 2VR9A 3VW3H 4PY7B 2VAJA 1J0ZA 1KNOA 5FEBA 5I8EB 3FN9A 3QEQE 1BIIA 5B3NA 4EUPH 4PLJC 3OL2A 3TZVA 3FQRB 2BRRL 1CFVH 2I25N 1HKFA 5C9JA 1BZ7B 1FFNA 2ZUTA 1BJ1J 4AL8H 4X4XB 5ILTL 3B9AA 3MRQB 4HBCL 5IT2L 3CVHL 3ZE0E 4XT1C 1U8MA 4L8DB 4PV9B 1PBYA 4LMQI 1HHGB 1IC1A 1NFDA 4WHCA 3R0MA 3BRGC 4NHCL 3SKNB 5J12B 2W07A 1GJIA 5DJDA 1GIGL 3EO9L 5I1CH 1CD1A 5E99L 3QEHA 1XCTA 4LLYB 3TN0A 1JZ6A 2Z35B 2AXFA 2H9GA 4BH7B 3QISA 5IMOB 1INDH 3MCKB 5JIIA 1EK3A 5EZIL 2AV7A 4LKXA 3TA3A 2BOCB 1T83C 3RGHA 2LVCA 3CNKA 4L8SC 4NQCD 5D96B 3N06B 4Y88A 5TGBA 4NQEA 4ENEC 3WEXB 4PRIA 3P9MB 3Q3GB 4XBPB 3HMXA 3QG6B 5A1AA 2FD6H 1FVCA 4OLXL 1T89C 2F19H 3GSNB 1WBZB 3EOBB 3MNWB 4KPHL 4WVRA 5E99H 2FHBA 4K71C 5DEFB 1RZJL 2AXHA 2Z93A 4JVWA 5AYUL 5DRWA 5D1ZD 3QUXB 4L29A 5EO1B 4H25A 3BISA 4L4VD 4F58L 5I16A 3TBTB 1WEJL 4OLUL 2Y9RT 3QCTH 1FN4B 3HHRB 4KQ3H 1JZ5A 4ZPVB 4HH8A 5FM8A 3QUXC 4EI6A 5C0ND 4GKZA 4NO2A 1X5FA 2W9LA 1CFQA 1FAIL 4CN6A 4CU6A 3FFCB 1I1FB 1U8NB 5DD5L 5HYEA 3GKWL 1YMHA 5LBSL 3WNMA 1FFNB 2VH5H 2H8PA 4M93C 3VXOA 2DIAA 5EIIA 4BFIB 3OAYH 5BV7L 4YHPA 4O5LL 3VGBA 1F90L 2MQCA 2APWA 3U4EB 1YDPA 4NQDA 1ZV5A 3MV11 4BFGA 1B3JA 2IQAA 2AJXH 4WI8A 3V7AG 2B8OT 3MROA 4RIRA 2OP4H 5E94B 1J1XH 4X6DE 1TQBB 3GEWB 1V3KA 2IALB 1BQSA 3DMMC 1EUUA 4QEGA 2WBKA 3MRPA 1VPOH 4ONGL 5GS0D 4NUJB 2HJKB 4ZS6D 3U4BH 3QEGL 5F7DB 3O8XB 1JWMA 1SY6A 1NC2B 2Z8RA 4JKKA 5FO8A 1Z6JT 1U42A 3PWPD 3QFJE 1YY8B 4P9HH 1AO7E 1UWXH 1WJ3A 1HN1A 5LQBL 2P8PA 4WHTB 1CU4H 3LKQA 1F42A 5IK3A 3VWKA 4LLAA 4PJCB 2VH5L 1MLBA 1NKOA 2XNAA 3D0VA 4A2MA 3PJSB 1KELH 1F90H 5CD5C 3DYPA 3DO7A 2PCPB 4NCDA 4JY4B 4R0LA 2YC1B 3EYFB 2DLFH 2ZPKH 2QKIA 1N26A 5AAWA 1C1EH 4OSUL 3RL1A 4O58H 3DUHA 1KSRA 3BZ4A 4GSDL 4NQSB 1JWUB 2DKMA 3OV6A 3KJ4C 3UC0H 2RIKA 1A6WL 3VD7A 5LWYH 5JW4R 4NKMA 5KVFL 5GRYA 1A22B 4K9EC 1IC7H 1KIRA 3SE3A 5IESH 4JREC 2K1MA 3QI9D 4MA7H 4UIMA 2DBLH 3VFVA 3LEXA 1SM3L 1FVEA 1A9EB 1A6AB 4LHUA 2R0ZL 1CDBA 5E03A 5FGBC 3M8OH 3X11A 1JCKA 2APFA 1MCWW 3QIWC 3VWKC 4CADB 3IDYC 1I75A 1XGTB 3MNVB 3BP5A 1KXTB 5H2BB 2X7LB 4MA1C 5C0EB 5ADPL 3CGTA 4PJ9D 2AGJH 1WK0A 2BFVH 4S10A 2A6IB 3NPSB 1D5XA 3F5WA 4HCRA 4ZOCA 4NT6B 3SBWC 2PYFA 2Y5TA 3SDDD 4A6YL 5JMOC 1MFNA 1QBLH 4ZS7H 4RQQA 2XZZA 1IGTB 4M02A 3NIFF 1I8MB 2OMBA 4PJDA 1DLFL 3MLUH 1G1CA 1NDGA 4KQ4L 5DF0A 2P8MA 4PRNA 5CP3A 1S7SA 3JVGC 3GMPB 3QAZC 3MBEB 3N1PC 4ZPTA 3NTCL 4L8BB 1NGXA 1CFTA 4JZOA 2ZUQB 3BI9X 1Y18A 4N8CH 5IJVA 1X9QA 1KGCE 4GBXC 4XNQB 3GK8L 4P2CG 3KPPA 1HYSD 3VG0H 1P84J 4NQSA 2X4OB 3K46A 4OCSH 3PQYB 2L0DA 1MRCH 2KPNA 3CVIL 4LEXH 4Y1AE 1H3VA 4JFOA 1RHHA 3NPZB 5E8NB 3SGEH 3T0EC 3UDWA 3R06A 1RZKC 4K7PL 5T3ZE 1DLFH 1G9NH 3MLUL 4KQ4H 2I26N 4KTDH 1I9JH 3MYJB 3RY5A 4AL8L 3UROR 3OQ3B 2ZJSL 4Z7UF 5C6TH 1YPZF 3PG2A 3VFWB 3LKSA 3QDJD 4J3XA 2CQVA 5DR5H 3FTGB 5F93C 3DRTB 1RUML 3FFCA 5KJRH 1EEZB 2W1NA 3OKYA 2EE9A 4GT7A 4JDTH 3T4AA 5F7DA 3UAJC 4KZEH 3H3KA 1MI5A 5E2VL 32C2A 5T1LA 1S9KC 4WY7L 5ACZB 1SYVB 1ZTXL 1JFQH 1OAXL 4B7IA 5I1CL 1I8KB 1F6AA 3RUGB 4EI5D 4WV1A 4H88H 5KSAC 4RISH 2O5XH 4KJWD 1YNKL 1RAMA 1J8HD 3ZSTA 1KN2H 4WNQA 3MV01 1F4WH 1MUJA 2JTDA 5AD0B 2AEQL 4L4VA 3M17B 4PBVC 3NIGE 2B5IB 2XYCA 4P5TC 2Z31D 4PJEA 1NBQA 5I75C 5I18L 3QG6A 3O3DB 1D5IH 4AEHH 4X6DB 4CKVX 4GKZB 3GIVA 3VA2C 1L0XA 1AKJB 4LLMA 4GKNB 1EFQA 1M7IB 4IRSA 3V4UL 2ZOLA 3HZKB 2EO9A 1RZIB 4NFCA 2X9XA 3QXVA 5J6HA 4JM2F 5DUBA 4JJHA 1AQKH 3NZHL 1T04B 4PJCF 4YBQC 3K4AA 4NQED 1IKFH 1GH7A 2Z93B 2MCG1 1UVQA 3IB4A 5DXWA 2EIZB 5SWSE 4PJXE 2MQ0A 3PF2A 3NCYP 4X7EC 4HPYH 5FUCC 5ELIA 5EOQL 4EJ1C 4WDIA 2FX7H 1F2XK 2UYLB 2E8ZA 5DJDB 4GUPB 1QFUL 5C0BD 1F3DJ 1KCVH 3SKNA 3TN0D 3Q3GA 2FRGP 4M1GL 5INDA 5IM7B 1ZHKA 2BC4A 2HMIC 2VDQL 4BQ8A 4JFEB 3IRPX 4WHYH 3IJHB 1TPXC 3EO0B 2GW5A 2MKWA 3HZYA 4JGUA 5A43C 5I30H 1RURL 5EZOL 4U1NB 3VGAB 1MFDL 3C60A 1GOGA 5F7NC 4PG9B 4OLEA 5SWZB 3MCKA 1QBBA 3LKNB 4OD1L 5I8OL 2BMKB 2F58L 3BRFA 4ZXBC 3FAXA 2G75A 1E4XH 1MF2H 4I5BA 5C0DA 3QFJD 3D6GA 2RCSL 5E8OB 3U36A 2V5MA 5KVDH 3B5HA 4X98A 3NN8B 1HXMA 4NOBA 4KAQH 3O2VL 4ENED 4RGNC 3C8KA 5GGSA 3WN5A 1I7TB 1KCSH 4ODUB 5FA4A 4HZAA 2GITB 4NFBA 1F45A 3QULB 4YGVB 4CJ0A 4ODVL 4HLZG 5EC1B 5HI5C 2XT1B 4LRIC 2CO7B 3RTQC 2A9MH 3HTLX 4X5XB 4OT1H 3H9YA 4WFFD 5EZOH 3E1F1 4JFPA 5DMIL 1CR9L 1W8OA 1OGTB 1S7VB 2FATH 4P2RE 4UT9L 5D71H 1IE5A 1VACB 1RV6X 5DWUL 1MHHA 4Z7UA 1UCBH 4XHJC 3UPCA 1P4LB 3WDHA 4DQOH 1CZ8H 5I73C 1BWWA 2RCSH 3MZTA 4HKXB 3T3ME 1PSKH 4F7CB 5LJYH 1G9NC 1JL8A 1U6AL 3C09B 1J5OH 4QRPB 3BOVA 4N5UA 5GRUH 4Z5RA 1M6OB 2JJSA 2KKQA 1I7TA 2WSKA 2ENSA 1I3RB 3A6CH 3UCRA 4TVPL 2HJFB 2PXYC 2FEEL 1IFHL 3QUZA 4OQTL 1IEHA 4TSAL 3DX9A 1AC6A 4U1JA 4O51B 4PLKD 4Q7DA 3UMTA 2W59A 5I0ZA 4X99B 5B38A 1YNTA 1C12A 4N90E 5E08H 5IBLD 1DUZA 3BO8B 2NY6C 5FYLL 1WZ1H 1H8NA 4GRLA 1GIGH 3QRGL 5FO9B 1CD0A 4D9LL 5I1GL 3B8YA 4G6MH 3RKPA 4OCWL 1XMWA 3QHZL 1CCZA 4OLWH 2CPCA 1NFDE 3GSXA 4LCWB 5F6HI 4M48L 4JDZA 4LF3B 3EJYD 5KSBF 3S3SA 4G8EA 1XCQB 4LLVA 2QR0B 1T03L 4C59B 1A14L 4Y5VC 5HYJD 2VERN 3CZJA 4DTGL 4Q9QH 1F3RB 2NXYB 1QBML 2JCCB 4XVSH 4WWKA 2XV6B 4NN7B 4JPWH 3ZSSA 5C0BE 4NJAH 3D2UD 3MLYH 5JOEA 5SV3A 1FJ1B 1Q1JH 5DUBB 2ARJB 4MCZB 5JOFB 4ZYKB 3DETD 1NCCL 1BIHA 2H1PL 3IXAA 5IP4A 2HFGH 5ITBH 1CICC 1WC7A 3T8XB 4OLWL 4NOFA 1TTUA 3ARDA 3A6OA 4IJ3B 4PJ7A 3T4AB 3VG0L 4UQ3B 1MRFH 4MQXD 3EGSB 1C08B 4F58H 1BF2A 3B4NA 3P9LA 5DQJB 3FQNB 2EEAA 5ICZA 3CDCA 4J3WA 4IJ3C 2VDNL 4OQ1A 3T0AA 5GGVY 5BRZA 1UZ6E 4BK4A 4M6MH 5FM4A 4MJ4A 4RGMC 1HINH 1KPVA 3NCBB 1HIML 1EHAA 2XZQH 4OUUA 2NY3D 4FFWD 4R7NB 2HJLB 5TE7L 4EUPG 1JYNA 4KVCL 9CGTA 1PQZB 1EGJL 4OIIL 3U1SH 4X7CC 4X6CA 4OLZL 4NNYA 5AZEH 3TF7C 3FO1A 5ISZB 4IOFC 4KV5E 3RHWF 3H42H 4DUWA 5J13B 4RMUA 5FGCB 5A2JH 4PRNB 4BH8B 4X9FA 1NCTA 3PDOB 4QCIA 2UWEB 4PJDB 2HG5A 5JW5B 2J4WH 1AI1L 4Y0GA 2DWEA 1I7ZA 3PHOA 3BP7A 4KK6D 4LSRL 4OZFG 1T89A 1RIVL 4TNVF 4F57H 5ACLA 4HWBA 5BW7A 3BJ91 5GRJH 5J6GB 1LVEA 4QYOB 3GJFK 5JOPD 4TYUA 3L5XH 4B5EA 1Y0LA 4N5ED 4LSUH 5LG1A 2A6KB 3SO5A 1UZ8A 5F7KC 3QFJA 3SJVA 1O5DT 1A6ZA 5CSZB 4TVPD 1I1RA 1EEUA 1NCAL 4ZO8A 4MAYC 4HS6B 5IMMA 2PN5A 3UPAA 5KSAD 5C0JA 1EHNA 1RZ7H 3O3EB 3GMNA 4UNUA 2ZNXA 1ZA6B 2D31A 3BEVA 3QPXH 1YC7A 4MJIB 1VGKB 5HXMA 2F8VA 2VISB 3H6JA 5JUEH 4ZSOA 4NKIH 3X17A 3HAEB 3I3BA 5EPMB 2VLJE 2FX7L 2FSEA 3TJEH 1ZHBB 1LP9B 3VFTA 5C0BA 1VA9A 5L7XL 2FH6A 3WNPA 8FABA 3RWDA 2HKHL 3F6IA 2CDGA 4Z0BH 3VD4A 1Q9OA 1S7WA 4U1SB 5FUZL 3DSFL 5KN5A 4RWHA 4AT6A 1OSZB 5FYKD 2EECA 4X9HA 1E27B 2VLJB 3CSYB 2X1XR 4NGHL 4JE4B 4WI9A 4UV4H 1KJMA 1YN7A 5I8OH 2F54B 5KSBA 3ULVF 1P2CB 4V2BA 4X99A 1MWAB 5B38B 5TFSH 3BQUA 1CLCA 4LPCA 4JPKH 3UZQA 2NX5B 1JNLH 3PJSA 4LCCC 4LCYA 4OB5L 5AUMB 4MD5A 1ORQB 4L3EB 3RA7H 5DJXB 2EYRB 3LB6D 3R1GL 1YPZE 2JELH 4HMEA 3DVGB 1CGSL 3SKUD 1J0YA 1FDLL 2AI0H 4UI2A 3ZL4L 5IHBA 1MCWM 3V8CA 3GJFB 2R2HB 1AD9B 5EO0A 2A9ML 4HDIB 4NQEE 1YMMD 4MXVE 5C3TA 1YQVH 4UV4L 5I2IB 4UAOC 5FYKU 1QBLL 1ACYH 2VDLH 2X4PA 5ECJE 3U9UB 1CE1H 1CDJA 1BJMA 3BX7C 4WFGE 2P49B 5HGHB 2X05A 4U6HB 3RGVD 3C60C 3DX7A 3PXHA 5T1LD 3E3QE 1BFSA 1L7TH 3ILPB 1OAZH 4GG8B 1J18A 3CD4A 3L5JA 2CLZA 4W4NA 3S36H 4R8WL 3F7VB 3EYQD 5AEAA 1FYTB 4NBZB 1ZA6A 1A7OH 2CDEA 1TCRB 3G6JA 3ECBA 2GJJA 3VGAC 4MJIE 5D8JH 3UTTD 3WN5C 5KSVA 3V95A 3TC9A 3NMEA 4DFHA 5FKPA 4YHLL 3RVWD 1YUHB 3FO1B 2IQAB 1PEZA 5E8OA 1LK2A 2DMBA 2AK4A 4MZ2A 2Z91A 4RMWA 5GQBA 3WV0A 3T3MF 1OT2A 1FGVH 4G80A 3I6LD 1ZHNB 5F3HB 2AVGA 1S9XA 4KJPD 5GGTH 4WY7H 4D0CA 2DLTA 3THMH 3HPLB 5TDOB 3HR6A 4XNUH 4R7NA 4OZIA 5D2NC 1XEDA 3EOTH 5ERWA 2JJWA 2K7QA 1WAAF 1DR9A 1AHWA 4LKCB 1I1FA 1U8NA 4CVUA 4QRRD 1FVCB 4OCWH 3S34H 5HYQB 4R4FL 1OP9A 4R8WH 4PUBL 1GOFA 3OBAA 1NDMB 5I66A 3SCMA 4EI5C 3G08A 5DURB 2H6PB 4P4KB 5I16B 4J12A 1QHPA 3B83A 2AV7B 1J1OL 1U8KA 5KAQG 1KLGB 1L9NA 1P5UA 2HT2C 5D6DC 5ENWB 3G6DL 4HIEA 4ODHH 3MOBH 4AMKL 5C70A 3T8XA 4K8RD 5DEGB 4PJIB 1IEAB 3G04B 4J3VA 2PF6A 2R29L 5KSBE 4ZNCD 5I19L 2AEPL 5IROC 4H26A 1NANI 3ARBB 3HC0B 1RK1A 4X8JB 4APQA 5T5NF 1T20B 3PP4L 4LPWA 1U2CA 4JY6B 3T09A 1S7TA 1MCEA 4ODTL 5TGBB 1U8MB 1UKQA 2WNGA 4MVBC 4DN3L 1CL7I 3VFMB 4DVRH 2E5EA 1UACL 3I6KA 4NQCA 5IUSA 3O2DL 1UYWL 1JF1B 1I3GL 1D9KD 2BNRD 3QBTB 2ITCA 1HHJA 2JF1A 2DTMH 2ADFL 4F37F 4HBQA 2Z35A 5HSFA 2P7TB 5FIEA 4JDZB 4LF3A 5I8EA 4AMKH 5FB8B 3QEHB 2IFFL 3VRLE 1JHLH 5F1SA 5FO9A 3BXNA 3L3GB 1X5LA 4N0FB 1F58L 3MRRA 4U05A 2IH3B 2J5LC 1LO0L 3HE7C 1AJ7L 2DM7A 1HILB 1JTOA 2VC2H 4P5KB 4PJ9B 4BQ9A 4YXKH 2VZSA 1UEYA 2AEIT 4P5MB 5DK0A 5GRVK 4BZ1H 1CE6A 4XCFH 1PZ5A 1XF5A 3B9KB 5E8DL 3NPSC 2H6PA 3SDXA 2EE3A 1KJ2L 3ARDD 5JNYB 3U4AA 4MMXC 3WIHL 2Q86B 1MFAH 2OL3B 5D6CA 4LVHB 3P4MA 3U7YL 3OXRA 2M2DA 4IRZH 3WS6C 3LSOA 1C5CL 1Q9KA 4N5EC 1DQTA 3W9DA 5E95B 5KOMC 4LCWE 4BSWB 2HAZA 3BIAX 3KPNA 3X13B 3SHSA 3BH8B 2GAZA 4MDIB 5CEYB 1MCRA 1FNEA 3RUGE 1CR9H 3IFLL 1TQBC 1VERA 1HXYA 1NEUA 2WV3A 5HVWA 4IIQC 4I0PC 3KPPB 3RWEA 4HW6A 4XP9H 4PPTA 4JQIL 4ZTOH 2BOBA 2XWBA 4Z95H 3AMKA 3FN0H 2D7MA 4TNWF 1U0QA 3ZKND 1U2HA 4P3WA 2RB8A 4NO3A 4LEOB 1WSST 3TVMD 4X5XA 2ADJA 1LEIA 5DC0A 3QEQD 3L1OL 1I1AD 3GMLB 1SJEA 4WWKD 5K93A 3JBG7 3FQUB 3LOWA 2H26B 5FF6A 4MA3B 3HUJB 1CDCA 4UNTA 1NGYB 4TULL 4RZCB 4JHAL 2EKSA 5H35B 1S9VB 5E9DA 2ZKHL 3VE0B 2ILLA 2XWJB 3PIQA 4JFZL 3DHJA 5D1ZA 2M8XA 5FYLH 5GHWH 3AXLA 4GRLD 3BIKA 3STBA 4LP5A 5HGGS 4P2RB 4LSPH 3QI9C 4Z78B 5A2KH 1U8HA 4O58L 4R3SB 3BWUC 1BJ8A 1A1OA 1KCUH 2IC2A 1KBGL 4X5WB 3WFDH 1G7IA 4HWEH 2XN9B 4JREB 3RAJH 1I7RA 1KIUA 2C1PB 1T1YB 3QI9B 4JPKL 3DVGA 2HTLD 1LK3H 4HXAL 3RNQA 4HV8A 3V4VH 2BP3A 4AQOA 5IB3A 4J6RH 5FCSH 1JGUL 3V6FA 3OKLA 3TYFB 1LP9E 4I18A 2IBBA 2FB4H 2VLRA 1ZVSA 4NKMB 3C5JA 4HKJB 3QXUA 4K3DH 3TA3D 2DQHH 1XFPA 1S7QA 2DBLL 1FDLH 2AI0L 3TPUB 4XVTH 3C5SB 1KTDA 2NY6D 3E6HA 1KJMB 2F53E 3D87B 5HI4C 4YFEA 3TVMA 2DQCL 3QJFA 3E0GA 4DZBB 3CIQA 2OXHA 4NPYA 2GY7B 4GH7B 4J3UA 1GC1L 2R1YB 3Q1SH 1ZMYA 3VWJB 4JFFD 4B0MM 4NJAL 1E6JL 4F7EB 2ZP0T 1P4IH 1FGNH 3K3QA 5C08D 3PWUA 1PEWA 2I60L 1TTFA 3H9HB 4FFYL 2WP3T 4ZAKB 3S97C 1BF8A 1M71A 4PJIE 4HJ0D 4LLQB 3QDME 3IS1X 1NC2A 2R0KL 4AH2A 5HYJE 4Y8DC 5C0AD 1DLHB 5C0AA 3WDJA 5D8JL 1MIEL 4PJ8A 4PJHE 4N1EA 1I1AC 4MWFA 5MEPB 3PL6C 3ZKMC 4YDKL 1FNHA 1NC4D 1YEEH 5I9QC 4EBQH 2EXYC 1IAIM 2GK2A 1LE9B 4WJ5B 1ADQA 4M6ML 1ZAGA 3IDNA 4HIJB 2BSTB 5AZEL 3QCUL 5I6XC 3HI6L 2ICWI 1MCIA 3H42L 2OJZL 3LEVL 1AC0A 1Q9KB 3SKOA 4JN2A 1AGEB 3DURB 3RX8A 1CFBA 4LAQH 4WNQB 5J06A 1KB5B 2BZDA 4K3JL 4AENB 3CLFL 3ULUH 1RZJH 4S0TD 3O2WH 5IVNA 4WV1B 4CVZA 1JNHA 4TTDC 2LU4A 3GBLA 4QGYA 4FQHA 4S2SA 3MRLB 1PAMA 4XPFH 1UM5L 3P4OA 4WEBH 4CVWA 3ARDC 4YDKH 3KLAB 3W5MA 4JDTL 5GIRB 5DRWB 5DGRA 1AY1H 4I1NB 3VU2A 2XY2A 5DJ2A 2UVEA 5IW6B 4IMKC 3KPOA 5ID1A 3GMPA 3H3PH 2JJUA 4K2UL 3VXNB 4K3JH 2YBRA 4UZGA 1KN2L 3DX8A 2AJZB 2YSSB 5JUEL 3WSQH 1JPSL 4DN3H 4NQCB 5BS0B 3JSSA 3VXTA 2WW8A 3EOAB 5EU7E 1A9BA 4YLQT 3I6GB 5ICZB 1MIML 3C09C 4WU7A 1VKXA 5BXFA 5CUSL 4TSCH 4F33B 2L7JA 3SCMD 1XF4B 2NPLX 4TUJB 5EFIA 3HNSL 2XZAH 3N9GL 5IBUB 3WE6A 1GPOH 5HY9B 2W9EH 5FUZH 5K9QG 5F9OL 4TOYL 3OB8A 4KMTH 1KEGL 1NGXB 1RQ5A 4TPRL 1PX4A 3TFKC 1S7SB 4W4OC 3D39A 1MI5D 4PP2A 2Q8AH 5KS9A 1LO0H 1CN4A 1QSFA 2P24B 5C9KA 4U1HB 4N0YL 4HKZB 5DTFB 5DFTA 4ZFGL 1QFWL 1DQDH 5ALCH 4KI5C 5F1IB 1AIFA 2NW2B 4UT7L 1U3HD 2Q8BL 4DKDC 1ES0A 4R3SA 4U3HA 1C1EL 4OSUH 4IRJC 2V2TB 3BT2H 4KUCD 3OWEA 4MQ7B 1BZ7A 3L3OA 4JRYD 4NBXB 2C4FT 1FC1A 5MHSE 4IRZL 4LQ1A 4G7YL 4YNYB 3TZVC 2VDQH 4TOYH 2CUIA 3GSVA 5HGAA 3QUZD 4ZUSB 3RL1B 3MV9E 1YMMA 4DEPB 1QA9A 2A77L 2EDKA 5EULV 2C3HA 3L3KA 3K2MC 3V5HA 1J8HA 3HNTH 3QZWA 5BCAA 1NUNB 4Y4HB 1JYVA 2YOCA 2X40A 4UTAH 1CGYA 4OZHE 3I50H 3FO2A 1JN6B 2RBLA 2YWYA 2ZUYA 1UXWA 4YQXL 2BSED 1X5KA 3EFFB 4DK6A 4GXVL 3NZ8A 4WTZA 1BVZA 2DL9A 2QSTA 3BT2L 4G7VL 5DJ8B 5C1MB 1T5WB 1TCRA 3RTQD 5IWLA 1HEZB 3WIFA 4ZXBA 1CFNA 2Q7NA 3GSNH 1WBXB 2Q76B 3MRPB 4PS4H 5GGVH 1A6VL 3DBXA 1HXYB 3EOYG 3PV6B 3X13A 5LGJA 1K9TA 1UG9A 2A77H 3QSKB 1UC6A 3LIZL 5GZOD 2I24N 1D5BA 3BQUD 1U91B 3CFBB 2D7TH 4XMLH 5CSGA 3T2QA 3UYRH 1ND0B 2Q7YB 2VDOL 1MAJA 3K0WA 1BEYL 3SE8L 4LVEA 3N1MC 3UBXB 3GBNH 5I74C 5TH2A 3IU4H 3I75A 3THML 4FZ8L 3MV7E 4WO4D 4H0HB 1IFHH 4XCNB 4ZD3L 4QNPE 2NY1C 3T2NL 1QR1B 4ZUTA 1Y6MR 3IFOA 3JWDH 2MPAH 4R4FH 2WWMC 3BE1L 2HKFH 4JKLA 3PGCA 4XP4L 1LP9F 4Y7MA 1U58B 1P5VA 4L3CB 3L3IA 3A6BH 4LSVL 4M7ZB 1Z0NA 2CO6B 1BQHB 3ROOB 3WXVL 3HI5H 3T2PA 5BV7C 1ITBB 2H3NB 2VJXA 1QEWA 3GRWH 2Y6SC 2C3WA 2Z4QA 4MCYA 2XA8L 5B4MC 1E4XI 3P9MA 1LEKB 2F15A 1KGCD 1FGNL 4MD4B 1BGXL 5KTEL 2UUDK 4WUUB 1T03H 3R4DA 3RKDD 1O7SA 2BOCA 4LU5L 4LKXB 3GIZH 2EYTB 2C1OA 3JWDL 1JV5A 1W72B 3MCG1 3TH2T 3IFPA 4I3SH 4U7SA 4DZ8A 5DD1H 1DQMH 3OZ9H 2F54D 1U8OA 3ARUA 4X4YB 1B0WA 1MAML 3VI3E 5HHNB 5DK3A 2A6DA 4KV5F 2X9WA 5B4MD 1BECA 1IGIL 4YHZL 3U0WL 4J23A 1NQBA 4UU9A 5FHAL 1YN6B 2VUYA 3EHBD 4RAHA 3RTQA 5I15L 4CRPA 1WCBA 4AZ8A 1QEWB 5DHVH 3VI4E 3AB0C 4G3YH 4M7KL 4MB3A 4FTVB 5IMKB 1T0MB 4PG2A 2WMPA 4U1GC 4P2OC 3GGWA 4MNHB 4YK4C 4P49A 1ONQA 3PHOB 2CKBB 2DWEB 2AJZA 2YSSA 4YDJA 3RQ3A 1I8IA 4LCIH 3CLFH 5FECB 1BOYA 4I3SL 3PGCB 1JUFB 1BOGA 3OKMB 3LAFA 4LOUD 4C4KT 3C5ZB 5J9PB 4PJ7E 4DKEH 2XZQL 4PJGB 3GHBL 2J1KA 1RY7B 1PQZA 2X4RA 1VFBA 2YPLE 2NY0B 4HUXA 4YHOL 4WCYH 4LSDA 3JWDC 4PJCE 5F3BA 4QRQA 3QUYD 5D7IE 4PJGF 3O3UN 5F89A 3RWIB 3C8DA 1PGRB 3L1OH 3O8XD 4POZC 1CYGA 5FHBL 4YHIA 2RR3A 3ULVD 2IGFH 2OLDA 2VDPL 2F58H 5B21A 2QQKH 2WANA 5I1IH 1Q38A 5I2IA 5HDLA 4FFWC 4UT6H 4FXGA 4OZFH 5JHDE 3DSNA 4TSCL 5IBTH 1KXVC 4GAFB 1ZT1A 4JZJC 1CTNA 5FUOL 1DQJA 5GGRB 5DHYB 5E2UL 2WBWB 3AY4A 4NO0D 1OM3L 2YN3A 3MLZL 5GSVB 4KMTL 4TTDD 5HBBA 3QDAA 1EXUA 4CVXA 2E8YA 5CHNA 1MCNA 4LPYA 5AUMA 3FCTB 1BVKB 3KPMA 2P8MB 2IGFL 1MCQA 4JY5L 3U2SB 1QFWM 1P2CA 1QSEB 5DVKA 1G9EA 3PUCA 3RVTD 3WJJC 5C08A 1S7UB 2PYFB 2BNQE 3QHTC 5CIPA 2KBGA 2X89A 3OJ2C 4AT6B 1UM6L 3PWLA 3NFPB 1MCBA 1SJHB 4TUKL 3UTSB 5GZND 4XP6L 4EOWH 2ZOKA 4FN0A 1PG7X 8FABB 3LQAL 1B6DA 4XVUD 2V2WB 1F6LL 1CD8A 4HJJH 1H5BB 2V2TA 2FSEB 3X11B 3MRIB 2OTUB 2WUBL 1KPUA 4ZQKB 2FB4L 4XPHH 4LBEA 3NBNA 1CDGA 1QHOA 5E0QA 4MNQE 1DANU 2VDRH 3TFKD 3SCMC 3CK0L 1YEFH 4YE4H 3STZB 5KANI 5GXBB 5IB5B 5I75B 5K59E 2AABL 4WU5B 2NXZB 2VDMH 2MNUA 4JO3L 1BBDL 5C0JB 4HS8L 1W0YT 2FX9H 3MLXH 1CGVA 3IDMA 4HH9A 5KSAA 1CGSH 5JIPA 2DBJA 5HY9A 3MRHB 3NCJH 4NM8H 3IKKA 3WE6B 3ME0A 3QAZB 3SJVD 5I1AB 3DMMB 2EIDA 1A14H 4WU7B 4K9EH 1VKXB 3UBXG 4AIOA 2W60A 4Y5VB 1YQVL 4JFFA 2X4TA 4LEXL 1G84A 2VLME 3LN5A 4KJQD 4UOW1 2NLJB 3DX6B 4R96A 2WIMA 3BH9A 2DM2A 4FQCH 3H9SE 1T22B 2AABH 2DYPA 2E6JA 5C6TL 3S4SA 2VOTA 4PJ5B 1Z9LA 3PABA 2HT4C 4H8WL 1LO4L 5T5FL 4Z7VA 4G9FE 1HHKA 4HUNB 3LN9A 1VFBB 1SJEB 1NMAL 4KZEL 2ATKB 2HJKA 5F9WB 4Y16A 1TFHA 3VJ6B 1I8LA 1UKTA 1P1ZA 3FQWB 3LPGA 1N64L 4LVHC 4KHXL 3VW3L 4JGMA 2G75B 4I5BB 1JE6A 5ISZE 2VZOA 4IIQB 1K5NA 1K3ZA 2WLYA 1U8IA 3CLEH 3GSWA 4D0DB 1TXKA 4NC1C 3V6BR 4PRDA 3KPNB 4RGNB 3MJ7A 4WENB 3ULVL 3QQNA 4KKAC 4XPFL 4OZGE 3O41A 3GO1L 2Z31A 4NQDE 3KLHD 1AR1C 2HFFA 3QQ3B 4HZLB 1FFOB 5DMKA 4FZEL 2ADIB 1OP5H 1NGPH 1J0JA 5E00A 3B9VA 4LLWB 2FECI 1CXLA 5F96H 2ESVE 5TDPA 1XF3A 1T2XA 5DRXA 1ZE3C 4E0RA 4ORGB 43CAA 2A9NH 4XH2A 4HLZH 4LU5H 1NSNH 3HZVB 5E9DD 5EIQA 5M94B 5T3XE 4KDWA 1CDHA 5C7XH 3IFPB 5HHMB 3MOBL 4M61A 2X70B 2H2PD 5L88L 2R1WB 1IAKB 5E2WH 1UADC 2BHZA 5CILL 1RZIA 1MAMH 4F7TA 3NOIA 4F57L 1P53A 4FXKA 3GO1H 5TDNB 1NFKA 1MHCB 2R0WL 2IANA 3U0WH 3O3AB 3L5XL 4CW1A 5HHOA 4GW5B 4OGXL 5GZNC 4FZEH 2EDYA 4MCYB 4ZFGH 3QXTA 4Z7WB 1K4DA 5HI4D 3X12A 1T7ZA 1R5IB 5GPRA 3LN4B 3H7LA 3L9RB 5I1EL 2Y1VA 1MLCB 3OR6A 4ZMAT 1C16A 2PW1A 4KPHH 1RFDL 2CLVB 1OWRM 2FZ3B 3SGKA 3HE7B 3PHSA 5CBEB 4FQ1H 3VDBA 4JN1L 5ALCL 4H26B 3V79C 2GSIB 2XXCB 4PJ8D 3RKDC 1MH5A 4KUZH 4R7DA 2DWDB 3TJEL 5KVEH 1A7PH 3U30B 5L7XH 1SMOA 4K3EH 3CXDH 5I1LA 2Y6SD 4EN3C 4DVBA 2HKHH 4GS7C 4PTUA 5IVXF 2ADIA 1FNGA 4WCYL 5C71A 1MCLA 1LEGB 3BSZH 1FV1B 1U92B 5IFJA 5EORH 1UA6H 2BNUB 3KXFA 3WFCL 5TQ2H 1SEQL 1WIUA 4WWID 4RGND 1Q9LA 3ARSA 1U8IB 5BV7H 1Q9WA 5SX4I 2DJUA 2P47B 1RPQA 3QUYB 3VFNA 1WIPA 3GNML 1MAKA 4QRPE 4QTHA 3U46A 1JPTH 1G9MC 3SDDA 4WWKC 5FV2A 2IAND 5D7LB 3SDXF 1GZQB 1U6AH 4QXTB 2GJ6E 3L6FA 5GRUL 5FUOH 2YPVL 2HTKC 3U83A 4S1SH 1FPTL 1NFIB 3GMLA 1HHKB 5GGSY 3QP3A 1A6VH 1JI2A 1FQ9C 4LDLB 1X5IA 1LWRA 2BVPA 3ULVC 5J3HC 1RZGB 2YKLH 3RIFF 3QO1B 1YYLL 1TZGL 4HUKB 3UPRB 4YH6A 5HVGB 1J10A 5F7YC 4ZXBD 1UQSB 4YC2C 1QKZH 4LSTH 3S6CA 5JQ6L 3TLRA 3LKNA 3DRQA 5T33H 1CFSB 4O9HL 4ZQKA 5D96C 5EOCL 5CJ5A 3C60B 5CEZD 2VKWA 3HCVA 5E6IA 4JRXA 1RK0A 4MAUH 1S9YB 4Q74A 1IILE 2E6PA 1OAYL 3OXRB 4S1SL 4HT1H 2OL3A 4Y5XA 1RUPH 2YK1L 3MR9B 4BK5A 4NRZB 1LO2L 3BJLA 5DJAA 5K9KA 2Q6WA 5LGKA 3RIAK 1NUFA 1XGQA 1A1NB 3O0RL 4YUEL 2JB6B 3KHQA 3GRWL 2D7NA 3CVHB 5DTFA 4JVUA 1SM3H 3U2SA 4M8QB 4J3TA 1HILA 3OAUL 5L2JA 4G42A 3N1QC 5A2LH 4WFGD 2OZ4L 2VMFA 3N1GC 5I8KH 2WIIA 5JW3L 3D18B 2P5EE 3MLXL 2GTWA 3OXSB 1JP5A 2Y36L 2L4OA 4XB7A 4P2YA 3QG7H 2DQJL 4WUKL 4NSKA 2XA8H 5JR1L 3O4OC 4L5FH 5EDXA 3SPVA 4F9PC 4MA8H 4S1QH 3TH4T 2W65B 1RJYB 4UIKL 1B0RB 2ESVB 1CXHA 3D25B 2W91A 3BHBB 5DFWH 3UTTE 4A6YH 3MUY1 1OAUH 2XIDA 1BZ9B 5T3XL 5IVOA 3CFKB 3MREA 4OZHF 3O3AA 3H9ZA 1WLHA 5FOJA 3D2UB 4NN6B 5CHNB 3E6FB 1BD2A 4HKBB 4XP5H 4HG4J 5D5ME 3NGBC 3SDAA 1EEYA 1TVHA 4F7TB 1ODAA 4JRYB 3G9VA 5F97E 4YHZH 1ADQH 3BD5A 3L3JB 3PHQA 5DEGA 1H3TA 3TNNA 5T1DH 4GRWE 1U3HB 5IJKA 1MREH 2VR4A 4XNZC 3LZFH 3O3EA 4PRPD 2ADGB 1YC8A 2VE6A 3IRZA 1MCPL 3AC0A 1S7RB 1QYGL 1EO5A 3GHBH 3MRLA 4ORGA 43CAB 3GI8L 3PWNB 4QOKB 1MHPH 3SGJC 1JNHB 2R23B 1M1SA 3TBSB 4F2MA 1Q94B 5D7KE 3QUXD 1KB5A 4JM2A 4PGCB 1FAIH 1AGEA 4G5ZL 4QHLB 2Z31B 5KW9H 2NY5H 3PP3H 2FHFA 4ZFOB 4JM2D 2QEJA 4OZIB 3D69A 4IIQA 4OZHA 1UWGL 2P44B 3O2WL 1AE6L 3VH8G 3SO3C 3OJMB 3MACH 5C86A 5L2KA 1JFQL 3O6LH 3VXUA 3FO9B 4NO5A 4ETQB 2KUTA 3MC0A 4H88L 5K9QI 4DZ8B 4PJBE 2CKBA 1BD2D 1NC4A 4JG0L 1TNMA 2CLRB 2YEZB 2YPLB 3L5WB 3QFDA 2APTA 4X4ZA 2Q3AA 4RFNC 3MA9H 1FH5H 1V7ML 4X6EA 1Y6KR 1KELL 4Z0BL 5IBTL 1JPFA 1H8OA 2X4PB 1X5ZA 1RZFL 3HMXL 1UEMA 3C8HA 2QQLH 3H3BC 1JZ4A 1U41A 1KCKA 4HFWB 3PV7A 4FQ2L 3OJDB 1X5JA 2XZAL 4F15C 1PLGH 2F53D 3MLSL 4NDMA 1Z9SA 2IWGA 3BESR 1WQVT 2EYRA 1YECL 3WNOA 3UTTA 1K85A 4ONHA 4RGNE 4MD5B 3LQAC 3ZKMD 5LAXA 3RU8L 4P48A 3GB7A 2UZYB 5JO5A 3ZL4H 2HLAB 2C1PA 5I1JH 3R0NA 3VGGA 1S5IH 1JWUA 2PNDA 4LRIA 4JO3H 4Y2DC 2FX9L 4MNGB 5K9KB 3TBVB 1SEQH 5DEZA 1U58A 2CUMA 2QKIB 2X10A 4NSKB 4JM4L 1PDKA 2E9BA 3TYGH 1YEFL 4YE4L 3SKMB 4DWHA 3FJTA 4GW1A 2QHLA 4OI9A 1IM9D 4U49A 3QIBC 4JRXB 3O9WD 3ZT6A 5E6IB 2W0LA 5ADOL 3D18A 1A5FL 3KR3L 1HQRB 4ZSOB 2YA0A 1R3JA 1VGKA 1WT5C 2LVEA 3JTTB 2EDLA 4UDUA 2Q7YA 3ORJA 1A1NA 4PR5A 4LIQH 3RWCB 3C9NB 4XVJL 43C9B 4OT1L 5DC9B 5DO2C 2DQCH 3N0PB 3MV7B 5FK9A 3IJYA 2OJEA 4S1DD 4C55A 1AGBA 3QFJB 3GUTA 4QRPA 1YDPB 4FXLA 4NQDB 4KGJA 4XCYA 4KKBD 1J8HB 1TITA 1GZQA 4MSWA 1VSCA 3V6OC 1A7NH 2PYEB 3D39D 1NLDH 5DHXB 5GGQL 4HC1A 3BP7B 3RVXD 1KLFA 1MI5E 1RIUL 4ZSOE 3REVB 3QDMA 1IARB 3QO1A 4QTIL 3IDGB 1ZSDB 2Y23A 1E6OH 1FNAA 4RAUA 1BX2B 4M7LH 3L7FB 2R0LH 2I5YL 5EN2B 5IFJB 2VXUH 2OR8A 2ZUQC 4KHXH 1VENA 3IXTB 3O8XC 3QCVH 3RNKA 1VEOA 3GBNL 3FB6A 3TIEB 3EYOA 3MRRB 5HHMD 2XQYK 4PJFF 1DEEA 1J88A 2HN7A 5C0CD 4P59L 4OI8A 1PG7W 2IF7A 2WUCL 2PR4H 5MERA 4LHQB 4WW1A 3QHZH 2P7TA 5D7LD 2HKFL 4YNYA 3JV6A 4NQXB 4DEPC 4S11A 4H1LB 3VA6A 3QO0B 4BJLA 1YEJL 2WWKO 1FLRH 2E6QA 2PO6C 1T2QH 4MGXA 4X7DC 2FEDC 1A0QL 5I9QB 4Z77B 2GUOB 4UUJA 3VFMA 5ISZD 1NEZB 2VKXA 1CGWA 5D72H 5IB1B 2ITDB 2DI7A 5H37G 2A83A 1S7TB 3DIFB 4H5SA 3OKEA 2WINB 1KG0A 1DP0A 2OMNA 2Z9TA 4HKZA 3TCXA 4UU9B 3ZT7A 3WS3B 2O5ZL 2Y06L 1CD1B 1U8LA 5JDSA 2EC8A 1DEEB 3BKYL 2EDDA 4KJQC 1QPXA 4P2QB 4KROB 5DJYB 1AXIB 2NY4C 4PIRF 1HSBB 2J8UE 2C7UA 3FO0H 3G5VB 2FGWL 3IDIA 4JRXE 3O9WC 3QNYA 1B6UA 1RULH 1IM3B 3SQBA 4QHKI 1S9WB 3HE7D 1BM3L 5D7JC 5DRXB 1ZLVK 4AK1A 5I66B 5KG9A 1E4KA 1MFAL 4HUUB 2A73B 5LKNA 2VZ1A 4DAGL 5IB2B 5SWQA 3CMOH 3KYMA 4XZUA 2R4RL 4ODXA 4OD3L 2CSPA 4U1LA 4JG1H 4DKFL 2PXYB 2I9TB 3H0TB 2EDWA 4L3CA 5AD0A 1QQDA 3HPLA 5TDOA 3EYOB 3QEUB 1S78C 3WUWG 1DE4B 4D0CB 2CRZA 2NR6D 4MDJA 3QNXB 2C5DC 3PWJB 5CP7A 4MS8C 5IQ9A 2BHUA 5KZCB 1Z3GL 2V7NA 2YXMA 5KVDL 4DKEL 1MFEH 2N56A 4S0SD 1D6VH 3IDXL 1BM3H 1LDPH 1WWAX 1NMCB 3CC5A 3KPSB 7FABL 2IAMD 4XMPL 2J4WL 3G9AB 3RWJB 4JN2B 2DOCA 2XTJC 3LKSB 1BWMA 1RIVH 5FGSA 1CG9B 2DYPD 1ND0A 3WJLA 2XI9A 5GRJL 5EU5A 3MYJA 1A6TA 2KH2B 1NBVH 1YYMH 3PWUB 3DX7B 4K7FB 3HNTL 2XWTB 5I0DA 1IRAY 4PJBA 1EMTL 5H37H 4E41B 3VWJA 1SVCP 4HAGA 3RVTC 4MD0A 3O6KL 2HWZH 5EOCH 3RBGA 1OP3K 3BPLC 1PSKL 4XPTH 4PR5B 4GG6F 4OF7A 1V5JA 4HX1A 4U6YA 1RZ7L 3QIUB 5CJOL 3CFEA 5ANMA 4GAYB 4U6XA 2YD1A 3ISWA 3MRKB 3MRHA 4CMMA 5I1KH 3ZHDA 3MLSH 1NCUA 4GAGH 2J7LA 4HH9B 1QO3B 5KSAB 2BJMH 1M71B 5AAMA 4KZDL 3VXME 3H9HA 4O02H 4F3FB 4IHOA 2DQFA 2DN7A 2FX8L 3P9WB 4WU5A 1NBVL 5DD6B 4AIZA 1BQHG 3SKMA 5D6DA 4F7EA 4CMHB 4EI5A 4RQQB 3FFCD 2V5RA 3OR7A 3L3DA 5I1JL 4LSSL 2W60B 3TBVA 4KXZH 1A7BA 5SWZA 3BN9C 3N85H 5DGQA 3HPJB 3CCHB 4PJ9C 1R24A 4DKAA 3QG7L 2CR3A 2JE8A 4X6EB 3IDMB 3E8UL 3B9KC 4HFUL 3MNZB 3QIBA 5HPMB 5IWLC 2LABA 3A0OA 4FS0A 2D03L 4WDIB 3T2NH 5IB5A 3MRJB 3QI9A 1N6UA 4X80L 2YRPA 3MLYL 4LASH 3FT2A 2R4SL 1VHPA 2BVEA 3BKMH 4OGYH 3OJDA 3TESA 1M05B 3ULVE 2DF3A 4NNPH 4S1QL 1KT2A 4XVJH 5IVXB 4QRRB 2IPUK 1EXUB 2OQJA 2X4QB 1KULA 2XWBB 4NM8L 2OR7A 3IU3B 4X6DA 5E56A 5TJWK 1MRFL 3GSUB 2NY1B 1BGXH 5KTEH 1GGIH 4OTXL 4ZNEA 3DPBA 5CEYA 1IGYB 2VSCA 3MV7D 4FQXB 1JNNH 5C08B 2P4AB 5F8QC 3S3JA 4KMLB 4JFYA 4JY4A 2DS4A 3VRJB 3D85B 2UWEA 3K4DA 3TO4A 5IV2B 3FB5A 1MCDA 2AV1B 2BRRH 5EZJA 5BZWB 3LZFL 1HIMH 1LEIB 1D9KA 5F7EH 5D70H 2C3VA 5IW6A 2O61B 2GJ6B 3MV9D 1LQSR 4P5MA 3CPLB 2BOBB 3H7BA 5ACZA 1DL7H 3HN3A 32C2B 5T1LB 1UB5B 4P4RB 2HFEB 2ORBH 4UDTB 4UOW0 4G3YL 2IBZY 3TCLB 3KG5A 1ZT4B 4G9FB 4LIQE 1K4CB 2CIIB 2LE9A 5GJSH 4EXKA 1NLBL 5F9JB 3K8LA 5ANME 1G9NL 4PV8A 3MLWL 4RFEA 3GDBA 1FLRL 4YXHL 3WD5L 1F11A 4Q97A 5FUCE 1R3LA 2PETA 3QNYB 1ZKAA 2BSTA 1C08A 1IZKA 5B3JF 3ARTA 5D1QB 1XGRA 2VL4A 1L7IL 3I9GL 3DUUA 3OKKA 3TGXA 4YBLB 2W9EL 1N5YL 3MFFB 3HR5A 5BRZD 4K7PX 3BEWA 3W2DH 4BQCA 4EEEA 1EO8H 2AK4D 3KYKH 3ARGB 4QRRA 3FRUA 3K1KC 5GS2H 2ZCHH 5CKAA 1FZMB 3OKDB 5KOVC 4QGTA 1JIBA 1FJ1A 4ZG1A 4YWGL 4WI2A 4ELKB 4LP4A 2PTVA 2IEPA 3VRJA 3X14B 4IDJH 3Q6FA 3VWKD 3ARGC 3NAAL 3FO0L 2YZ8A 2NCMA 4UT6L 1ZLSL 2FJFB 1B0RA 2ESVA 3D25A 3LPFA 4NN5B 1G6RA 4EIZC 3LB6C 4FQ2H 1UYWH 4HXBL 3GSUA 4OF5A 4X4MA 2DJ4A 2QADD 5HHME 1T20A 2F5AH 1PLGL 3BP5B 3HC0A 3RGVA 2XKUA 2IFFH 4DFIA 2BY1A 1TZIA 2WBJC 3K2UH 3OX8A 3KYKL 2AJSL 2DLEA 2BSRA 2LV4A 5FYJU 4QRRE 1SBSH 1S9XB 2VC2L 2NQCA 3NIFE 4GXUM 2PO6B 3MRJA 3I50L 1QFWI 3FAWA 2DIBA 3IXTA 3TYFA 4WO4A 2OP4L 3JTSB 4HMDA 5JZ7D 1KJVA 1A7RH 3S37L 3MODH 4PJFA 1OTUD 1A3RH 1PG7H 4OM1L 4WUUA 4NRZA 1KCVL 1AHWC 4RAVB 5DD0L 3MTRA 1HHGA 4BM7A 3S96A 1FYTA 4MS8D 2H3NA 1BBJB 3GSNL 4WTZG 5HDBF 4LNRB 4EDWH 3QWOB 3LQAH 4U6YB 3AAZB 1N5AB 2NNAB 4XX1E 3TZVD 5ADOH 1MFDH 1CFSA 3L3IB 1G0XA 1GAFL 2WUBH 3BKJL 4D8PB 4Z7UB 1H5BC 3OR7B 1ZHNA 5F3HA 5JHDB 4RDQF 3LS4L 3WFEH 1QG3A 1CLZH 1J1PL 2AXJA 1QD0A 3HRPA 4HMCA 4IS6B 2X44D 1U3HC 2VXTL 3UBXI 3WNNA 4LGRB 4XCNA 1NGYA 3VMNA 3C9NA 43C9A 4EXPX 3DBXB 1U92A 4NC2B 2R2HA 1KCSL 1L4IA 2HVKB 3JWOC 3F7VA 4YO0B 4RRPG 1KTLB 3RUGF 4X0KB 4QXTA 5FM5O 2CKBH 2PW2A 1KB5L 1IGFH 2FNBA 4NO3B 5D93C 4ETYA 1TQCC 3C6LD 5E94A 4L4TA 5IESL 1NANH 2GSIA 3UYPA 3FFDA 2E7HA 5I74B 3CAFA 4PJBB 4M43H 2APXA 2OI9B 3V4PL 1EV2E 4PREA 4GMTH 3WL9A 2MHAB 3BGFC 1G7QA 1DE4A 4E41E 3JUZA 2FIKB 1V7NL 5GS0C 4PG2C 3A6BL 4KHTL 4HDIA 1C16B 1QA9B 2BNUA 3CSYA 4PJGE 5F7HA 3PWPA 3S35L 1NBYA 4M6NL 4U1LB 2F74B 5DQDH 3RVUD 1JGDB 1W0VA 1JVKA 3CZFB 4PJHF 1DFBL 3IDJA 1VDGA 4HT1L 3SGJA 4UNVA 3CDGB 5JOPE 4GUPA 3V4VL 1DVFC 1XF5B 3NZ8B 3MLTA 1YQ2A 1A21A 3FKUS 4HK3N 3SGDH 3T3PF 5HGBB 1QLFA 2Y07H 3ZKXC 4NQDD 4PB0H 4IOIB 4AIXA 2VDKH 5HHVL 5C2BH 3QEUA 5E08L 5DT1L 2DI9A 2FEEI 3AFLA 2ZOLB 4U1IA 3S8WA 3OGOE 4NZTH 3EYVA 5ACMA 3HC3H 1T4KA 3AU1B 3W39A 1N4XH 4I48B 4PRAA 5TPWL 5ESQA 3OKNA 4JO2H 1D6EA 5EBLA 1RUAL 4GRWB 5I15H 5MEOA 4I0PB 3OKEB 2BNRB 3DNKA 2DAVA 2ZCKL 4UB0H 1PYWB 5HDQL 2HFFB 3X3FL 1TTGA 2EYSA 2OS7A 1GYAA 3RWHA 4BFBD 2CIKB 4OLXH 4I3GA 4L4VB 2Y7QA 1JK8A 4M1CD 2R56L 4JRXD 4OAWB 5CMAB 4Q0XL 1F5WA 3KYOB 5E8PB 2GHWB 4JPIA 2ICWA 3Q6FB 3X14A 2D31B 3F62A 4NQXA 2VDKL 5HTSA 3NCYS 3GMNB 5KS9B 4ZUVB 3VXRB 4ODBD 4OGAD 4DW2H 4R26H 3KYNA 4NZTL 3VFGH 1IEAA 4D9QE 1OARL 1IL1B 4JEGB 1DL7L 2EXWC 1MI5B 1MFCL 5I1HL 2GEEA 3ZDZF 1ZLUH 1EEZA 2BDNH 4L8DA 4PV9A 2QHRL 3HI6H 3VFWA 3S36X 2YRZA 5ICXA 3MA7B 3QNZA 5L8JB 4QRSA 3TBYA 3SCMB 1EO7A 2BRQA 3B43A 4JVPA 4Q0XH 4LAQL 2B1HL 4YX2H 1EVUA 1RU9L 2QQNH 2DQEH 3HB3D 3U7YH 2YPKA 3GSQA 5K9JL 2QQKL 4G8IA 5E6IC 1YEGL 2X1QA 5EU7C 2R23A 4XMKH 1FO0L 3MJ9H 1MPAL 5I76A 4M4PA 1MFEL 5DUML 4LSQH 1OTUC 1T0PB 5LCVH 1D6VL 4WEBL 2ADGA 5FV1L 3NIGF 2OCFD 3B5GA 3I2CH 5MENB 4PJ7B 2GT9A 1UB5A 4P4RA 4PLJD 3U30C 3KYAA 4NWTL 4XPGL 4KDVA 4F7MA 3M1BB 4Z18A 3MACL 4NQVB 1FIGH 3INUL 3QDGA 1EEYB 2Z8VC 1WBYB 5IEKA 4OZIE 3MXVH 1BD2B 5IFAH 2ZCHL 3TVMC 3QDMB 5IB4B 5BZWA 2NLJA 3BMVA 2ARJA 3VFRB 4YWGH 1DZBA 4DN4L 4XBGB 3WLBA 2X4TB 2BK8A 5A16B 3RPIA 2BJML 4HPYL 1CF8H 4BZ2L 2PUQT 2PYEA 5EB9A 2LAGB 1Z2KA 2P45B 1RJYA 3BPNC 3RDTB 3B2UC 3ARYA 1XCQA 4M5ZL 5SWSA 4M5YL 1T1WA 3KPRB 4JZNB 4YIQB 3GSXB 4I48A 5FK9B 1A7QL 4YPGA 4GBXA 1FNLA 2ZG2A 1LNUB 3RWCA 4OFVA 1S7UA 4M03A 4NWUL 3QR2A 3MXVL 4KJYB 1TZGH 1BP3B 4PRHE 3LQMA 4XNMB 2Y4SA 1FFRA 4FQQA 4IOIA 4MB5A 5FO7A 5F71A 3FOMA 5C6WH 2XICA 5KSUA 3E8UH 4UT7H 4KRMB 4WGVB 1C7TA 3HA0A 2VLRB 4WWKB 4YC2B 4I18B 4ZAKA 4N9OB 3X3GL 3MLTB 3V8OA 3HLAB 1R6VA 5E4EC 4HS8H 2V2WA 1A3RL 1VESA 2EH8H 2N7BA 1FCCA 2X89D 3QUZB 1WIOA 5DHVB 3O2VH 1MJ7L 4Z76A 4K3DL 1XGUB 4KKCD 4Z8FL 1DJSA 5JW4M 3VXMB 5C0FA 3CZFA 3G5YB 5IW3A 5I6XB 4UAOB 3P4LA 1H15A 1J0HA 5DA0B 3DSFH 4NKQB 1GL4B 1CT8B 5IW1B 3ABZA 1OGAB 2N1KA 2WP3O 3ARFC 3KPLB 4NWUH 2YD2A 3BIKB 3C60D 4PREB 4OZGF 3S3PA 2BY2A 5JXAL 4X80H 5M7QA 1E6JH 4JB9H 4LVOC 4JR9L 5DSCA 5HHXH 4O51A 2VQTA 4PYGA 4HG4K 3UXFA 4HIXL 3VGEA 5IB4A 2B1AL 3LKOA 4CVXB 4JFPB 4ONHB 3L7EA 3QXDA 4ZNEE 4P2RD 1HOCA 5E1HB 1GHFL 5HDBE 4RMVA 1G7LB 2H26A 2JELL 4PGDB 5F3BB 1MCFA 1M6OA 2R0KH 2DQJH 3FQUA 1HDMB 3GHEH 4NUJA 4F7PA 2J12B 2GT9B 3MFGB 4X5WA 1P4BL 4JO1L 5DC4B 2IADB 2R2BB 3EYSL 1GOHA 3VFPA 1FIEA 1VADB 2O5YL 3OB0H 3E3QC 3EJJX 4G8IB 3U4EA 5CZVL 3C08H 5DZLA 3QUYA 3ZYIA 4M62H 4BFIA 5HHXL 1P69B 5K33A 4B41A 4OKDA 5IVZB 1ZLVH 5TF1H 1AO7B 3H9SB 4K7PY 1SBBA 2FDBP 2H45A 2VQUA 3BDXA 4YEFA 5JLZB 5EU6B 1MNUL 3QULA 4YGVA 2ZUXA 4JRYE 4U0RC 3O6FD 1A4JA 2O26U 2ORBL 2PYEE 4PRBA 4XNYH 5IR1B 5EUOF 3OG4B 3WKNA 4OBRA 4PTTB 1K3IA 5CD3A 3MV9B 3V5DB 1DDHB 1I7UB 4CAGA 1BVLA 1JZ8A 1QYGH 5CJXC 3RZWA 1NAMA 2MQ3A 2AQ3A 3NH7L 3GFUA 2V7NB 2VXUL 1PD6A 1Q0YL 4Y2DB 5C0DB 3UX9B 4GOSA 5E2JA 5C7XL 1WITA 3AM8C 2BSRB 1RZKH 3MLWH 3TWCH 3QUMB 1EHLH 2VL5B 2NY3B 4K8RL 2R1XB 4YZFE 4ELMF 3UJTH 3H0TA 3OR6B 5ILTH 2QJDA 1IEBB 3H3PL 1N4XL 1MNUH 4XZUB 2NY1D 3GIVB 1RJCA 2BNRA 1RUAH 4KDTA 4PGZA 2G5BA 3EYUH 4CBPA 3WEXA 1YJDH 4J4PD 3TV3L 1HSAB 2UV3A 1MJ8L 1T5XA 1DBAH 3GKZA 4QWWC 3CH8A 1X6NA 2IANB 4HGMA 3WHXA 3EYVB 2Y5EA 4FXKB 1LO3L 2FLBT 4HSQA 5D72L 4X4YA 5DI8A 1Q0XH 3RY4A 5JXEC 1AQKL 1I8LC 3ARDB 3NZHH 4LPXA 3U9PH 4JPVL 5F7LB 1OQXA 3IGAB 2VWEC 5SV4A 1KEGH 3MLRH 4RGMB 4R26L 4ZYKA 1HWHB 2WIIB 4E0RB 3CXDL 4K3GA 1QUNA 5CS7A 4EZMA 4OF0A 1JGLL 5FA3A 4HF5L 5HDOA 1ITCA 1DBBL 3WXWL 1IGCL 3EBAA 2A83B 5DMKB 5IMLA 1INQB 4RMTA 3QIWB 3BD4A 3O41B 4Y4FC 1NAKH 3C6SB 1HQ4B 2W0FA 4OLYL 4ZAKC 1AR2A 5C0GB 1RJLB 4MNQB 1INEH 3HB3C 1RHHB 2BX5A 3ARBA 2JK5B 5CWSA 3VXUD 1QR1A 1EFXB 5ESAB 3DJ9A 4MJ5A 4JG1L 2HA1A 2VL5A 3AMLA 5BJTA 5JMRA 3ALPA 1ETZB 5AWNL 3HS0B 4M8QA 3FB6B 3TIEA 4Z7WF 3VXRD 1E4WL 2JB6A 4AEIL 1CXFA 3UPRA 1T5WA 1YUHA 5DK2A 3PL6B 1A3LH 2BNQB 4D0BB 4RBPH 3BKJH 1NCWH 3FO2B 3JV4B 4QRTB 4L8SB 3CFJB 4APQD 2X5PA 1H3PH 1PKQE 1J1PH 3MBXL 2QSQA 3U48A 3L6FB 5IQ7H 1IAMA 4PS4L 4MLIA 4DJMA 1RUKH 1TJIL 1B9ZA 1OPGL 1RMFL 3MV8A 4QXUL 1I1CA 2FO4B 5B3JE 4U31A 5H8DA 1WBXA 3HC4H 4FTVE 4Z7NE 1ORSA 1BBJA 2VXSL 1ZANL 1X7QB 4XP9L 1UENA 2J88L 3RZCC 1DBML 1ZHLA 1Y18B 1CDYA 3HAEG 1LO2H 5DJ8A 12E8L 4BSVA 1XH3A 4LK4A 2XFXA 4U0QB 4R4BB 3TNMA 2Z8WC 3ECBB 2HP4A 1AIFB 2NW2A 4N0UA 1G9ML 4KK5C 4NYLA 4QOKE 5I1KL 3MRMB 3C8KB 4R97C 3V5HB 3FRPG 1LDSA 1YMMB 5F21B 3REWA 3SDDB 4CL7A 4V1DA 5HPMA 2PXYD 4LCYB 1PX3A 4M6NH 4KC3B 5D7IB 4HGKC 5DSCB 3B2VL 3MLVL 1JZ2A 3VFNB 1N59A 4QHUA 4I2XB 3UC0L 3ZE2E 1MJUL 2AQ1A 5IOPB 3MGOA 5E5MB 1JF5A 4KDTC 5GGUB 2FEDD 1CT8A 5IW1A 1BFOB 1TZHA 3WXVH 5L8KB 1QBMH 4N68A 5IT2H 5IMLB 1H15B 4CUCA 4E41D 4XPHL 1A9EA 1UM4H 2YC1A 1FNGB 4MA7L 3QQ9D 1G9MH 1BAFL 1UXSA 3MGAA 4TRPH 1H3UA 1IQWH 2I9LA 3QJHA 4AIZB 5DD3H 5FKAA 1PJ9A 5LAXB 5C0BB 4L3EA 4NQTA 4OGAC 2E7MA 3HLAA 2VDML 1JGUH 5EPMA 3HAEA 2P8PB 4WHTA 2NX5A 1IAKA 5J0BA 1CD9B 2VLKE 3GHEL 4FFZH 1T1ZA 4G6JH 1EZVY 2WM0A 3BZEA 2B4CC 2AGJL 2Z8SA 3FHQA 1M7IA 1NCBH 3BUTA 3GI8H 2BY3A 1IGIH 4FXGB 1B2WH 2HYMA 1F02I 4NKDA 4PV8B 4PJ8C 2MCPH 1HHHA 5C0CE 2UZIL 2XWTA 5ID0A 3ARFA 2UY6A 3NCMA 2NX5E 1QLEL 1ZT4A 3FOLA 3MUJA 3KPOB 5AZ2L 3RWIA 3CVIH 1ZT7A 3G6JE 4AJ0A 5TQ0L 4HK0B 4S1DC 2OXGA 1MFCH 4HWBL 3TBWB 3VCLA 1WZKA 1VEMA 3BVNB 3WCYA 4MMZC 4N0CD 1D5MB 3CPLA 2BCKB 1KJ3L 2BNQD 3LQZB 3IF1A 1FL3B 2NY7H 3OMZA 3P77A 2FO1A 4PJGA 5DURD 4S2SB 1RZJC 1XF2A 5DJZA 1QSED 3RVUC 2AAVA 1DBKL 3JXAA 2KZ1B 2XN9D 5IGXL 1R5WB 4OZHB 3OSKA 3UTQB 3MPCA 1FYHB 4JFYB 3INUH 4XMKL 1P84K 1MY5A 2GTZA 2XG5A 4K94L 1MJJA 2AJVL 5FDWB 4I4WB 2WQ8A 4GRWH 4XTRC 3LEYH 2N4IA 3PWVB 4G6FB 2O5XL 4P46B 4YR6A 2VDPH 1WCBB 2GIYA 4JM2B 2AEWA 4PP1C 4FG6D 4PRIB 4WI7A 3PQYA 5GGTA 4NPYB 5D7JB 4Z7VF 4MWFB 5MEPA 4XC1H 4KI5E 1OAXH 4WW2F 1AKJD 1FL5A 2G2RA 3BZEB 5HD8D 3IDXH 4KKAD 3ARGD 3U9PL 5LXGL 1U3HA 4HHAA 4DN4H 5D2NB 4P57A 2HJLA 1S7QB 1C5BH 2AXGA 5EOTA 1OTSD 5DRZB 5B8CB 1DQLH 5J13C 5LQBH 1TDQA 2DM4A 5T1KD 3TIDA 1ZVYA 1KPVB 4F8QA 1AJ7H 3GMOA 1G6RH 3BDYL 3D2UA 4XAKE 3STZA 4JJ5B 4I77H 3EJZC 3D1MC 1I1YA 3CFKA 2Z4QB 1T7YA 3RWGB 4NBYB 2ITDA 5EOQH 3GZKA 5BQ7A 2OSLA 1SYSA 3O6KH 3MOAH 3IKCA 1IGJB 3R8QA 5E8DH 1MIMH 1JWSB 2EDEA 1MJ7H 4XCEA 1CLOL 2APVA 3TH3T 1A6UL 4AY0A 3CFDB 2DQUH 3T77A 4WFHD 1IKFL 1FFPA 3TYGL 3VE0A 1RVFH 4WW1B 4GAGL 2VTFA 4KY1L 2BVTA 1AGFA 1M7XA 5H35A 1JNJA 2VZUA 3B9KD 3IXAB 3U0TB 1G0DA 5JXEA 3NFNB 3S88H 2EKSB 1L9MA 1K8IB 2FX8H 3MXWL 4PJIF 3TM6A 4MCZA 5JPNA 5AWNH 4KRNA 4X6DF 4G42B 4Z7OE 3JVGA 4O2EA 4NUGH 1HHIB 2R9HC 1FZJA 5HYSB 1R3HB 5C07D 4LCWD 4NP4L 3HG1D 4Y5YC 4QHNA 3TNMB 1W72H 4U7MA 1BX2A 2WBJD 4X4XA 5BVPH 1RI8A 1FBIL 1XH3B 4GO6B 1QNZL 3AXLB 3DECA 3BN3B 3EHBC 4PGBA 3OJVC 5JXAH 1KENH 1KN4L 4MJ6A 3FMGH 4PD4J 1KIQB 5IJKC 4PY7A 3MGTB 1NBYB 2BFVL 2V9RA 3EYSH 4BSWA 3HUJA 3RVVC 3WL9B 5CGYC 5GGRY 1DQQB 4JFXB 3IFNH 4M8VA 1MHHB 3CFCL 3HRZB 3ES6A 5DVMA 1DBMH 1G7PB 2IPUG 3CXHJ 3VMPA 1P4BH 3VWKB 5HYJA 4ERSL 4BZYA 4YO0A 1MSPA 3RJDA 2ZSVB 4LSTL 2R69H 1FORH 3UAJD 3EOTL 1QQDB 4QLRA 3Q5YA 4P59H 2JCCE 1PKQB 3NFNA 5ETUA 3RI5F 4IS6A 4KK9C 4ZS6C 3W0WB 5JHDA 3WNKA 3T0BA 5D1XC 3T77B 2A73A 2ID5A 3A6CL 3F12B 3I6LE 3LKRB 5CLTA 5E8EB 4KGLA 3V0WH 1QSFE 5KG9B 4XCEB 4EVNA 4MQ7A 3TBYB 3O3BB 1WZMA 4EUPB 5HHPA 4XP1H 2WWKT 3DGGA 2DQGL 4HCRH 4P3DA 4CN1A 5F1IA 2H32H 5JIKA 2EE2A 1YJDL 5IHLB 1WICA 1DN0A 4MAYB 4G6FD 3ZE1F 1FN4A 2OTPA 4U1HA 5MEND 3OAUH 1AFVH 1HNGA 3NFSH 1HXMB 3FQXA 4XPBH 2JKXA 4X98B 2Y06H 3L3GA 4AM0A 1NPUA 1D3CA 1MEXH 4PJEF 4MLSA 2VLRD 4XVSL 4KTEL 4RWYL 2GJ6D 4B50A 2P8LB 4J8RA 5D2NA 4ZFFA 2EDQA 5HHVH 4QRUA 1J8KA 5JR1H 1W8NA 2E7LA 1KC5H 3BP4B 3DIFA 4XCCH 1RJZA 4IRSD 5DQ9B 3F8UB 5FYJL 1FL5B 1TZIB 4PRIE 1UACH 3HC3L 1A9BB 5T3XD 3RIAF 2ZUVA 2CIKA 3HI5L 4F9LC 4JFEA 1PYWA 3UZVB 3ZLQC 5J1AB 3QO0A 1AQDB 3G5XA 5T3XH 1WWCA 4WRLA 2MCPL 3BIBX 5MEOB 4NQEB 4UTBL 5CJQH 3S7GA 1Z5LB 2E27L 1ZGLM 1MOEA 2YD4A 3WUZA 5DJ2B 1NL0L 4Z7OF 4P2OD 5GS1C 4LCCB 4I18C 2UWEF 3PGDA 4JFEE 4ACPA 4Y4KA 3QUZC 1OTTC 4DW2L 3V5DA 3D48R 3C2AL 4MD4A 1A47A 4RMRA 1U36A 3I75B 3REVA 2J6EL 5BZDB 4J1UB 3C2SA 1PKOA 3T65B 3MJ9A 3QIWD 3SDYH 1CIDA 1UWXK 2QHRH 5AG8A 2IPTL 4Z0XB 2W0PA 3WIIL 4HIJA 4YX2L 2HRPH 1SBSL 1AI1H 3VXPA 2FL5B 4GRMA 1EGJH 4WJ5A 3MBXH 5IQ7L 5HHQB 4I3RH 4KKLC 2ZPKL 1TJIH 4ZUTB 2HWZL 2KQMA 2HTKD 4L4TB 4QO1A 4OLUH 1AD9A 3DV6B 5F8RC 4GMSL 4NZDA 4MXQD 3DXAA 3SOBL 2IQ9L 1G7HB 1ZS8A 1TPXB 3F6LA 3ALWA 3L3JA 3K4ZA 3V7AE 1H3PL 4LSRH 5D7LE 5DJXA 1HQRA 1WAAA 2A1WH 2NTFA 3ZTJG 1E4KC 2YHGA 5LBSH 1ORQA 4LLDA 4ZOEA 4PP1D 1XIWD 5IV2A 3HC4L 4OZFA 3UZEA 5CD5D 3KLDA 1DQQA 1GGBL 1EJOH 3ZO0A 3QZWB 1UCBL 5FM5M 4DQOL 5JQ6H 4JFFB 1QPPA 2R2EB 2VO5A 3L3KB 1OF2B 1URLA 1MVUB 3QJFB 3PV6A 5F1NB 5EO0B 2Y72A 2ARWA 3NGBB 5HGAB 1NGQH 3JV5A 4LRNL 4DGIH 1MQ8A 4PB9H 3LV3B 3WJJA 3SDCA 2H41A 3VXMA 5C0FB 1IT9L 3B3IB 3D85D 3GB7B 4CADA 3TPKA 3JUYA 2E7CA 3OKLB 4KKCC 4ZDHA 4XPAL 1N6QH 3REWB 3MXWH 1DSFL 3BQUB 2EXWD 4LASL 3DO3A 4JO4L 5DD3L 5IBLC 4KJYA 2C4FU 4NNPL 2YMXH 3DOSA 5I8KL 4KHTH 3HE6D 1HCVA 5DJAB 3RP1A 5IBUG 2XFXB 4IBLT 2OK0L 1N0XL 3F7PC 4Z8FH 4N1CA 1JPFB 1XF4A 4L5FL 5TFSL 2NY5C 4G6JL 5F6IC 2NZ9D 3HPJA 1T21B 4Y1AB 3EDEA 4WUUE 4DUXA 3ZKSD 4OCRL 4R4ND 4GJTB 3SE4C 1DVFB 2NY4D 3QUKA 3KPRD 4I2XE 4HWZA 3MRNB 3CK0H 1X5HA 5FCUL 1S8DA 4BKLB 3HNVL 1AGCB 1NAMH 1REIA 3TIDB 2YMXL 3WKMH 1SQ2N 4HPOL 4X9IA 3AREC 1AR1D 4H20H 1NFIA 1KF9B 5TQ0H 3M07A 4RX4D 1KPRA 4TUJA 1ACYL 2EZ0C 2JB5L 4UQ2B 5AYQA 1CDUA 3QIUA 3BPLB 1QTYT 4G8GA 5E6YA 1DVFD 3GM0A 1OF2A 1F11B 3B6SA 1OAZL 1T7VA 1PY4A 5GRZA 5F9WC 5GJSL 4ZS7L 4CVZB 2LTQB 1DBKH 1WCQA 5D2LA 1XIWC 3D5OF 4RMSA 2LQRA 3LKQB 4X9BA 4K94H 1CBVL 5LGHH 1CE6B 4XP1L 3W11C 4ALAH 1L7IH 2B7DT 3I9GH 4XHQA 1IAIH 4I13B 4DVBB 3ZDYF 3IAQA 3GK8H 5BVJB 1ETZA 2HFTA 3W2DL 1A1MB 4LQFL 4RGOL 1SEBA 3LRGA 3T1FA 2C3VB 4N0FA 4RIRB 2O61A 5BS0D 1GRWA 1N64H 5A2IH 5CP7B 2X6MA 3IGAA 4JFHD 2B0SL 3VCLB 2AK1H 2JJVA 3VXPB 2QSVA 3V52L 2DQEL 4UV7H 25C8H 2DLHA 2IJ0C 2W0FB 3KPSD 1BZ9A 1I9JL 4FQXA 1HI6A 3BHBA 1BQLH 1F4XH 4XHJD 2X42A 4FTVA 3SE9H 4FABL 3T65A 1FP5A 2GSGB 2JIXD 4CW1B 5F88A 4UILH 5F9OH 1YN6A 1MCCA 3DTXB 3IETB 1WVZA 2BERA 1KT2B 5IVXA 3DYMA 2HTLC 5GJTH 3BP4A 1H3XA 1KUMA 3V52H 4I77L 4HIEB 1RVFL 1XGYH 1ZVHA 4PLKC 3C5JB 1TJGH 2JCCA 4DGVH 4KH2A 4LPUA 1UZ6F 1BVLB 1RULL 1QRNA 4P4KA 4AM0B 1B0GB 3IYLW 5CD3B 4OM0L 4Q2ZA 1T5XB 3QCTL 4LPVA 4PJ7F 3IDJB 2DLIA 5I18H 3Q5OA 4HJGB 2LU7A 3TT1H 1J11A 3D0LB 1G7IB 1F00I 1R24B 1S5IL 3BPOC 3RHWK 5HHPB 1ZA3B 3PGFH 4F7CA 4LKCA 4L3EE 1U8HB 4XXCA 4YHKL 3UJIH 3H9SA 4D9RE 2A74A 5C9JB 3QPQC 2MHAA 3FONB 3CXHK 3KGRA 3PIQB 1KN4H 1OB1B 3TN0B 4OJFH 5D7IA 1ZVSB 1KNOB 2V5TA 4OCLC 1JJUA 5BO1L 5EIVA 3X3GH 2VZTA 3HUJF 3RGVC 2PW2B 1UH2A 4PTTA 4HUWA 2EH8L 2QV2A 1ULVA 2YD3A 4YEEA 1I9RL 5DVOA 1EH9A 1NEZG 1OTTD 2ATKA 2GQHA 1MY7A 3CFCH 3K1DA 1T1YA 1LILA 3AREA 3TT1L 2VB5A 5FA4B 4AEIH 4ODUA 3T0WA 3CSPA 2ADJB 3S4SB 1W0WB 3PGFL 4M9OA 4O4YL 4HIHA 4HKXA 5DMGD 3TZVB 3BGAA 4YBLC 1WUNT 2CRIA 2K3TA 2XWJA 2NY2D 35C8H 4OLVH 2CKNA 4R2GB 4HK3J 2DLFL 1FCGA 1L7TL 3FB8B 4JLRA 1TQCB 3EZJB 3MV8B 4P23D 2V7HB 1HNFA 2IADA 5EU5B 3NA9L 4MA3A 4GSDH 1EVTC 1CG9A 2CUHA 4XCYB 3HZMB 5GGQH 4KAQL 2ZUWA 4PB9L 3LSOB 1NC2D 2FYYB 3O4LE 2GITA 2UY7A 4XC3L 1BEYH 5EBMA 4O2CA 4ZFZB 4YJZL 3O6MH 4Y19A 1MELA 3WHE0 3IDYB 3RZCD 4KROC 3B9DA 3FFCE 3O11B 2AJ3A 4JO1H 4KKLD 4AYFA 4DTGH 4Q9QL 1KJVB 4XPAH 4LEOA 1U3JA 4X7SL 2GFBB 2G9HA 1N6QL 5GS0H 5DK0B 4FOMA 3BE1H 4TQEL 5FAAA 3PDDA 4JFXA 5C0IB 2BNRE 1KLUA 4JM2C 1MCSA 2A74B 1FAKT 1FNEB 5IIEA 1MCJA 4APQC 1H5BA 1MEXL 1JGEB 1ZA3A 1L6XA 3N85L 2VLJA 1D5ZA 3IJHA 2NXZC 4MYWB 1R5IA 3JWOH 3W5NA 3NFPA 1GGTA 1S7XB 3K74B 5D1XD 2B4CH 4KK8C 1UFUA 2VLKA 3EO1A 1YEJH 4NRXA 4Z76B 1I9EA 1JF1A 5C09D 1AFVL 1UB6B 4X7TB 1G6RB 3L3OB 4H1LG 1A0QH 3B9KA 1ZEAL 5HYSG 2NY6B 3U0PB 3F7QA 1ES0B 4OD2A 3O0RH 8CGTA 2LTQC 5CIPH 4PFEA 5FA3B 1J0IA 1I1YB 3GJFH 5EOCJ 4KJWC 4U1KB 3KXFE 3O45A 3EDDA 1NGZA 3L95A 1AD0B 4Q58C 3HZVA 5FXCH 5ESVB 1P7QA 2YD7A 3U7WH 3HZKA 1FE8H 2F19L 1U8LB 4EIGB 3QRGH 3WFHA 1LO4H 4GBXB 1FZOB 5T5FH 3BAEL 4NQVA 5C8JB 3MFFA 5TE7H 2HRLA 4LGSB 1R0AH 4MXWL 1DQJB 3PXJA 1MFBH 3OHXB 3OKOB 3BZDA 5B39A 5EFIB 1KG0B 2ZZUT 4ZUWA 1G7JB 4F33A 1Y0LB 3BGMA 4MA8L 2FGWH 4FMKA 4GG6E 3LH2H 3VFSA 4YFLF 3M17A 3C5ZD 4NRYB 4X8XA 1IC4L 3RPIB 3N1FC 4JFDA 5A16A 1NL0H 4ZO6A 4H1LA 1E0OB 4LFHG 4P46A 5JW5A 4RA0C 2IPTH 4BH8A 1JHLL 2OR9H 1FO0H 1YMME 2J3SA 1MIEH 3LEVH 5ICXB 3C2AH 4LARL 4JFHE 3KJ4B 4OV5A 3SDDC 5ITBL 5BVJA 2ED8A 3ULUE 5DFVC 1UGNA 3QEQB 1KLGA 1OLZA 4J4PC 3ARXA 1IGCH 3NA4A 1OGAD 5IEHA 2NY7L 5D7JA 4KUCF 4NJ9L 1OT1A 3G6JB 2B0SH 5H94A 1S8DB 4BKLA 2O93L 1T0NA 4WHYG 3PWVA 1YNLL 4OUOA 4FQJL 2GCYA 4LHJB 4PBWD 4OFYA 5DDHB 1U9KA 4RBPK 3H2WA 4P0DA 1T21A 4Y1AA 1IKNA 2YD6A 3SJVE 4ONGH 1IAOA 1D5IL 4AEHL 2ZG3A 5EWIL 1AE6H 2X09A 4ZOAA 3OHXA 1E4WH 2Q1EA 3WLWC 2IMNA 3WSQL 4DK3A 2P5ED 4TTGA 2FR4A 2E7LC 1NJ9B 1UH3A 5E2TH 1RFDH 2P5WD 1OW0C 1EBAA 1T2JA 2Y25A 1GGUA 4KROD 2YA1A 1HDMA 3HAEH 4HUMB 5JTWA 1U93B 5J1SC 1DLHA 2RJMA 4JPIB 1JV5B 1A6WH 1W72A 4Q6IC 1EAPA 3ZHLA 1HOCB 5KVFH 4L4TE 1EJ6A 3CJJA 1R5VB 1QRKA 1CK0H 2EYSB 3WIHA 3W11D 1GC1C 3BDYH 5IG7A 1KJ2A 4L9LB 1LEKA 1IZJA 4I0PA 4MAYD 4M1GH 1S7XA 1DQDL 1ZANH 4OQTA 3SDCB 4I9WE 5FDYA 3HMXH 3SY0B 3M45A 2R1YA 1CLYH 3CCHA 5IVXE 5F7MC 4K55A 1NCAH 3K2UL 4M1CC 1OWWA 2COQA 2DICA 4PGEB 2R9HD 1FZKB 2MOVA 3MRFA 5IIEB 2FLRT 1CGUA 2P42B 2MSPA 5ADPH 4UIMB 4D9QD 4LCUA 4NKOB 1QFWH 3GNMH 3IFOB 2HT3C 4M3KB 2B1AH 4NKIL 1K2DB 1YECH 5DS8A 4OCRH 5I1DA 5I8CB 5IK3B 4XWOD 3IJSA 2E9IA 1QO3A 2ESVD 4KRLB 3V6OE 3QJHB 4CMMB 1FLTX 5FO7B 3UBXA 4FQQB 4UTAL 1A7OL 3GSRB 3LV3A 4NZJA 1YN7B 1AGDA 4O2CB 5KSBB 3CFEB 1I7RB 3ALXA 3QRFM 3TO2B 3ZDYE 2AKRA 2IANE 5HI5D 1G0YR 3B8SA 4HFWA 2D7QA 4JKPH 1NFDF 3NABL 3QDJA 5CCKL 2C3XA 4ELME 1UM4L 2FATL 4QHUB 4UT9H 1FGVL 4JM4H 5SWSB 3EAKA 3LS4H 5GGTL 35C8L 2F5BL 3MRCA 1IQWL 1U8JB 4XXCC 1P4IL 1P9MC 5ITFA 3D0VB 5LGJB 2SEBB 4IOFD 2C9AA 1JGVL 2ICWJ 4WGWB 5KVGH 1EAPB 3BZFB 4L4JA 3RWJA 1J0KA 3WLBB 1UQSA 4QRQB 2X4NB 3RY6C 4YZFF 5D9SB 1EEQA 2X4RB 4ZUUB 1P7QD 5GGVL 3GJEA 4HJ0C 2IALA 3FQTA 5DJ6A 3EFFA 1OLLA 1X5XA 4JKPL 1VCAA 3JTSA 1J1OH 4G6KL 4I0PD 3HG1B 3DV4B 2FL5A 3RJQB 2R8SL 3LIZH 4Y4HA 1RZ8B 2APBA 4J3OC 4KU1A 4GMTL 4N8VA 4JHBA 3VXRE 4YDJB 1ZTXH 2NR6C 2H8PB 4HQQH 5DDHA 1TVBA 5I19H 4U1NA 1KEMH 1EFXA 1EERB 5ESAA 4FQXC 3EO0A 3HZYB 1FG9C 1RUMH 4QHLA 3KHOA 4ALAL 1SJVA 3ULUL 3QT2A 4MNQA 1QP1A 4QY8B 3PDOA 4OGZA 1WTGT 5C0GA 4Y4HC 2X4UB 4P2QD 1CVSC 5IF0A 3WJLC<