3CFWA

L-selectin lectin and egf domains
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
156
structure length
156
Chain Sequence
WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Glycan Bound to the Selectin Low Affinity State Engages Glu-88 to Stabilize the High Affinity State under Force.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords L-selectin
total genus 35
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2008-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00059 Lectin_C Lectin C-type domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3cfwA02
3.10.100.10 Alpha Beta Roll Mannose-Binding Protein A; Chain A Mannose-Binding Protein A, subunit A 3cfwA01
2BZ6L 5JBAE 1F02I 4DN8A 2PF5A 2VRPA 4GJ0A 1IODA 3NCXA 3MQEA 4Y71B 1XPHA 3V64C 2W26B 3NCWA 3C22A 1Y17B 1P1ZD 2XBYL 1HYRA 4PP8A 2GO0A 3R05A 3RS1A 1KWYA 4ZXXL 2BQ6A 2EI8B 3HPTA 1EMOA 3SOVA 4WCOA 1ZAQA 4NGAL 1MUQA 3U7UG 5CISA 1BJ3A 1TLGA 3N8ZA 4MMZB 1YUFA 2BPDA 1DV8A 1URKA 4LMFA 3VYJA 4Z0KB 3BX4B 1F0RB 3ZYIB 3WWKC 3HO4A 1CVUA 3N8XA 1YPQA 1KZB1 1YTTA 1HX2A 3WBQA 3NT1A 4ISIL 1IQLL 2MTIA 4ZESA 1RDO1 5F2QA 2H2RA 1UMRC 2BO2A 2KMB1 2VVCK 4RRXA 4XLWA 1QDDA 1BCH1 2OX8A 1Z6CA 2WFXB 3M37L 3BX4A 1I0UA 1YUGA 1YPUA 4BDWA 2GGXA 2BOKL 1P0SL 3NTGA 1O7CT 2BQWA 1FFMA 1KZC1 5K0HB 5JBCE 2FLRL 1MQ5L 2XR5A 2ZIBA 1FAXL 3BDWB 3K7BA 1EBVA 2XBXL 1KIGL 3GISX 2P16L 1NZIA 3L9JC 4D0EA 1KZD1 5F1AA 4WQQA 1LPKA 3DBZA 2RIAA 4LORA 1UV0A 5CKNA 1EMNA 2OYUP 4Y7AB 5B1WA 4Y6DB 4CAJA 3HO5A 1BV4A 2M94A 3C8JA 2CJIB 1F7EA 1X2TB 2NPRA 1K9IA 2XC5L 3FF8C 5IKRA 1KWZA 1DX5I 2W3IB 3FF7C 1COUA 1KZA1 3P5GA 1CCFA 1LITA 2FD6A 3TZIA 1V4LA 1FF7A 1RDJ1 1BUUA 1OZ7A 1G1RA 4WRFA 3KCGL 1JWIA 1SB2A 4XBMA 1ATBA 3QMOA 4MMXB 1J34A 4WREA 1KWXA 4GI0A 3HS7A 3SOQA 4BDXA 1BNLA 3Q3KB 1IQEL 2OYEP 4BXWA 1W8BL 4CSYA 2MHPA 2UWPB 4OTYA 1K36A 1X2TA 2MSBA 3EGFA 1HZ8A 3IKNA 2BOHA 2RICA 4JZDL 1KWWA 3BT2A 3KQBL 1HUPA 3BPSE 3ASIA 5B1RA 5K8YA 2OX9A 1J35A 3IKQA 1WHFA 1V7PB 2WPHE 2P3TA 1CWVA 1PRHA 3KL6B 2H9EL 1ATEA 1SZBA 1A3PA 5L2YL 1EPJA 2GGUA 2VWLL 1FVUB 1EZQB 1ADXA 3MDLA 1UKMB 1XFEA 2JKHL 1AFA1 3ENSA 1R14A 2RA0L 3WHDA 1BF9A 2FZZL 4PDCA 1UMRA 4KMB1 4N32A 2I9BA 5L30L 1YO8A 1EQGA 2J95B 3NTBA 4KI1E 1QFKL 1DQBA 2PUQL 5M62A 4MTHA 3P7HA 2H2TB 3TBDA 1KG0C 4YMDA 4N36A 4AQTA 4OTJA 4M11A 4NG9L 2C6UA 1ATAA 3LN1A 2G00L 2ZWKA 4ZETA 2RIEA 1HRFA 3K9XA 1AFD1 3CFWA 1XDTR 1RDI1 1UKMA 1TPGA 1IXXB 1ESLA 4BTTA 3DEMA 5IKQA 2MGRA 2P93L 3ALSA 1N1IA 3P7GA 1KWUA 4WUWA 4D0FA 2Q1JB 3FF9A 4WUXA 2BQ7A 5JVZA 1P4LD 2VVUL 1UZQA 4RUTA 4MMYB 1UOSA 3PAQA 1PW9A 4KZVA 1KCGA 1IJKC 1RFNB 3P5HA 1NFYB 1G1QA 3IKRA 3UBUA 2K2SB 1L5GB 1RDM1 1KWVA 1MOXC 4WRCA 3G83A 2BOXA 2Y7XB 3FBYA 5FFRA 3GPRB 2MGPA 1IJQA 2GD4A 5JB9E 3C8KD 5IKTA 1KLOA 1IP0A 2YHFA 3WBRA 1IXXA 2D1JB 2VH0B 2VWNL 1IJKB 1KWTA 5E8DA 1V3XB 1SL4A 3P5IA 3RR3A 4ZHAB 1FE2A 1WMZA 2RHPA 3SW2A 2E3XB 2PHBB 1KX1A 1QO3C 4QKGA 5JBBE 1LMJA 1UZKA 4KZWA 4N37A 3LIWB 3VYKA 4IOPB 2AYLA 5COXA 1V4LB 2BPEA 2BRSA 3KQGA 1CEJA 4GK1A 4X8TL 2W3KB 4O1ZA 2AFPA 1X7AL 1IOXA 2Y82B 3GCXE 1C3AB 3CADA 5J6GG 1HAFA 1IOEL 1TLEA 1RDL1 3TH3L 4G96A 3P5BL 1O5DL 1EGGA 1G1TA 3H5CB 4RRYA 4ZH8B 3PGHA 1HREA 1EGFA 3BDWA 4QKJA 1WHEA 1SL6A 5LGKE 4IOPA 2Y5HL 3KK6A 2XC4L 1U8CB 4QKHA 1OB1C 4FM5A 1DDXA 4GKOG 2KB9A 4LU5A 3P5DA 2YGOA 1CX2A 1KOEA 3PAKA 3CA7A 5FFSA 4PH9A 3CCKA 2Y81B 3IITB 1LPZA 1IQIL 4RRWA 1DY2A 2VWOL 2UWLB 3TGFA 1YUKB 3LTFB 1RTM1 3BT1A 4COXA 3ALUA 2EI7B 3N8YA 3UBUB 3P7FA 1KLIL 5KIRA 1J9CL 2ZQKA 3ELAL 3WWKB 2J38B 1IQHL 2WFTA 1SB2B 2FLBL 5I46L 4YLIA 1JZNA 5KTHA 1CQEA 5L2ZL 2P26A 6COXA 1DY1A 2OS9A 4JZEL 3KRKA 1MSBA 2LS8A 2WPIE 2ADXA 2WPME 4ZAEB 1U0NC 4M18A 2ORKA 1B9WA 3ZYJB 1IVOC 1CCVA 3OLUA 1EPIA 1BJ3B 3CDGF 3N8VA 3PARA 1RJHA 3PBFA 1Z6EL 4GJXA 5B1XA 1K37A 1E5UI 4J6KA 4M1GA 1DY0A 4J6NA 1KMB1 2P94L 4LQFA 3FFGL 3HO3A 3T3AA 4JZFL 1W7XL 3F1SB 2E3XC 2VUVA 2UWOB 1F00I 2FLGA 2VH6B 1UZPA 1E8IA 3POYA 1EPHA 1CVWL 1JV2B 5F19A 3F6UL 3WWKA 1BCJ1 5JVYA 1HT8A 1WMYA 1G2MB 2XBVL 2Y7ZB 1MPUA 1NQLB 1NPEB 1X2WA 3OLTA 1IGZA 2J2UB 2TGFA 5FFTA 2RNLA 3HS5A 1BYFA 1JBUL 4Y79B 4N38A 3VLGA 2WPKE 1PWBA 1FIFA 1KX0A 3TK5B 3N8WA 2WYGB 2P28B 2BOUA 4Z6AL 4ISHL 3U73A 1IQNL 4A7IA 1WT9B 2XC0L 1IQJL 1V7PA 1APOA 4RRZA 3G8KA 1AUTL 2KV3A 4TGFA 3WH2A 4E52A 4BTIA 1ATDA 4WR9A 4CUFA 3GPRC 1FIHA 1C3AA 1AFB1 5KTIA 1H8UA 1HT5A 1IQKL 3NJPC 1HJ7A 4G9AA 2RIBA 4N34A 2WG4B 1YGCL 1O7BT 1TDQB 3LTGD 1DVAL 1UOSB 3WSRA 4EZMG 3N8WB 1NFXB 4N33A 4S0UA 3P5EA 1JA3A 4X8VL 4YT6L 5CKMA 1FM5A 4JYUL 1TOZA 2W2ME 2XR6A 3G81A 1FAKL 2J34B 1PXXA 2VUZA 5IKVA 3LC5B 1OZ7B 2K2TA 3GPRA 2Y80B 1PGEA 1E87A 1T8CA 4ZRVA 2WYJB 3CENL 4X8SL 1LQDA 1IODB 4YZUB 4CUDA 3ZYGA 1K9JA 3LN0A 1PTHA 2VRPB 1N7DA 1L3YA 3QH0A 4J6QA 1EPGA 2I83A 2BMGA 2W2PE 1Y17A 4M10A 3P5FA 3HS6A 2EI6B 2WPLE 4QKIA 2I9AA 1MQ6L 1UZJA 2Y5GL 3CDGE 2WG3C 4C9FA 1U0NB 3ALTA 3V65B 2ORJA 2CL8A 4J6LA 4UWWA 4ZRWA 4RS0A 2P3FL 1B6EA 3M9ZA 2J94B 1XKAL 3LC3B 2XBWL 4YT7L 1HAEA 1U0OA 1FSBA 4M17A 3IKPA 2Y38A 1U67A 3QCWA 5JW1A 1YPOA 1EAIC 4O02B 3FCSB 4BXSA 1HTNA 2P3FN 4G1MB 1SL5A 1WU1B 3G84A 4X8UL 1HQ8A 1YXKA 4NA9L 5KN5C 2N40A 1NT0A 2PY2A 2WPJE 3LAQA 1Q4GA 4Z0LA 1PFXL 2W2NE 2IT6A 1U0OB 4AK8A 2M74A 1JL9A 1P9JA 1UEXB 1XKBA 1G1SA 1WK1A 2VVVL 2PR3B 2F9BL 4E1GA 1RDN1 1KZE1 1IQGL 1EGIA 1FJSL 3CS7L 4JYVL 4UXMA 1G2LB 3ZHGA 1J35B 1R13A 3HUPA 1LPGA 3GCWE 1IGXA 4XL1A 4D90A 2IT5A 4J6JA 4J6MA 1DIYA 1GK5A 3FD4A 1FVUA 1UEXA 2W2QE 1NFWB 4J6PA 5FDQA 3WH3A 2W86A 1GZ2A 2RIDA 1YXJA 1IQFL 3ZHGD 1KLJL 1NFUB 3TK6B 3WBPA 2DDUA 1WT9A 1F7MA 2VWMK 2BPHA 1KSNB 3KQCL 4Y76B 1EQHA 4BTUA 3Q7DA 3G8LA 3KQEL 2VJ3A 3KMB1 1TN3A 3SOBB 2KL7A 2J4IB 2KV4A 1JWIB 3GPRD 1F0SB 1HCGB 2W2OE 3M36L 4ZXYL 4C16A 1T8DA 3IJEB 1B08A 1M1XB 1RDK1 4N35A 1C5MF 1J34B 2YGPA 5CKQA 3VPPA 2P95L 1IQML 5JB8E 3KQDL 5EGMB 2P3UA 4Y7BB 2B7DL 2Y5FL 3C9AC 3N8YB 4CUEA 1XARA 1APQA 1X2WB
chains in the Genus database with same CATH superfamily
2BZ6L 5JBAE 1F02I 4DN8A 2PF5A 2VRPA 4GJ0A 1IODA 3NCXA 3MQEA 4Y71B 1XPHA 3V64C 2W26B 3NCWA 3C22A 1Y17B 1P1ZD 2XBYL 1HYRA 4PP8A 2GO0A 3R05A 3RS1A 1KWYA 4ZXXL 2BQ6A 2EI8B 3HPTA 1EMOA 3SOVA 4WCOA 1ZAQA 4NGAL 1MUQA 3U7UG 5CISA 1BJ3A 1TLGA 3N8ZA 4MMZB 1YUFA 2BPDA 1DV8A 1URKA 4LMFA 3VYJA 4Z0KB 3BX4B 1F0RB 3ZYIB 3WWKC 3HO4A 1CVUA 3N8XA 1YPQA 1KZB1 1YTTA 1HX2A 3WBQA 3NT1A 4ISIL 1IQLL 2MTIA 4ZESA 1RDO1 5F2QA 2H2RA 1UMRC 2BO2A 2KMB1 3S6XA 2VVCK 4RRXA 4XLWA 1QDDA 1BCH1 2OX8A 1Z6CA 2WFXB 3M37L 3BX4A 1I0UA 1YUGA 1YPUA 4BDWA 2GGXA 2BOKL 1P0SL 3NTGA 1O7CT 2BQWA 1FFMA 1KZC1 5K0HB 5JBCE 2FLRL 1MQ5L 2XR5A 2ZIBA 1FAXL 3BDWB 3K7BA 1EBVA 2XBXL 1KIGL 3GISX 2P16L 1NZIA 3L9JC 4D0EA 1KZD1 5F1AA 4WQQA 1LPKA 3DBZA 2RIAA 4LORA 1QIUA 1UV0A 5CKNA 1EMNA 2OYUP 4Y7AB 5B1WA 4Y6DB 4CAJA 3HO5A 1BV4A 2M94A 3C8JA 2CJIB 1F7EA 1X2TB 2NPRA 1K9IA 2XC5L 3FF8C 5IKRA 1KWZA 1DX5I 2W3IB 3FF7C 1COUA 1KZA1 3P5GA 1CCFA 1LITA 2FD6A 3TZIA 1V4LA 1FF7A 1RDJ1 1BUUA 1OZ7A 1G1RA 4WRFA 3KCGL 1JWIA 1SB2A 4XBMA 1ATBA 3QMOA 4MMXB 1J34A 4WREA 1KWXA 4GI0A 3HS7A 3SOQA 4BDXA 1BNLA 3Q3KB 1IQEL 2OYEP 4BXWA 1W8BL 4CSYA 2MHPA 2UWPB 4OTYA 1K36A 1X2TA 2MSBA 3EGFA 1HZ8A 3IKNA 2BOHA 2RICA 4JZDL 1KWWA 3BT2A 3KQBL 1HUPA 3BPSE 3ASIA 2HOXA 5B1RA 5K8YA 1LMMA 2OX9A 1J35A 3IKQA 1WHFA 1V7PB 2WPHE 2P3TA 1CWVA 1PRHA 3KL6B 2H9EL 1ATEA 1SZBA 1A3PA 5L2YL 1EPJA 2GGUA 2VWLL 1FVUB 1EZQB 1ADXA 3MDLA 1UKMB 1XFEA 2JKHL 1AFA1 3ENSA 1R14A 2RA0L 3WHDA 1BF9A 2FZZL 4PDCA 1UMRA 4KMB1 4N32A 2H9EC 2I9BA 5L30L 1YO8A 1EQGA 1KKEA 2J95B 3NTBA 2WZPP 4KI1E 1QFKL 1DQBA 2PUQL 5M62A 4MTHA 3P7HA 2H2TB 3TBDA 1KG0C 4YMDA 4N36A 4AQTA 4OTJA 4M11A 4NG9L 2C6UA 1ATAA 3LN1A 2G00L 2ZWKA 4ZETA 2RIEA 1HRFA 3K9XA 1AFD1 3CFWA 1XDTR 1RDI1 1UKMA 1TPGA 1IXXB 1ESLA 4BTTA 3DEMA 5IKQA 2MGRA 2P93L 3ALSA 1N1IA 3P7GA 1KWUA 4WUWA 4D0FA 2Q1JB 3FF9A 4WUXA 2BQ7A 5JVZA 1P4LD 2BT7A 2VVUL 1UZQA 4RUTA 4MMYB 1UOSA 3PAQA 1PW9A 4KZVA 1KCGA 1IJKC 1RFNB 3P5HA 1LK9A 1G1QA 1NFYB 3IKRA 3UBUA 2K2SB 1L5GB 1RDM1 1KWVA 1MOXC 2HORA 4WRCA 3G83A 2BOXA 2Y7XB 3FBYA 5FFRA 3GPRB 2MGPA 1IJQA 2GD4A 5JB9E 3C8KD 5IKTA 1KLOA 1IP0A 2YHFA 3WBRA 1IXXA 2D1JB 2VH0B 2VWNL 1IJKB 1KWTA 5E8DA 1V3XB 1SL4A 3P5IA 3RR3A 4ZHAB 1FE2A 1WMZA 2RHPA 3SW2A 2E3XB 2PHBB 1KX1A 1QO3C 4QKGA 5JBBE 1LMJA 1UZKA 4KZWA 4N37A 3LIWB 3VYKA 4IOPB 2AYLA 5COXA 1V4LB 2BPEA 2BRSA 3KQGA 1CEJA 4GK1A 4X8TL 2W3KB 4O1ZA 2AFPA 1X7AL 1IOXA 2Y82B 3GCXE 1C3AB 3CADA 5J6GG 1HAFA 1IOEL 1TLEA 1RDL1 3TH3L 4G96A 2JJLA 3P5BL 1O5DL 1EGGA 1G1TA 3H5CB 4RRYA 4ZH8B 3PGHA 1HREA 1EGFA 3BDWA 4QKJA 1WHEA 1SL6A 5LGKE 4IOPA 2Y5HL 3KK6A 2XC4L 1U8CB 4QKHA 1OB1C 4FM5A 1DDXA 4GKOG 2KB9A 4LU5A 3P5DA 2YGOA 1CX2A 1KOEA 3PAKA 3CA7A 5FFSA 4PH9A 3CCKA 2Y81B 3IITB 1LPZA 1IQIL 4RRWA 1DY2A 2VWOL 2UWLB 3TGFA 1YUKB 3LTFB 1RTM1 3BT1A 4COXA 3ALUA 2EI7B 3N8YA 3UBUB 3P7FA 1KLIL 5KIRA 1J9CL 2ZQKA 3ELAL 3WWKB 2J38B 1IQHL 2WFTA 1SB2B 2FLBL 5I46L 4YLIA 1JZNA 5KTHA 1CQEA 5L2ZL 2P26A 6COXA 1DY1A 2OS9A 4JZEL 3KRKA 1MSBA 2LS8A 2WPIE 2ADXA 2WPME 4ZAEB 1U0NC 4M18A 2ORKA 1B9WA 2BT8A 3ZYJB 1IVOC 1CCVA 3OLUA 1EPIA 1BJ3B 3CDGF 3N8VA 3PARA 1RJHA 3PBFA 1Z6EL 4GJXA 5B1XA 1K37A 1E5UI 4J6KA 4M1GA 1DY0A 4J6NA 1KMB1 2P94L 4LQFA 3FFGL 3HO3A 3T3AA 4JZFL 1W7XL 3F1SB 2E3XC 2VUVA 2UWOB 1F00I 2FLGA 2YGQA 2VH6B 1UZPA 1E8IA 3POYA 1EPHA 1CVWL 1JV2B 5F19A 3F6UL 3WWKA 1BCJ1 5JVYA 1HT8A 1WMYA 1G2MB 2XBVL 2Y7ZB 1MPUA 1NQLB 1NPEB 1X2WA 3OLTA 1IGZA 2J2UB 2TGFA 5FFTA 2RNLA 3HS5A 1BYFA 1JBUL 4Y79B 4N38A 3VLGA 2WPKE 1PWBA 1FIFA 1KX0A 3TK5B 3N8WA 2WYGB 2P28B 2BOUA 4Z6AL 4ISHL 3U73A 1IQNL 4A7IA 1WT9B 2XC0L 1IQJL 1V7PA 1APOA 4RRZA 3G8KA 1AUTL 2KV3A 4TGFA 3WH2A 4E52A 4BTIA 1ATDA 4WR9A 4CUFA 3GPRC 1FIHA 1C3AA 1AFB1 5KTIA 1H8UA 1HT5A 1IQKL 3NJPC 1HJ7A 4G9AA 2RIBA 4N34A 2WG4B 1YGCL 1O7BT 1TDQB 3LTGD 1DVAL 1UOSB 3WSRA 4EZMG 3N8WB 1NFXB 4N33A 4S0UA 3P5EA 1JA3A 4X8VL 4YT6L 5CKMA 1FM5A 4JYUL 1TOZA 2W2ME 2XR6A 3G81A 1FAKL 2J34B 1PXXA 4GU3A 5IKVA 3LC5B 2VUZA 1OZ7B 2K2TA 3GPRA 2Y80B 1PGEA 1E87A 1T8CA 4ZRVA 2WYJB 3CENL 4X8SL 4A94C 1LQDA 1IODB 4YZUB 4CUDA 3ZYGA 1K9JA 3LN0A 1PTHA 2VRPB 1N7DA 1L3YA 3QH0A 4J6QA 1EPGA 2I83A 2BMGA 2W2PE 1Y17A 4M10A 2VRSA 3HS6A 3P5FA 2EI6B 2WPLE 4QKIA 2I9AA 1MQ6L 1UZJA 2Y5GL 3CDGE 2WG3C 4C9FA 1U0NB 3ALTA 3V65B 2ORJA 2CL8A 4J6LA 4UWWA 4ZRWA 4RS0A 2P3FL 1B6EA 3M9ZA 2J94B 1XKAL 3LC3B 2XBWL 4YT7L 1HAEA 1U0OA 1FSBA 4M17A 3IKPA 2Y38A 1U67A 1V1IA 3QCWA 5JW1A 1YPOA 1EAIC 4O02B 3FCSB 2BSFA 4BXSA 1HTNA 2P3FN 4G1MB 1SL5A 1WU1B 3G84A 4X8UL 1HQ8A 1YXKA 4NA9L 5KN5C 2N40A 1NT0A 2PY2A 2WPJE 3LAQA 1Q4GA 4Z0LA 1PFXL 2W2NE 2IT6A 1U0OB 4AK8A 2M74A 1JL9A 1P9JA 1UEXB 1XKBA 1G1SA 1WK1A 2VVVL 2PR3B 2F9BL 4E1GA 1RDN1 2KNIA 1KZE1 1IQGL 1EGIA 1FJSL 3CS7L 4JYVL 4UXMA 1G2LB 3ZHGA 1J35B 1R13A 3HUPA 1LPGA 3GCWE 1IGXA 4XL1A 4D90A 2IT5A 4J6JA 4J6MA 1DIYA 1GK5A 3FD4A 1FVUA 1UEXA 2W2QE 1NFWB 4J6PA 5FDQA 3WH3A 2W86A 1GZ2A 2RIDA 1YXJA 1IQFL 1V1HA 3ZHGD 1KLJL 1NFUB 3TK6B 3WBPA 2DDUA 1WT9A 1F7MA 2VWMK 2BPHA 1KSNB 3KQCL 4Y76B 1EQHA 4BTUA 3Q7DA 3G8LA 4GU4A 3KQEL 2VJ3A 3KMB1 1TN3A 3SOBB 2KL7A 2J4IB 2KV4A 1JWIB 3GPRD 1F0SB 1HCGB 2W2OE 3M36L 4ZXYL 4C16A 1T8DA 3IJEB 1B08A 1M1XB 1RDK1 4N35A 1C5MF 1J34B 2YGPA 5CKQA 3VPPA 2P95L 1IQML 5JB8E 3KQDL 5EGMB 2P3UA 4Y7BB 2B7DL 2Y5FL 3C9AC 3N8YB 4CUEA 1XARA 1APQA 1X2WB
chains in the Genus database with same CATH topology
2BZ6L 5JBAE 1F02I 4DN8A 2PF5A 2VRPA 4GJ0A 1IODA 3NCXA 3MQEA 4Y71B 1XPHA 3V64C 2W26B 3NCWA 3C22A 1Y17B 1P1ZD 2XBYL 1HYRA 4PP8A 2GO0A 3R05A 3RS1A 1KWYA 4ZXXL 2BQ6A 2EI8B 3HPTA 1EMOA 3SOVA 4WCOA 1ZAQA 4NGAL 1MUQA 3U7UG 5CISA 1BJ3A 1TLGA 3N8ZA 4MMZB 1YUFA 2BPDA 1DV8A 1URKA 4LMFA 3VYJA 4Z0KB 3BX4B 1F0RB 3ZYIB 3WWKC 3HO4A 1CVUA 3N8XA 1YPQA 1KZB1 1YTTA 1HX2A 3WBQA 3NT1A 4ISIL 1IQLL 2MTIA 4ZESA 1RDO1 5F2QA 2H2RA 1UMRC 2BO2A 2KMB1 3S6XA 2VVCK 4RRXA 4XLWA 1QDDA 1BCH1 2OX8A 1Z6CA 2WFXB 3M37L 3BX4A 1I0UA 1YUGA 1YPUA 4BDWA 2GGXA 2BOKL 1P0SL 3NTGA 1O7CT 2BQWA 1FFMA 1KZC1 5K0HB 5JBCE 2FLRL 1MQ5L 2XR5A 2ZIBA 1FAXL 3BDWB 3K7BA 1EBVA 2XBXL 1KIGL 3GISX 2P16L 1NZIA 3L9JC 4D0EA 1KZD1 5F1AA 4WQQA 1LPKA 3DBZA 2RIAA 4LORA 1UV0A 5CKNA 1EMNA 2OYUP 4Y7AB 5B1WA 4Y6DB 4CAJA 3HO5A 1BV4A 2M94A 3C8JA 2CJIB 1F7EA 1X2TB 2NPRA 1K9IA 2XC5L 3FF8C 5IKRA 1KWZA 1DX5I 2W3IB 3FF7C 1COUA 1KZA1 3P5GA 1CCFA 1LITA 2FD6A 3TZIA 1V4LA 1FF7A 1RDJ1 1BUUA 1OZ7A 1G1RA 4WRFA 3KCGL 1JWIA 1SB2A 4XBMA 1ATBA 3QMOA 4MMXB 1J34A 4WREA 1KWXA 4GI0A 3HS7A 3SOQA 4BDXA 1BNLA 3Q3KB 1IQEL 2OYEP 4BXWA 1W8BL 4CSYA 2MHPA 2UWPB 4OTYA 1K36A 1X2TA 2MSBA 3EGFA 1HZ8A 3IKNA 2BOHA 2RICA 4JZDL 1KWWA 3BT2A 3KQBL 1HUPA 3BPSE 3ASIA 5B1RA 5K8YA 1LMMA 2OX9A 1J35A 3IKQA 1WHFA 1V7PB 2WPHE 2P3TA 1CWVA 1PRHA 3KL6B 2H9EL 1ATEA 1SZBA 1A3PA 5L2YL 1EPJA 2GGUA 2VWLL 1FVUB 1EZQB 1ADXA 3MDLA 1UKMB 1XFEA 2JKHL 1AFA1 3ENSA 1R14A 2RA0L 3WHDA 1BF9A 2FZZL 4PDCA 1UMRA 4KMB1 4N32A 2H9EC 2I9BA 5L30L 1YO8A 1EQGA 2J95B 3NTBA 2WZPP 4KI1E 1QFKL 1DQBA 2PUQL 5M62A 4MTHA 3P7HA 2H2TB 3TBDA 1KG0C 4YMDA 4N36A 4AQTA 4OTJA 4M11A 4NG9L 2C6UA 1ATAA 3LN1A 2G00L 2ZWKA 4ZETA 2RIEA 1HRFA 3K9XA 1AFD1 3CFWA 1XDTR 1RDI1 1UKMA 1TPGA 1IXXB 1ESLA 4BTTA 3DEMA 5IKQA 2MGRA 2P93L 3ALSA 1N1IA 3P7GA 1KWUA 4WUWA 4D0FA 2Q1JB 3FF9A 4WUXA 2BQ7A 5JVZA 1P4LD 2VVUL 1UZQA 4RUTA 4MMYB 1UOSA 3PAQA 1PW9A 4KZVA 1KCGA 1IJKC 1RFNB 3P5HA 1NFYB 1G1QA 3IKRA 3UBUA 2K2SB 1L5GB 1RDM1 1KWVA 1MOXC 4WRCA 3G83A 2BOXA 2Y7XB 3FBYA 5FFRA 3GPRB 2MGPA 1IJQA 2GD4A 5JB9E 3C8KD 5IKTA 1KLOA 1IP0A 2YHFA 3WBRA 1IXXA 2D1JB 2VH0B 2VWNL 1IJKB 1KWTA 5E8DA 1V3XB 1SL4A 3P5IA 3RR3A 4ZHAB 1FE2A 1WMZA 2RHPA 3SW2A 2E3XB 2PHBB 1KX1A 1QO3C 4QKGA 5JBBE 1LMJA 1UZKA 4KZWA 4N37A 3LIWB 3VYKA 4IOPB 2AYLA 5COXA 1V4LB 2BPEA 2BRSA 3KQGA 1CEJA 4GK1A 4X8TL 2W3KB 4O1ZA 2AFPA 1X7AL 1IOXA 2Y82B 3GCXE 1C3AB 3CADA 5J6GG 1HAFA 1IOEL 1TLEA 1RDL1 3TH3L 4G96A 3P5BL 1O5DL 1EGGA 1G1TA 3H5CB 4RRYA 4ZH8B 3PGHA 1HREA 1EGFA 3BDWA 4QKJA 1WHEA 1SL6A 5LGKE 4IOPA 2Y5HL 3KK6A 2XC4L 1U8CB 4QKHA 1OB1C 4FM5A 1DDXA 4GKOG 2KB9A 4LU5A 3P5DA 2YGOA 1CX2A 1KOEA 3PAKA 3CA7A 5FFSA 4PH9A 3CCKA 2Y81B 3IITB 1LPZA 1IQIL 4RRWA 1DY2A 2VWOL 2UWLB 3TGFA 1YUKB 3LTFB 1RTM1 3BT1A 4COXA 3ALUA 2EI7B 3N8YA 3UBUB 3P7FA 1KLIL 5KIRA 1J9CL 2ZQKA 3ELAL 3WWKB 2J38B 1IQHL 2WFTA 1SB2B 2FLBL 5I46L 4YLIA 1JZNA 5KTHA 1CQEA 5L2ZL 2P26A 6COXA 1DY1A 2OS9A 4JZEL 3KRKA 1MSBA 2LS8A 2WPIE 2ADXA 2WPME 4ZAEB 1U0NC 4M18A 2ORKA 1B9WA 3ZYJB 1IVOC 1CCVA 3OLUA 1EPIA 1BJ3B 3CDGF 3N8VA 3PARA 1RJHA 3PBFA 1Z6EL 4GJXA 5B1XA 1K37A 1E5UI 4J6KA 4M1GA 1DY0A 4J6NA 1KMB1 2P94L 4LQFA 3FFGL 3HO3A 3T3AA 4JZFL 1W7XL 3F1SB 2E3XC 2VUVA 2UWOB 1F00I 2FLGA 2YGQA 2VH6B 1UZPA 1E8IA 3POYA 1EPHA 1CVWL 1JV2B 5F19A 3F6UL 3WWKA 1BCJ1 5JVYA 1HT8A 1WMYA 1G2MB 2XBVL 2Y7ZB 1MPUA 1NQLB 1NPEB 1X2WA 3OLTA 1IGZA 2J2UB 2TGFA 5FFTA 2RNLA 3HS5A 1BYFA 1JBUL 4Y79B 4N38A 3VLGA 2WPKE 1PWBA 1FIFA 1KX0A 3TK5B 3N8WA 2WYGB 2P28B 2BOUA 4Z6AL 4ISHL 3U73A 1IQNL 4A7IA 1WT9B 2XC0L 1IQJL 1V7PA 1APOA 4RRZA 3G8KA 1AUTL 2KV3A 4TGFA 3WH2A 4E52A 4BTIA 1ATDA 4WR9A 4CUFA 3GPRC 1FIHA 1C3AA 1AFB1 5KTIA 1H8UA 1HT5A 1IQKL 3NJPC 1HJ7A 4G9AA 2RIBA 4N34A 2WG4B 1YGCL 1O7BT 1TDQB 3LTGD 1DVAL 1UOSB 3WSRA 4EZMG 3N8WB 1NFXB 4N33A 4S0UA 3P5EA 1JA3A 4X8VL 4YT6L 5CKMA 1FM5A 4JYUL 1TOZA 2W2ME 2XR6A 3G81A 1FAKL 2J34B 1PXXA 2VUZA 5IKVA 3LC5B 1OZ7B 2K2TA 3GPRA 2Y80B 1PGEA 1E87A 1T8CA 4ZRVA 2WYJB 3CENL 4X8SL 4A94C 1LQDA 1IODB 4YZUB 4CUDA 3ZYGA 1K9JA 3LN0A 1PTHA 2VRPB 1N7DA 1L3YA 3QH0A 4J6QA 1EPGA 2I83A 2BMGA 2W2PE 1Y17A 4M10A 3P5FA 3HS6A 2EI6B 2WPLE 4QKIA 2I9AA 1MQ6L 1UZJA 2Y5GL 3CDGE 2WG3C 4C9FA 1U0NB 3ALTA 3V65B 2ORJA 2CL8A 4J6LA 4UWWA 4ZRWA 4RS0A 2P3FL 1B6EA 3M9ZA 2J94B 1XKAL 3LC3B 2XBWL 4YT7L 1HAEA 1U0OA 1FSBA 4M17A 3IKPA 2Y38A 1U67A 3QCWA 5JW1A 1YPOA 1EAIC 4O02B 3FCSB 4BXSA 1HTNA 2P3FN 4G1MB 1SL5A 1WU1B 3G84A 4X8UL 1HQ8A 1YXKA 4NA9L 5KN5C 2N40A 1NT0A 2PY2A 2WPJE 3LAQA 1Q4GA 4Z0LA 1PFXL 2W2NE 2IT6A 1U0OB 4AK8A 2M74A 1JL9A 1P9JA 1UEXB 1XKBA 1G1SA 1WK1A 2VVVL 2PR3B 2F9BL 4E1GA 1RDN1 2KNIA 1KZE1 1IQGL 1EGIA 1FJSL 3CS7L 4JYVL 4UXMA 1G2LB 3ZHGA 1J35B 1R13A 3HUPA 1LPGA 3GCWE 1IGXA 4XL1A 4D90A 2IT5A 4J6JA 4J6MA 1DIYA 1GK5A 3FD4A 1FVUA 1UEXA 2W2QE 1NFWB 4J6PA 5FDQA 3WH3A 2W86A 1GZ2A 2RIDA 1YXJA 1IQFL 3ZHGD 1KLJL 1NFUB 3TK6B 3WBPA 2DDUA 1WT9A 1F7MA 2VWMK 2BPHA 1KSNB 3KQCL 4Y76B 1EQHA 4BTUA 3Q7DA 3G8LA 3KQEL 2VJ3A 3KMB1 1TN3A 3SOBB 2KL7A 2J4IB 2KV4A 1JWIB 3GPRD 1F0SB 1HCGB 2W2OE 3M36L 4ZXYL 4C16A 1T8DA 3IJEB 1B08A 1M1XB 1RDK1 4N35A 1C5MF 1J34B 2YGPA 5CKQA 3VPPA 2P95L 1IQML 5JB8E 3KQDL 5EGMB 2P3UA 4Y7BB 2B7DL 2Y5FL 3C9AC 3N8YB 4CUEA 1XARA 1APQA 1X2WB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BZ6 L;  5JBA E;  1F02 I;  4DN8 A;  2PF5 A;  2VRP A;  4GJ0 A;  1IOD A;  3NCX A;  3MQE A;  4Y71 B;  1XPH A;  3V64 C;  2W26 B;  3NCW A;  3C22 A;  1Y17 B;  1P1Z D;  2XBY L;  1HYR A;  4PP8 A;  2GO0 A;  3R05 A;  3RS1 A;  1KWY A;  4ZXX L;  2BQ6 A;  2EI8 B;  3HPT A;  1EMO A;  3SOV A;  4WCO A;  1ZAQ A;  4NGA L;  1MUQ A;  3U7U G;  5CIS A;  1BJ3 A;  1TLG A;  3N8Z A;  4MMZ B;  1YUF A;  2BPD A;  1DV8 A;  1URK A;  4LMF A;  3VYJ A;  4Z0K B;  3BX4 B;  1F0R B;  3ZYI B;  3WWK C;  3HO4 A;  1CVU A;  3N8X A;  1YPQ A;  1KZB 1;  1YTT A;  1HX2 A;  3WBQ A;  3NT1 A;  4ISI L;  1IQL L;  2MTI A;  4ZES A;  1RDO 1;  5F2Q A;  2H2R A;  1UMR C;  2BO2 A;  2KMB 1;  2VVC K;  4RRX A;  4XLW A;  1QDD A;  1BCH 1;  2OX8 A;  1Z6C A;  2WFX B;  3M37 L;  3BX4 A;  1I0U A;  1YUG A;  1YPU A;  4BDW A;  2GGX A;  2BOK L;  1P0S L;  3NTG A;  1O7C T;  2BQW A;  1FFM A;  1KZC 1;  5K0H B;  5JBC E;  2FLR L;  1MQ5 L;  2XR5 A;  2ZIB A;  1FAX L;  3BDW B;  3K7B A;  1EBV A;  2XBX L;  1KIG L;  3GIS X;  2P16 L;  1NZI A;  3L9J C;  4D0E A;  1KZD 1;  5F1A A;  4WQQ A;  1LPK A;  3DBZ A;  2RIA A;  4LOR A;  1UV0 A;  5CKN A;  1EMN A;  2OYU P;  4Y7A B;  5B1W A;  4Y6D B;  4CAJ A;  3HO5 A;  1BV4 A;  2M94 A;  3C8J A;  2CJI B;  1F7E A;  1X2T B;  2NPR A;  1K9I A;  2XC5 L;  3FF8 C;  5IKR A;  1KWZ A;  1DX5 I;  2W3I B;  3FF7 C;  1COU A;  1KZA 1;  3P5G A;  1CCF A;  1LIT A;  2FD6 A;  3TZI A;  1V4L A;  1FF7 A;  1RDJ 1;  1BUU A;  1OZ7 A;  1G1R A;  4WRF A;  3KCG L;  1JWI A;  1SB2 A;  4XBM A;  1ATB A;  3QMO A;  4MMX B;  1J34 A;  4WRE A;  1KWX A;  4GI0 A;  3HS7 A;  3SOQ A;  4BDX A;  1BNL A;  3Q3K B;  1IQE L;  2OYE P;  4BXW A;  1W8B L;  4CSY A;  2MHP A;  2UWP B;  4OTY A;  1K36 A;  1X2T A;  2MSB A;  3EGF A;  1HZ8 A;  3IKN A;  2BOH A;  2RIC A;  4JZD L;  1KWW A;  3BT2 A;  3KQB L;  1HUP A;  3BPS E;  3ASI A;  5B1R A;  5K8Y A;  2OX9 A;  1J35 A;  3IKQ A;  1WHF A;  1V7P B;  2WPH E;  2P3T A;  1CWV A;  1PRH A;  3KL6 B;  2H9E L;  1ATE A;  1SZB A;  1A3P A;  5L2Y L;  1EPJ A;  2GGU A;  2VWL L;  1FVU B;  1EZQ B;  1ADX A;  3MDL A;  1UKM B;  1XFE A;  2JKH L;  1AFA 1;  3ENS A;  1R14 A;  2RA0 L;  3WHD A;  1BF9 A;  2FZZ L;  4PDC A;  1UMR A;  4KMB 1;  4N32 A;  2I9B A;  5L30 L;  1YO8 A;  1EQG A;  2J95 B;  3NTB A;  4KI1 E;  1QFK L;  1DQB A;  2PUQ L;  5M62 A;  4MTH A;  3P7H A;  2H2T B;  3TBD A;  1KG0 C;  4YMD A;  4N36 A;  4AQT A;  4OTJ A;  4M11 A;  4NG9 L;  2C6U A;  1ATA A;  3LN1 A;  2G00 L;  2ZWK A;  4ZET A;  2RIE A;  1HRF A;  3K9X A;  1AFD 1;  3CFW A;  1XDT R;  1RDI 1;  1UKM A;  1TPG A;  1IXX B;  1ESL A;  4BTT A;  3DEM A;  5IKQ A;  2MGR A;  2P93 L;  3ALS A;  1N1I A;  3P7G A;  1KWU A;  4WUW A;  4D0F A;  2Q1J B;  3FF9 A;  4WUX A;  2BQ7 A;  5JVZ A;  1P4L D;  2VVU L;  1UZQ A;  4RUT A;  4MMY B;  1UOS A;  3PAQ A;  1PW9 A;  4KZV A;  1KCG A;  1IJK C;  1RFN B;  3P5H A;  1NFY B;  1G1Q A;  3IKR A;  3UBU A;  2K2S B;  1L5G B;  1RDM 1;  1KWV A;  1MOX C;  4WRC A;  3G83 A;  2BOX A;  2Y7X B;  3FBY A;  5FFR A;  3GPR B;  2MGP A;  1IJQ A;  2GD4 A;  5JB9 E;  3C8K D;  5IKT A;  1KLO A;  1IP0 A;  2YHF A;  3WBR A;  1IXX A;  2D1J B;  2VH0 B;  2VWN L;  1IJK B;  1KWT A;  5E8D A;  1V3X B;  1SL4 A;  3P5I A;  3RR3 A;  4ZHA B;  1FE2 A;  1WMZ A;  2RHP A;  3SW2 A;  2E3X B;  2PHB B;  1KX1 A;  1QO3 C;  4QKG A;  5JBB E;  1LMJ A;  1UZK A;  4KZW A;  4N37 A;  3LIW B;  3VYK A;  4IOP B;  2AYL A;  5COX A;  1V4L B;  2BPE A;  2BRS A;  3KQG A;  1CEJ A;  4GK1 A;  4X8T L;  2W3K B;  4O1Z A;  2AFP A;  1X7A L;  1IOX A;  2Y82 B;  3GCX E;  1C3A B;  3CAD A;  5J6G G;  1HAF A;  1IOE L;  1TLE A;  1RDL 1;  3TH3 L;  4G96 A;  3P5B L;  1O5D L;  1EGG A;  1G1T A;  3H5C B;  4RRY A;  4ZH8 B;  3PGH A;  1HRE A;  1EGF A;  3BDW A;  4QKJ A;  1WHE A;  1SL6 A;  5LGK E;  4IOP A;  2Y5H L;  3KK6 A;  2XC4 L;  1U8C B;  4QKH A;  1OB1 C;  4FM5 A;  1DDX A;  4GKO G;  2KB9 A;  4LU5 A;  3P5D A;  2YGO A;  1CX2 A;  1KOE A;  3PAK A;  3CA7 A;  5FFS A;  4PH9 A;  3CCK A;  2Y81 B;  3IIT B;  1LPZ A;  1IQI L;  4RRW A;  1DY2 A;  2VWO L;  2UWL B;  3TGF A;  1YUK B;  3LTF B;  1RTM 1;  3BT1 A;  4COX A;  3ALU A;  2EI7 B;  3N8Y A;  3UBU B;  3P7F A;  1KLI L;  5KIR A;  1J9C L;  2ZQK A;  3ELA L;  3WWK B;  2J38 B;  1IQH L;  2WFT A;  1SB2 B;  2FLB L;  5I46 L;  4YLI A;  1JZN A;  5KTH A;  1CQE A;  5L2Z L;  2P26 A;  6COX A;  1DY1 A;  2OS9 A;  4JZE L;  3KRK A;  1MSB A;  2LS8 A;  2WPI E;  2ADX A;  2WPM E;  4ZAE B;  1U0N C;  4M18 A;  2ORK A;  1B9W A;  3ZYJ B;  1IVO C;  1CCV A;  3OLU A;  1EPI A;  1BJ3 B;  3CDG F;  3N8V A;  3PAR A;  1RJH A;  3PBF A;  1Z6E L;  4GJX A;  5B1X A;  1K37 A;  1E5U I;  4J6K A;  4M1G A;  1DY0 A;  4J6N A;  1KMB 1;  2P94 L;  4LQF A;  3FFG L;  3HO3 A;  3T3A A;  4JZF L;  1W7X L;  3F1S B;  2E3X C;  2VUV A;  2UWO B;  1F00 I;  2FLG A;  2VH6 B;  1UZP A;  1E8I A;  3POY A;  1EPH A;  1CVW L;  1JV2 B;  5F19 A;  3F6U L;  3WWK A;  1BCJ 1;  5JVY A;  1HT8 A;  1WMY A;  1G2M B;  2XBV L;  2Y7Z B;  1MPU A;  1NQL B;  1NPE B;  1X2W A;  3OLT A;  1IGZ A;  2J2U B;  2TGF A;  5FFT A;  2RNL A;  3HS5 A;  1BYF A;  1JBU L;  4Y79 B;  4N38 A;  3VLG A;  2WPK E;  1PWB A;  1FIF A;  1KX0 A;  3TK5 B;  3N8W A;  2WYG B;  2P28 B;  2BOU A;  4Z6A L;  4ISH L;  3U73 A;  1IQN L;  4A7I A;  1WT9 B;  2XC0 L;  1IQJ L;  1V7P A;  1APO A;  4RRZ A;  3G8K A;  1AUT L;  2KV3 A;  4TGF A;  3WH2 A;  4E52 A;  4BTI A;  1ATD A;  4WR9 A;  4CUF A;  3GPR C;  1FIH A;  1C3A A;  1AFB 1;  5KTI A;  1H8U A;  1HT5 A;  1IQK L;  3NJP C;  1HJ7 A;  4G9A A;  2RIB A;  4N34 A;  2WG4 B;  1YGC L;  1O7B T;  1TDQ B;  3LTG D;  1DVA L;  1UOS B;  3WSR A;  4EZM G;  3N8W B;  1NFX B;  4N33 A;  4S0U A;  3P5E A;  1JA3 A;  4X8V L;  4YT6 L;  5CKM A;  1FM5 A;  4JYU L;  1TOZ A;  2W2M E;  2XR6 A;  3G81 A;  1FAK L;  2J34 B;  1PXX A;  2VUZ A;  5IKV A;  3LC5 B;  1OZ7 B;  2K2T A;  3GPR A;  2Y80 B;  1PGE A;  1E87 A;  1T8C A;  4ZRV A;  2WYJ B;  3CEN L;  4X8S L;  1LQD A;  1IOD B;  4YZU B;  4CUD A;  3ZYG A;  1K9J A;  3LN0 A;  1PTH A;  2VRP B;  1N7D A;  1L3Y A;  3QH0 A;  4J6Q A;  1EPG A;  2I83 A;  2BMG A;  2W2P E;  1Y17 A;  4M10 A;  3P5F A;  3HS6 A;  2EI6 B;  2WPL E;  4QKI A;  2I9A A;  1MQ6 L;  1UZJ A;  2Y5G L;  3CDG E;  2WG3 C;  4C9F A;  1U0N B;  3ALT A;  3V65 B;  2ORJ A;  2CL8 A;  4J6L A;  4UWW A;  4ZRW A;  4RS0 A;  2P3F L;  1B6E A;  3M9Z A;  2J94 B;  1XKA L;  3LC3 B;  2XBW L;  4YT7 L;  1HAE A;  1U0O A;  1FSB A;  4M17 A;  3IKP A;  2Y38 A;  1U67 A;  3QCW A;  5JW1 A;  1YPO A;  1EAI C;  4O02 B;  3FCS B;  4BXS A;  1HTN A;  2P3F N;  4G1M B;  1SL5 A;  1WU1 B;  3G84 A;  4X8U L;  1HQ8 A;  1YXK A;  4NA9 L;  5KN5 C;  2N40 A;  1NT0 A;  2PY2 A;  2WPJ E;  3LAQ A;  1Q4G A;  4Z0L A;  1PFX L;  2W2N E;  2IT6 A;  1U0O B;  4AK8 A;  2M74 A;  1JL9 A;  1P9J A;  1UEX B;  1XKB A;  1G1S A;  1WK1 A;  2VVV L;  2PR3 B;  2F9B L;  4E1G A;  1RDN 1;  1KZE 1;  1IQG L;  1EGI A;  1FJS L;  3CS7 L;  4JYV L;  4UXM A;  1G2L B;  3ZHG A;  1J35 B;  1R13 A;  3HUP A;  1LPG A;  3GCW E;  1IGX A;  4XL1 A;  4D90 A;  2IT5 A;  4J6J A;  4J6M A;  1DIY A;  1GK5 A;  3FD4 A;  1FVU A;  1UEX A;  2W2Q E;  1NFW B;  4J6P A;  5FDQ A;  3WH3 A;  2W86 A;  1GZ2 A;  2RID A;  1YXJ A;  1IQF L;  3ZHG D;  1KLJ L;  1NFU B;  3TK6 B;  3WBP A;  2DDU A;  1WT9 A;  1F7M A;  2VWM K;  2BPH A;  1KSN B;  3KQC L;  4Y76 B;  1EQH A;  4BTU A;  3Q7D A;  3G8L A;  3KQE L;  2VJ3 A;  3KMB 1;  1TN3 A;  3SOB B;  2KL7 A;  2J4I B;  2KV4 A;  1JWI B;  3GPR D;  1F0S B;  1HCG B;  2W2O E;  3M36 L;  4ZXY L;  4C16 A;  1T8D A;  3IJE B;  1B08 A;  1M1X B;  1RDK 1;  4N35 A;  1C5M F;  1J34 B;  2YGP A;  5CKQ A;  3VPP A;  2P95 L;  1IQM L;  5JB8 E;  3KQD L;  5EGM B;  2P3U A;  4Y7B B;  2B7D L;  2Y5F L;  3C9A C;  3N8Y B;  4CUE A;  1XAR A;  1APQ A;  1X2W B; 
#chains in the Genus database with same CATH topology
 2BZ6 L;  5JBA E;  1F02 I;  4DN8 A;  2PF5 A;  2VRP A;  4GJ0 A;  1IOD A;  3NCX A;  3MQE A;  4Y71 B;  1XPH A;  3V64 C;  2W26 B;  3NCW A;  3C22 A;  1Y17 B;  1P1Z D;  2XBY L;  1HYR A;  4PP8 A;  2GO0 A;  3R05 A;  3RS1 A;  1KWY A;  4ZXX L;  2BQ6 A;  2EI8 B;  3HPT A;  1EMO A;  3SOV A;  4WCO A;  1ZAQ A;  4NGA L;  1MUQ A;  3U7U G;  5CIS A;  1BJ3 A;  1TLG A;  3N8Z A;  4MMZ B;  1YUF A;  2BPD A;  1DV8 A;  1URK A;  4LMF A;  3VYJ A;  4Z0K B;  3BX4 B;  1F0R B;  3ZYI B;  3WWK C;  3HO4 A;  1CVU A;  3N8X A;  1YPQ A;  1KZB 1;  1YTT A;  1HX2 A;  3WBQ A;  3NT1 A;  4ISI L;  1IQL L;  2MTI A;  4ZES A;  1RDO 1;  5F2Q A;  2H2R A;  1UMR C;  2BO2 A;  2KMB 1;  3S6X A;  2VVC K;  4RRX A;  4XLW A;  1QDD A;  1BCH 1;  2OX8 A;  1Z6C A;  2WFX B;  3M37 L;  3BX4 A;  1I0U A;  1YUG A;  1YPU A;  4BDW A;  2GGX A;  2BOK L;  1P0S L;  3NTG A;  1O7C T;  2BQW A;  1FFM A;  1KZC 1;  5K0H B;  5JBC E;  2FLR L;  1MQ5 L;  2XR5 A;  2ZIB A;  1FAX L;  3BDW B;  3K7B A;  1EBV A;  2XBX L;  1KIG L;  3GIS X;  2P16 L;  1NZI A;  3L9J C;  4D0E A;  1KZD 1;  5F1A A;  4WQQ A;  1LPK A;  3DBZ A;  2RIA A;  4LOR A;  1QIU A;  1UV0 A;  5CKN A;  1EMN A;  2OYU P;  4Y7A B;  5B1W A;  4Y6D B;  4CAJ A;  3HO5 A;  1BV4 A;  2M94 A;  3C8J A;  2CJI B;  1F7E A;  1X2T B;  2NPR A;  1K9I A;  2XC5 L;  3FF8 C;  5IKR A;  1KWZ A;  1DX5 I;  2W3I B;  3FF7 C;  1COU A;  1KZA 1;  3P5G A;  1CCF A;  1LIT A;  2FD6 A;  3TZI A;  1V4L A;  1FF7 A;  1RDJ 1;  1BUU A;  1OZ7 A;  1G1R A;  4WRF A;  3KCG L;  1JWI A;  1SB2 A;  4XBM A;  1ATB A;  3QMO A;  4MMX B;  1J34 A;  4WRE A;  1KWX A;  4GI0 A;  3HS7 A;  3SOQ A;  4BDX A;  1BNL A;  3Q3K B;  1IQE L;  2OYE P;  4BXW A;  1W8B L;  4CSY A;  2MHP A;  2UWP B;  4OTY A;  1K36 A;  1X2T A;  2MSB A;  3EGF A;  1HZ8 A;  3IKN A;  2BOH A;  2RIC A;  4JZD L;  1KWW A;  3BT2 A;  3KQB L;  1HUP A;  3BPS E;  3ASI A;  2HOX A;  5B1R A;  5K8Y A;  1LMM A;  2OX9 A;  1J35 A;  3IKQ A;  1WHF A;  1V7P B;  2WPH E;  2P3T A;  1CWV A;  1PRH A;  3KL6 B;  2H9E L;  1ATE A;  1SZB A;  1A3P A;  5L2Y L;  1EPJ A;  2GGU A;  2VWL L;  1FVU B;  1EZQ B;  1ADX A;  3MDL A;  1UKM B;  1XFE A;  2JKH L;  1AFA 1;  3ENS A;  1R14 A;  2RA0 L;  3WHD A;  1BF9 A;  2FZZ L;  4PDC A;  1UMR A;  4KMB 1;  4N32 A;  2H9E C;  2I9B A;  5L30 L;  1YO8 A;  1EQG A;  1KKE A;  2J95 B;  3NTB A;  2WZP P;  4KI1 E;  1QFK L;  1DQB A;  2PUQ L;  5M62 A;  4MTH A;  3P7H A;  2H2T B;  3TBD A;  1KG0 C;  4YMD A;  4N36 A;  4AQT A;  4OTJ A;  4M11 A;  4NG9 L;  2C6U A;  1ATA A;  3LN1 A;  2G00 L;  2ZWK A;  4ZET A;  2RIE A;  1HRF A;  3K9X A;  1AFD 1;  3CFW A;  1XDT R;  1RDI 1;  1UKM A;  1TPG A;  1IXX B;  1ESL A;  4BTT A;  3DEM A;  5IKQ A;  2MGR A;  2P93 L;  3ALS A;  1N1I A;  3P7G A;  1KWU A;  4WUW A;  4D0F A;  2Q1J B;  3FF9 A;  4WUX A;  2BQ7 A;  5JVZ A;  1P4L D;  2BT7 A;  2VVU L;  1UZQ A;  4RUT A;  4MMY B;  1UOS A;  3PAQ A;  1PW9 A;  4KZV A;  1KCG A;  1IJK C;  1RFN B;  3P5H A;  1LK9 A;  1G1Q A;  1NFY B;  3IKR A;  3UBU A;  2K2S B;  1L5G B;  1RDM 1;  1KWV A;  1MOX C;  2HOR A;  4WRC A;  3G83 A;  2BOX A;  2Y7X B;  3FBY A;  5FFR A;  3GPR B;  2MGP A;  1IJQ A;  2GD4 A;  5JB9 E;  3C8K D;  5IKT A;  1KLO A;  1IP0 A;  2YHF A;  3WBR A;  1IXX A;  2D1J B;  2VH0 B;  2VWN L;  1IJK B;  1KWT A;  5E8D A;  1V3X B;  1SL4 A;  3P5I A;  3RR3 A;  4ZHA B;  1FE2 A;  1WMZ A;  2RHP A;  3SW2 A;  2E3X B;  2PHB B;  1KX1 A;  1QO3 C;  4QKG A;  5JBB E;  1LMJ A;  1UZK A;  4KZW A;  4N37 A;  3LIW B;  3VYK A;  4IOP B;  2AYL A;  5COX A;  1V4L B;  2BPE A;  2BRS A;  3KQG A;  1CEJ A;  4GK1 A;  4X8T L;  2W3K B;  4O1Z A;  2AFP A;  1X7A L;  1IOX A;  2Y82 B;  3GCX E;  1C3A B;  3CAD A;  5J6G G;  1HAF A;  1IOE L;  1TLE A;  1RDL 1;  3TH3 L;  4G96 A;  2JJL A;  3P5B L;  1O5D L;  1EGG A;  1G1T A;  3H5C B;  4RRY A;  4ZH8 B;  3PGH A;  1HRE A;  1EGF A;  3BDW A;  4QKJ A;  1WHE A;  1SL6 A;  5LGK E;  4IOP A;  2Y5H L;  3KK6 A;  2XC4 L;  1U8C B;  4QKH A;  1OB1 C;  4FM5 A;  1DDX A;  4GKO G;  2KB9 A;  4LU5 A;  3P5D A;  2YGO A;  1CX2 A;  1KOE A;  3PAK A;  3CA7 A;  5FFS A;  4PH9 A;  3CCK A;  2Y81 B;  3IIT B;  1LPZ A;  1IQI L;  4RRW A;  1DY2 A;  2VWO L;  2UWL B;  3TGF A;  1YUK B;  3LTF B;  1RTM 1;  3BT1 A;  4COX A;  3ALU A;  2EI7 B;  3N8Y A;  3UBU B;  3P7F A;  1KLI L;  5KIR A;  1J9C L;  2ZQK A;  3ELA L;  3WWK B;  2J38 B;  1IQH L;  2WFT A;  1SB2 B;  2FLB L;  5I46 L;  4YLI A;  1JZN A;  5KTH A;  1CQE A;  5L2Z L;  2P26 A;  6COX A;  1DY1 A;  2OS9 A;  4JZE L;  3KRK A;  1MSB A;  2LS8 A;  2WPI E;  2ADX A;  2WPM E;  4ZAE B;  1U0N C;  4M18 A;  2ORK A;  1B9W A;  2BT8 A;  3ZYJ B;  1IVO C;  1CCV A;  3OLU A;  1EPI A;  1BJ3 B;  3CDG F;  3N8V A;  3PAR A;  1RJH A;  3PBF A;  1Z6E L;  4GJX A;  5B1X A;  1K37 A;  1E5U I;  4J6K A;  4M1G A;  1DY0 A;  4J6N A;  1KMB 1;  2P94 L;  4LQF A;  3FFG L;  3HO3 A;  3T3A A;  4JZF L;  1W7X L;  3F1S B;  2E3X C;  2VUV A;  2UWO B;  1F00 I;  2FLG A;  2YGQ A;  2VH6 B;  1UZP A;  1E8I A;  3POY A;  1EPH A;  1CVW L;  1JV2 B;  5F19 A;  3F6U L;  3WWK A;  1BCJ 1;  5JVY A;  1HT8 A;  1WMY A;  1G2M B;  2XBV L;  2Y7Z B;  1MPU A;  1NQL B;  1NPE B;  1X2W A;  3OLT A;  1IGZ A;  2J2U B;  2TGF A;  5FFT A;  2RNL A;  3HS5 A;  1BYF A;  1JBU L;  4Y79 B;  4N38 A;  3VLG A;  2WPK E;  1PWB A;  1FIF A;  1KX0 A;  3TK5 B;  3N8W A;  2WYG B;  2P28 B;  2BOU A;  4Z6A L;  4ISH L;  3U73 A;  1IQN L;  4A7I A;  1WT9 B;  2XC0 L;  1IQJ L;  1V7P A;  1APO A;  4RRZ A;  3G8K A;  1AUT L;  2KV3 A;  4TGF A;  3WH2 A;  4E52 A;  4BTI A;  1ATD A;  4WR9 A;  4CUF A;  3GPR C;  1FIH A;  1C3A A;  1AFB 1;  5KTI A;  1H8U A;  1HT5 A;  1IQK L;  3NJP C;  1HJ7 A;  4G9A A;  2RIB A;  4N34 A;  2WG4 B;  1YGC L;  1O7B T;  1TDQ B;  3LTG D;  1DVA L;  1UOS B;  3WSR A;  4EZM G;  3N8W B;  1NFX B;  4N33 A;  4S0U A;  3P5E A;  1JA3 A;  4X8V L;  4YT6 L;  5CKM A;  1FM5 A;  4JYU L;  1TOZ A;  2W2M E;  2XR6 A;  3G81 A;  1FAK L;  2J34 B;  1PXX A;  4GU3 A;  5IKV A;  3LC5 B;  2VUZ A;  1OZ7 B;  2K2T A;  3GPR A;  2Y80 B;  1PGE A;  1E87 A;  1T8C A;  4ZRV A;  2WYJ B;  3CEN L;  4X8S L;  4A94 C;  1LQD A;  1IOD B;  4YZU B;  4CUD A;  3ZYG A;  1K9J A;  3LN0 A;  1PTH A;  2VRP B;  1N7D A;  1L3Y A;  3QH0 A;  4J6Q A;  1EPG A;  2I83 A;  2BMG A;  2W2P E;  1Y17 A;  4M10 A;  2VRS A;  3HS6 A;  3P5F A;  2EI6 B;  2WPL E;  4QKI A;  2I9A A;  1MQ6 L;  1UZJ A;  2Y5G L;  3CDG E;  2WG3 C;  4C9F A;  1U0N B;  3ALT A;  3V65 B;  2ORJ A;  2CL8 A;  4J6L A;  4UWW A;  4ZRW A;  4RS0 A;  2P3F L;  1B6E A;  3M9Z A;  2J94 B;  1XKA L;  3LC3 B;  2XBW L;  4YT7 L;  1HAE A;  1U0O A;  1FSB A;  4M17 A;  3IKP A;  2Y38 A;  1U67 A;  1V1I A;  3QCW A;  5JW1 A;  1YPO A;  1EAI C;  4O02 B;  3FCS B;  2BSF A;  4BXS A;  1HTN A;  2P3F N;  4G1M B;  1SL5 A;  1WU1 B;  3G84 A;  4X8U L;  1HQ8 A;  1YXK A;  4NA9 L;  5KN5 C;  2N40 A;  1NT0 A;  2PY2 A;  2WPJ E;  3LAQ A;  1Q4G A;  4Z0L A;  1PFX L;  2W2N E;  2IT6 A;  1U0O B;  4AK8 A;  2M74 A;  1JL9 A;  1P9J A;  1UEX B;  1XKB A;  1G1S A;  1WK1 A;  2VVV L;  2PR3 B;  2F9B L;  4E1G A;  1RDN 1;  2KNI A;  1KZE 1;  1IQG L;  1EGI A;  1FJS L;  3CS7 L;  4JYV L;  4UXM A;  1G2L B;  3ZHG A;  1J35 B;  1R13 A;  3HUP A;  1LPG A;  3GCW E;  1IGX A;  4XL1 A;  4D90 A;  2IT5 A;  4J6J A;  4J6M A;  1DIY A;  1GK5 A;  3FD4 A;  1FVU A;  1UEX A;  2W2Q E;  1NFW B;  4J6P A;  5FDQ A;  3WH3 A;  2W86 A;  1GZ2 A;  2RID A;  1YXJ A;  1IQF L;  1V1H A;  3ZHG D;  1KLJ L;  1NFU B;  3TK6 B;  3WBP A;  2DDU A;  1WT9 A;  1F7M A;  2VWM K;  2BPH A;  1KSN B;  3KQC L;  4Y76 B;  1EQH A;  4BTU A;  3Q7D A;  3G8L A;  4GU4 A;  3KQE L;  2VJ3 A;  3KMB 1;  1TN3 A;  3SOB B;  2KL7 A;  2J4I B;  2KV4 A;  1JWI B;  3GPR D;  1F0S B;  1HCG B;  2W2O E;  3M36 L;  4ZXY L;  4C16 A;  1T8D A;  3IJE B;  1B08 A;  1M1X B;  1RDK 1;  4N35 A;  1C5M F;  1J34 B;  2YGP A;  5CKQ A;  3VPP A;  2P95 L;  1IQM L;  5JB8 E;  3KQD L;  5EGM B;  2P3U A;  4Y7B B;  2B7D L;  2Y5F L;  3C9A C;  3N8Y B;  4CUE A;  1XAR A;  1APQ A;  1X2W B; 
#chains in the Genus database with same CATH homology
 2BZ6 L;  5JBA E;  1F02 I;  4DN8 A;  2PF5 A;  2VRP A;  4GJ0 A;  1IOD A;  3NCX A;  3MQE A;  4Y71 B;  1XPH A;  3V64 C;  2W26 B;  3NCW A;  3C22 A;  1Y17 B;  1P1Z D;  2XBY L;  1HYR A;  4PP8 A;  2GO0 A;  3R05 A;  3RS1 A;  1KWY A;  4ZXX L;  2BQ6 A;  2EI8 B;  3HPT A;  1EMO A;  3SOV A;  4WCO A;  1ZAQ A;  4NGA L;  1MUQ A;  3U7U G;  5CIS A;  1BJ3 A;  1TLG A;  3N8Z A;  4MMZ B;  1YUF A;  2BPD A;  1DV8 A;  1URK A;  4LMF A;  3VYJ A;  4Z0K B;  3BX4 B;  1F0R B;  3ZYI B;  3WWK C;  3HO4 A;  1CVU A;  3N8X A;  1YPQ A;  1KZB 1;  1YTT A;  1HX2 A;  3WBQ A;  3NT1 A;  4ISI L;  1IQL L;  2MTI A;  4ZES A;  1RDO 1;  5F2Q A;  2H2R A;  1UMR C;  2BO2 A;  2KMB 1;  3S6X A;  2VVC K;  4RRX A;  4XLW A;  1QDD A;  1BCH 1;  2OX8 A;  1Z6C A;  2WFX B;  3M37 L;  3BX4 A;  1I0U A;  1YUG A;  1YPU A;  4BDW A;  2GGX A;  2BOK L;  1P0S L;  3NTG A;  1O7C T;  2BQW A;  1FFM A;  1KZC 1;  5K0H B;  5JBC E;  2FLR L;  1MQ5 L;  2XR5 A;  2ZIB A;  1FAX L;  3BDW B;  3K7B A;  1EBV A;  2XBX L;  1KIG L;  3GIS X;  2P16 L;  1NZI A;  3L9J C;  4D0E A;  1KZD 1;  5F1A A;  4WQQ A;  1LPK A;  3DBZ A;  2RIA A;  4LOR A;  1UV0 A;  5CKN A;  1EMN A;  2OYU P;  4Y7A B;  5B1W A;  4Y6D B;  4CAJ A;  3HO5 A;  1BV4 A;  2M94 A;  3C8J A;  2CJI B;  1F7E A;  1X2T B;  2NPR A;  1K9I A;  2XC5 L;  3FF8 C;  5IKR A;  1KWZ A;  1DX5 I;  2W3I B;  3FF7 C;  1COU A;  1KZA 1;  3P5G A;  1CCF A;  1LIT A;  2FD6 A;  3TZI A;  1V4L A;  1FF7 A;  1RDJ 1;  1BUU A;  1OZ7 A;  1G1R A;  4WRF A;  3KCG L;  1JWI A;  1SB2 A;  4XBM A;  1ATB A;  3QMO A;  4MMX B;  1J34 A;  4WRE A;  1KWX A;  4GI0 A;  3HS7 A;  3SOQ A;  4BDX A;  1BNL A;  3Q3K B;  1IQE L;  2OYE P;  4BXW A;  1W8B L;  4CSY A;  2MHP A;  2UWP B;  4OTY A;  1K36 A;  1X2T A;  2MSB A;  3EGF A;  1HZ8 A;  3IKN A;  2BOH A;  2RIC A;  4JZD L;  1KWW A;  3BT2 A;  3KQB L;  1HUP A;  3BPS E;  3ASI A;  5B1R A;  5K8Y A;  1LMM A;  2OX9 A;  1J35 A;  3IKQ A;  1WHF A;  1V7P B;  2WPH E;  2P3T A;  1CWV A;  1PRH A;  3KL6 B;  2H9E L;  1ATE A;  1SZB A;  1A3P A;  5L2Y L;  1EPJ A;  2GGU A;  2VWL L;  1FVU B;  1EZQ B;  1ADX A;  3MDL A;  1UKM B;  1XFE A;  2JKH L;  1AFA 1;  3ENS A;  1R14 A;  2RA0 L;  3WHD A;  1BF9 A;  2FZZ L;  4PDC A;  1UMR A;  4KMB 1;  4N32 A;  2H9E C;  2I9B A;  5L30 L;  1YO8 A;  1EQG A;  2J95 B;  3NTB A;  2WZP P;  4KI1 E;  1QFK L;  1DQB A;  2PUQ L;  5M62 A;  4MTH A;  3P7H A;  2H2T B;  3TBD A;  1KG0 C;  4YMD A;  4N36 A;  4AQT A;  4OTJ A;  4M11 A;  4NG9 L;  2C6U A;  1ATA A;  3LN1 A;  2G00 L;  2ZWK A;  4ZET A;  2RIE A;  1HRF A;  3K9X A;  1AFD 1;  3CFW A;  1XDT R;  1RDI 1;  1UKM A;  1TPG A;  1IXX B;  1ESL A;  4BTT A;  3DEM A;  5IKQ A;  2MGR A;  2P93 L;  3ALS A;  1N1I A;  3P7G A;  1KWU A;  4WUW A;  4D0F A;  2Q1J B;  3FF9 A;  4WUX A;  2BQ7 A;  5JVZ A;  1P4L D;  2VVU L;  1UZQ A;  4RUT A;  4MMY B;  1UOS A;  3PAQ A;  1PW9 A;  4KZV A;  1KCG A;  1IJK C;  1RFN B;  3P5H A;  1NFY B;  1G1Q A;  3IKR A;  3UBU A;  2K2S B;  1L5G B;  1RDM 1;  1KWV A;  1MOX C;  4WRC A;  3G83 A;  2BOX A;  2Y7X B;  3FBY A;  5FFR A;  3GPR B;  2MGP A;  1IJQ A;  2GD4 A;  5JB9 E;  3C8K D;  5IKT A;  1KLO A;  1IP0 A;  2YHF A;  3WBR A;  1IXX A;  2D1J B;  2VH0 B;  2VWN L;  1IJK B;  1KWT A;  5E8D A;  1V3X B;  1SL4 A;  3P5I A;  3RR3 A;  4ZHA B;  1FE2 A;  1WMZ A;  2RHP A;  3SW2 A;  2E3X B;  2PHB B;  1KX1 A;  1QO3 C;  4QKG A;  5JBB E;  1LMJ A;  1UZK A;  4KZW A;  4N37 A;  3LIW B;  3VYK A;  4IOP B;  2AYL A;  5COX A;  1V4L B;  2BPE A;  2BRS A;  3KQG A;  1CEJ A;  4GK1 A;  4X8T L;  2W3K B;  4O1Z A;  2AFP A;  1X7A L;  1IOX A;  2Y82 B;  3GCX E;  1C3A B;  3CAD A;  5J6G G;  1HAF A;  1IOE L;  1TLE A;  1RDL 1;  3TH3 L;  4G96 A;  3P5B L;  1O5D L;  1EGG A;  1G1T A;  3H5C B;  4RRY A;  4ZH8 B;  3PGH A;  1HRE A;  1EGF A;  3BDW A;  4QKJ A;  1WHE A;  1SL6 A;  5LGK E;  4IOP A;  2Y5H L;  3KK6 A;  2XC4 L;  1U8C B;  4QKH A;  1OB1 C;  4FM5 A;  1DDX A;  4GKO G;  2KB9 A;  4LU5 A;  3P5D A;  2YGO A;  1CX2 A;  1KOE A;  3PAK A;  3CA7 A;  5FFS A;  4PH9 A;  3CCK A;  2Y81 B;  3IIT B;  1LPZ A;  1IQI L;  4RRW A;  1DY2 A;  2VWO L;  2UWL B;  3TGF A;  1YUK B;  3LTF B;  1RTM 1;  3BT1 A;  4COX A;  3ALU A;  2EI7 B;  3N8Y A;  3UBU B;  3P7F A;  1KLI L;  5KIR A;  1J9C L;  2ZQK A;  3ELA L;  3WWK B;  2J38 B;  1IQH L;  2WFT A;  1SB2 B;  2FLB L;  5I46 L;  4YLI A;  1JZN A;  5KTH A;  1CQE A;  5L2Z L;  2P26 A;  6COX A;  1DY1 A;  2OS9 A;  4JZE L;  3KRK A;  1MSB A;  2LS8 A;  2WPI E;  2ADX A;  2WPM E;  4ZAE B;  1U0N C;  4M18 A;  2ORK A;  1B9W A;  3ZYJ B;  1IVO C;  1CCV A;  3OLU A;  1EPI A;  1BJ3 B;  3CDG F;  3N8V A;  3PAR A;  1RJH A;  3PBF A;  1Z6E L;  4GJX A;  5B1X A;  1K37 A;  1E5U I;  4J6K A;  4M1G A;  1DY0 A;  4J6N A;  1KMB 1;  2P94 L;  4LQF A;  3FFG L;  3HO3 A;  3T3A A;  4JZF L;  1W7X L;  3F1S B;  2E3X C;  2VUV A;  2UWO B;  1F00 I;  2FLG A;  2YGQ A;  2VH6 B;  1UZP A;  1E8I A;  3POY A;  1EPH A;  1CVW L;  1JV2 B;  5F19 A;  3F6U L;  3WWK A;  1BCJ 1;  5JVY A;  1HT8 A;  1WMY A;  1G2M B;  2XBV L;  2Y7Z B;  1MPU A;  1NQL B;  1NPE B;  1X2W A;  3OLT A;  1IGZ A;  2J2U B;  2TGF A;  5FFT A;  2RNL A;  3HS5 A;  1BYF A;  1JBU L;  4Y79 B;  4N38 A;  3VLG A;  2WPK E;  1PWB A;  1FIF A;  1KX0 A;  3TK5 B;  3N8W A;  2WYG B;  2P28 B;  2BOU A;  4Z6A L;  4ISH L;  3U73 A;  1IQN L;  4A7I A;  1WT9 B;  2XC0 L;  1IQJ L;  1V7P A;  1APO A;  4RRZ A;  3G8K A;  1AUT L;  2KV3 A;  4TGF A;  3WH2 A;  4E52 A;  4BTI A;  1ATD A;  4WR9 A;  4CUF A;  3GPR C;  1FIH A;  1C3A A;  1AFB 1;  5KTI A;  1H8U A;  1HT5 A;  1IQK L;  3NJP C;  1HJ7 A;  4G9A A;  2RIB A;  4N34 A;  2WG4 B;  1YGC L;  1O7B T;  1TDQ B;  3LTG D;  1DVA L;  1UOS B;  3WSR A;  4EZM G;  3N8W B;  1NFX B;  4N33 A;  4S0U A;  3P5E A;  1JA3 A;  4X8V L;  4YT6 L;  5CKM A;  1FM5 A;  4JYU L;  1TOZ A;  2W2M E;  2XR6 A;  3G81 A;  1FAK L;  2J34 B;  1PXX A;  2VUZ A;  5IKV A;  3LC5 B;  1OZ7 B;  2K2T A;  3GPR A;  2Y80 B;  1PGE A;  1E87 A;  1T8C A;  4ZRV A;  2WYJ B;  3CEN L;  4X8S L;  4A94 C;  1LQD A;  1IOD B;  4YZU B;  4CUD A;  3ZYG A;  1K9J A;  3LN0 A;  1PTH A;  2VRP B;  1N7D A;  1L3Y A;  3QH0 A;  4J6Q A;  1EPG A;  2I83 A;  2BMG A;  2W2P E;  1Y17 A;  4M10 A;  3P5F A;  3HS6 A;  2EI6 B;  2WPL E;  4QKI A;  2I9A A;  1MQ6 L;  1UZJ A;  2Y5G L;  3CDG E;  2WG3 C;  4C9F A;  1U0N B;  3ALT A;  3V65 B;  2ORJ A;  2CL8 A;  4J6L A;  4UWW A;  4ZRW A;  4RS0 A;  2P3F L;  1B6E A;  3M9Z A;  2J94 B;  1XKA L;  3LC3 B;  2XBW L;  4YT7 L;  1HAE A;  1U0O A;  1FSB A;  4M17 A;  3IKP A;  2Y38 A;  1U67 A;  3QCW A;  5JW1 A;  1YPO A;  1EAI C;  4O02 B;  3FCS B;  4BXS A;  1HTN A;  2P3F N;  4G1M B;  1SL5 A;  1WU1 B;  3G84 A;  4X8U L;  1HQ8 A;  1YXK A;  4NA9 L;  5KN5 C;  2N40 A;  1NT0 A;  2PY2 A;  2WPJ E;  3LAQ A;  1Q4G A;  4Z0L A;  1PFX L;  2W2N E;  2IT6 A;  1U0O B;  4AK8 A;  2M74 A;  1JL9 A;  1P9J A;  1UEX B;  1XKB A;  1G1S A;  1WK1 A;  2VVV L;  2PR3 B;  2F9B L;  4E1G A;  1RDN 1;  2KNI A;  1KZE 1;  1IQG L;  1EGI A;  1FJS L;  3CS7 L;  4JYV L;  4UXM A;  1G2L B;  3ZHG A;  1J35 B;  1R13 A;  3HUP A;  1LPG A;  3GCW E;  1IGX A;  4XL1 A;  4D90 A;  2IT5 A;  4J6J A;  4J6M A;  1DIY A;  1GK5 A;  3FD4 A;  1FVU A;  1UEX A;  2W2Q E;  1NFW B;  4J6P A;  5FDQ A;  3WH3 A;  2W86 A;  1GZ2 A;  2RID A;  1YXJ A;  1IQF L;  3ZHG D;  1KLJ L;  1NFU B;  3TK6 B;  3WBP A;  2DDU A;  1WT9 A;  1F7M A;  2VWM K;  2BPH A;  1KSN B;  3KQC L;  4Y76 B;  1EQH A;  4BTU A;  3Q7D A;  3G8L A;  3KQE L;  2VJ3 A;  3KMB 1;  1TN3 A;  3SOB B;  2KL7 A;  2J4I B;  2KV4 A;  1JWI B;  3GPR D;  1F0S B;  1HCG B;  2W2O E;  3M36 L;  4ZXY L;  4C16 A;  1T8D A;  3IJE B;  1B08 A;  1M1X B;  1RDK 1;  4N35 A;  1C5M F;  1J34 B;  2YGP A;  5CKQ A;  3VPP A;  2P95 L;  1IQM L;  5JB8 E;  3KQD L;  5EGM B;  2P3U A;  4Y7B B;  2B7D L;  2Y5F L;  3C9A C;  3N8Y B;  4CUE A;  1XAR A;  1APQ A;  1X2W B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...