3CFWA

L-selectin lectin and egf domains
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
156
structure length
156
Chain Sequence
b'WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-selectin
publication title Glycan Bound to the Selectin Low Affinity State Engages Glu-88 to Stabilize the High Affinity State under Force.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 35
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2008-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00059 Lectin_C Lectin C-type domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3cfwA02
3.10.100.10 Alpha Beta Roll Mannose-Binding Protein A; Chain A Mannose-Binding Protein A, subunit A 3cfwA01
1O7BT 4UXMA 3C9AC 1R13A 1UMRC 1HT8A 4RRWA 1C5MF 1HQ8A 4AK8A 3T3AA 3WSRA 2XBWL 2KB9A 3P7HA 1G1TA 2F9BL 1C3AB 1KCGA 1IQFL 1EAIC 1KZA1 4C9FA 1EMOA 3BT1A 2FD6A 4D90A 1J34B 3CCKA 3PAQA 3GPRA 1E8IA 2RHPA 1V3XB 2P3FL 4ZRVA 3VLGA 4LORA 4BDWA 3BX4A 2Y7XB 3M36L 2ADXA 4ZH8B 2Y38A 4G96A 2VVVL 3BDWA 1BCH1 4Y6DB 3LC3B 1WHEA 2MHPA 1T8CA 2Y81B 2BMGA 4Y7BB 1FJSL 2WPIE 3PARA 3IKQA 2EI7B 1RDN1 1JWIB 1XARA 3SOVA 1EMNA 1B9WA 1PWBA 4KZWA 1U0NB 2K2SB 3GPRD 2RICA 1HAFA 1KWZA 2W2QE 3UBUB 3FD4A 4M17A 2EI6B 3WWKA 4LMFA 5E8DA 5JVYA 3G81A 4MMXB 3TH3L 1IQGL 3TK5B 3IITB 1CWVA 3VPPA 3U7UG 4BXSA 2H2TB 1J34A 4CSYA 1KZB1 2H2RA 3HS7A 1RTM1 2VWOL 3TK6B 1HUPA 2LS8A 3KK6A 1WU1B 4M18A 1KLIL 4J6MA 4BTUA 1BJ3B 1IJKB 3G84A 1RDL1 1W8BL 4GJXA 4Y71B 4CUEA 4M1GA 3NT1A 1HREA 4N38A 2MGPA 5K0HB 1B6EA 5J6GG 5K8YA 2M74A 1NFYB 3GCWE 4X8TL 3HUPA 2P26A 2XC4L 3ALTA 3CS7L 1KOEA 4CAJA 3Q3KB 1JWIA 5B1RA 1Z6CA 3CENL 5CKQA 1UKMB 2EI8B 1KZE1 1IGXA 1J35B 1KZD1 1IQML 1ADXA 1UEXA 3PGHA 3UBUA 2XC5L 1BV4A 3FF7C 5JBBE 3HO3A 1N7DA 4LQFA 5KTIA 3ZHGA 2BQ7A 3MDLA 1PFXL 1BUUA 4N32A 5KTHA 4PH9A 3N8WB 4LU5A 3WH2A 5JBAE 5COXA 3U73A 3ENSA 1FSBA 2I83A 1NFXB 1TDQB 1APOA 1FFMA 1KWTA 2UWPB 3P5BL 4CUFA 1ATAA 1SZBA 1KWWA 2P3UA 1X7AL 1BJ3A 4M11A 2WPLE 2BPEA 4YZUB 2Y80B 2G00L 3WBRA 1KIGL 3FBYA 2XR6A 1L3YA 2RA0L 4A7IA 1DQBA 1UOSA 4ZXXL 3EGFA 2CL8A 3L9JC 3ZHGD 1GZ2A 4O1ZA 1QFKL 1F02I 1MOXC 4JYVL 2MTIA 3K9XA 2XBYL 5JBCE 1FF7A 1KWXA 1KWUA 1LQDA 5FFRA 3C8JA 1X2TA 2RIBA 1PGEA 1EPHA 4X8SL 1W7XL 5IKTA 3WWKC 1HT5A 1OZ7B 2VWNL 2VWMK 1MQ6L 4YMDA 4PP8A 1O5DL 1F0SB 3CDGE 2VUVA 1YUKB 1AFA1 3N8WA 1IQIL 2P95L 2Q1JB 2RIDA 1UZKA 2AFPA 3CA7A 1U67A 4WUXA 1UZPA 1OB1C 4D0FA 2W3KB 1J9CL 1XKBA 2IT5A 4GI0A 1KZC1 4RRYA 3QMOA 2VRPB 1IODA 3ASIA 2KMB1 1P0SL 4XL1A 3PBFA 4GK1A 1KX1A 4E1GA 1G2LB 3KQBL 1RDK1 2CJIB 2ZIBA 3M37L 4ZXYL 1SL5A 4WR9A 5LGKE 2MGRA 4X8VL 1YXJA 3IKPA 3GCXE 3NCXA 3HO4A 1WK1A 3OLTA 1EPJA 5F19A 1RFNB 1WMZA 1EBVA 4ZAEB 2M94A 2W86A 2PY2A 4X8UL 3P7GA 2VVCK 1KLJL 1KG0C 1G1QA 1RDO1 1U0NC 4JZFL 1Y17B 2OX8A 1RDM1 3ZYJB 1KWVA 1CEJA 2RIAA 1KLOA 1QDDA 2GD4A 1COUA 3HS5A 2P16L 1C3AA 4J6LA 3SOBB 4D0EA 1KSNB 1SB2B 1SL4A 2ZWKA 4G9AA 2W2PE 4QKJA 4Y76B 2XBXL 2WG4B 2VVUL 1ATBA 2J2UB 4BDXA 3ALSA 5I46L 3G8KA 3IKNA 2BZ6L 3NJPC 1IOEL 2KL7A 3P5IA 4KI1E 4Z0KB 1YUGA 4GJ0A 2I9BA 1URKA 3DBZA 2WPKE 3TBDA 4Z0LA 2E3XB 4NG9L 4GKOG 2DDUA 3KQEL 2ORJA 2XR5A 4FM5A 3RS1A 3LN1A 4O02B 1P9JA 1LMJA 2BQ6A 1F7EA 3P5DA 2Y82B 5JW1A 4WQQA 1FE2A 3V65B 3P5FA 1YTTA 3PAKA 1BYFA 1WT9B 1JA3A 4WRFA 2RIEA 3ALUA 3V64C 2PR3B 1HCGB 4WREA 3NTBA 2VH6B 5IKQA 2VWLL 2OX9A 1IQHL 4RRZA 2PF5A 2WPME 3LC5B 1O7CT 1U0OB 2IT6A 1BF9A 1HRFA 3LN0A 1FAXL 1HX2A 1HTNA 4J6NA 4N33A 3VYKA 2P94L 3IKRA 1SB2A 3OLUA 1LITA 1H8UA 2UWOB 4J6PA 5FFTA 1IQEL 2J34B 3CADA 3GPRC 1YO8A 4IOPB 4NGAL 4ZESA 3NTGA 1G1SA 3KMB1 4CUDA 2BOXA 1G2MB 2Y5HL 2NPRA 1YPQA 4J6KA 3ZYIB 4S0UA 2Y5GL 3WHDA 3P5EA 1B08A 4QKHA 1E5UI 1F7MA 1JL9A 3ZYGA 1LPZA 2N40A 4JYUL 4N34A 2VJ3A 4QKGA 2KV4A 3KQDL 5F1AA 4C16A 2FLGA 1P4LD 1EQHA 1IOXA 3ELAL 1FIHA 1IQLL 1DY1A 1NFUB 4MMZB 3WBPA 2W2OE 2J95B 1X2WB 1WHFA 2VUZA 1UKMA 5L2YL 1UZJA 5CKNA 1MQ5L 1PTHA 1J35A 4DN8A 2WYJB 1L5GB 2P3TA 3GISX 1KMB1 5IKRA 1U0OA 2YGOA 2W26B 1I0UA 4M10A 3FFGL 2C6UA 4COXA 1NFWB 1XDTR 1YUFA 2BOUA 2K2TA 1DX5I 1BNLA 2WPHE 1PRHA 4WRCA 2BPDA 2P93L 2BOKL 2J4IB 4IOPA 1PXXA 3P5HA 4MMYB 2GGXA 3F6UL 4XLWA 3HO5A 4ZRWA 1YPOA 1DIYA 1NZIA 6COXA 1G1RA 1UZQA 1NQLB 2FLRL 2FZZL 1RJHA 1N1IA 2OS9A 4J6QA 3TGFA 1DDXA 2H9EL 5JVZA 1XPHA 4G1MB 4UWWA 2YHFA 3TZIA 4JZEL 3WWKB 3QH0A 3MQEA 3IJEB 3FCSB 3KL6B 1F00I 4N36A 1TOZA 3DEMA 4OTJA 5L2ZL 2UWLB 2OYEP 2J38B 2VH0B 4BTTA 3G8LA 4N37A 4N35A 3N8XA 3SW2A 1X2WA 4BTIA 2BO2A 1F0RB 2I9AA 3C22A 3HPTA 5B1XA 5CKMA 1V7PB 1QO3C 4EZMG 3BPSE 1AFB1 1BCJ1 4RUTA 1IGZA 1JZNA 1IP0A 1MSBA 1IXXB 1K37A 1K36A 1ESLA 1YXKA 4YLIA 3R05A 1OZ7A 1JV2B 3POYA 5JB9E 1A3PA 1KWYA 3N8YB 2WPJE 4XBMA 5JB8E 1Q4GA 3F1SB 2W2NE 1T8DA 1V4LB 1IJQA 4ZETA 2BRSA 3SOQA 2MSBA 1CVWL 3G83A 1YGCL 1P1ZD 2WFTA 3H5CB 2P28B 4WUWA 2XC0L 1EQGA 4Y79B 1HJ7A 3CDGF 2VRPA 2RNLA 4BXWA 1DVAL 1UEXB 1NT0A 4RS0A 1IJKC 1UMRA 2E3XC 3QCWA 1GK5A 1RDJ1 2PHBB 3FF9A 5FFSA 1M1XB 1HAEA 2AYLA 1E87A 1HYRA 5KIRA 2WG3C 3BT2A 1FAKL 2GGUA 1CCFA 4E52A 4NA9L 2TGFA 1PW9A 3M9ZA 2B7DL 5F2QA 2KV3A 2W3IB 2ORKA 3FF8C 5B1WA 1CX2A 4YT6L 3N8VA 3KRKA 1YPUA 4KZVA 1Y17A 1FVUB 1V7PA 1MUQA 1FIFA 1EGFA 5L30L 2XBVL 4ISIL 3LTGD 5CISA 1IXXA 1MPUA 3P5GA 5KN5C 2J94B 2WYGB 1RDI1 1TLGA 3LIWB 4KMB1 1JBUL 1EPGA 4J6JA 3VYJA 1DV8A 4Y7AB 1CVUA 1EGGA 3N8YA 1UOSB 3RR3A 1NPEB 1APQA 1TPGA 1Z6EL 2Y5FL 4WCOA 1V4LA 1LPGA 4PDCA 1IQJL 3Q7DA 1U8CB 3LAQA 1AFD1 1DY2A 1EGIA 2OYUP 1R14A 1X2TB 1XKAL 1K9JA 3KCGL 2BOHA 5IKVA 3NCWA 1ZAQA 3KQCL 3N8ZA 1WMYA 1CQEA 3P7FA 2GO0A 1CCVA 1IQNL 1TN3A 4QKIA 5EGMB 2BPHA 1FM5A 2ZQKA 3CFWA 1HZ8A 5M62A 4ISHL 3GPRB 1K9IA 1TLEA 1WT9A 2JKHL 2P3FN 4YT7L 1LPKA 5FDQA 3WBQA 3HS6A 3LTFB 1FVUA 3BX4B 1DY0A 1IODB 4JZDL 4ZHAB 1EPIA 1KX0A 1ATDA 3C8KD 2FLBL 4AQTA 1XFEA 4RRXA 3KQGA 3WH3A 4OTYA 1IQKL 3BDWB 2WFXB 1SL6A 4MTHA 2BQWA 2W2ME 2Y7ZB 2D1JB 3K7BA 1IVOC 1ATEA 1UV0A 4TGFA 2YGPA 1EZQB 1AUTL 2PUQL 4Z6AL
chains in the Genus database with same CATH superfamily
1O7BT 4UXMA 3C9AC 1R13A 1UMRC 3S6XA 1HT8A 4RRWA 1C5MF 1HQ8A 4AK8A 3T3AA 3WSRA 2XBWL 2KB9A 3P7HA 1G1TA 2F9BL 1C3AB 1KCGA 1IQFL 2VRSA 1EAIC 2JJLA 1KZA1 4C9FA 1EMOA 3BT1A 2FD6A 4D90A 1J34B 3CCKA 3PAQA 3GPRA 1E8IA 2RHPA 1V3XB 2P3FL 4ZRVA 3VLGA 4LORA 4BDWA 3BX4A 2Y7XB 3M36L 2ADXA 4ZH8B 2Y38A 4G96A 2VVVL 3BDWA 1BCH1 4Y6DB 3LC3B 1WHEA 2MHPA 1T8CA 2Y81B 2BMGA 4Y7BB 1FJSL 2WPIE 2KNIA 3PARA 3IKQA 2EI7B 1RDN1 1JWIB 1XARA 3SOVA 1EMNA 1B9WA 1PWBA 4KZWA 1U0NB 2K2SB 3GPRD 2RICA 1HAFA 1KWZA 2W2QE 3UBUB 3FD4A 4M17A 2EI6B 3WWKA 1V1IA 4LMFA 5E8DA 5JVYA 3G81A 4MMXB 3TH3L 1IQGL 3TK5B 3IITB 1CWVA 3VPPA 3U7UG 4BXSA 2H2TB 1J34A 4CSYA 1KZB1 2H2RA 3HS7A 1RTM1 2VWOL 3TK6B 1HUPA 2LS8A 4GU4A 3KK6A 1WU1B 4M18A 1KKEA 1KLIL 4J6MA 4BTUA 1BJ3B 1IJKB 3G84A 1RDL1 1W8BL 4GJXA 4Y71B 4CUEA 4M1GA 3NT1A 1HREA 4N38A 2MGPA 5K0HB 1B6EA 5J6GG 5K8YA 2M74A 1NFYB 3GCWE 4X8TL 3HUPA 2P26A 2XC4L 3ALTA 3CS7L 1KOEA 4CAJA 3Q3KB 1JWIA 5B1RA 1Z6CA 3CENL 5CKQA 1UKMB 2EI8B 1KZE1 1IGXA 1J35B 1KZD1 1IQML 1ADXA 1UEXA 3PGHA 3UBUA 2XC5L 1BV4A 3FF7C 5JBBE 3HO3A 1N7DA 4LQFA 5KTIA 3ZHGA 2BQ7A 3MDLA 1PFXL 1BUUA 4N32A 5KTHA 2BT7A 4PH9A 3N8WB 4LU5A 3WH2A 5JBAE 2YGQA 5COXA 3U73A 3ENSA 2WZPP 1FSBA 2I83A 1NFXB 1TDQB 1APOA 1FFMA 1KWTA 2UWPB 3P5BL 4CUFA 1ATAA 1SZBA 1KWWA 2P3UA 1X7AL 1BJ3A 4M11A 2WPLE 2BPEA 4YZUB 2Y80B 2G00L 3WBRA 1KIGL 3FBYA 2XR6A 1L3YA 2RA0L 4A7IA 1DQBA 1UOSA 4ZXXL 3EGFA 2CL8A 3L9JC 3ZHGD 1GZ2A 4O1ZA 1QFKL 1F02I 1MOXC 4JYVL 2MTIA 3K9XA 2XBYL 5JBCE 1FF7A 1KWXA 1KWUA 1LQDA 5FFRA 3C8JA 1X2TA 2RIBA 1PGEA 1EPHA 4X8SL 1W7XL 5IKTA 3WWKC 1HT5A 1OZ7B 2VWNL 2VWMK 1MQ6L 4YMDA 4PP8A 1O5DL 1F0SB 3CDGE 2VUVA 1YUKB 1AFA1 3N8WA 1IQIL 2P95L 2Q1JB 2RIDA 1UZKA 2AFPA 3CA7A 1U67A 4WUXA 1UZPA 1OB1C 4D0FA 2W3KB 1J9CL 1XKBA 2IT5A 4GI0A 1KZC1 4RRYA 3QMOA 2VRPB 1IODA 3ASIA 2KMB1 1P0SL 4XL1A 3PBFA 4GK1A 1KX1A 4E1GA 1G2LB 3KQBL 1RDK1 2CJIB 2ZIBA 3M37L 4ZXYL 1SL5A 4WR9A 5LGKE 2MGRA 4X8VL 1YXJA 3IKPA 3GCXE 2BT8A 3NCXA 3HO4A 1WK1A 3OLTA 1EPJA 5F19A 1RFNB 2H9EC 1EBVA 4ZAEB 1WMZA 2W86A 2M94A 4X8UL 2PY2A 3P7GA 2VVCK 1KLJL 1KG0C 1G1QA 1RDO1 1U0NC 4JZFL 1Y17B 2OX8A 1RDM1 3ZYJB 1KWVA 1CEJA 2RIAA 1KLOA 1QDDA 2GD4A 1COUA 3HS5A 2P16L 1C3AA 4J6LA 3SOBB 4D0EA 1KSNB 1SB2B 1SL4A 2ZWKA 4G9AA 2W2PE 4QKJA 4Y76B 2XBXL 2WG4B 2VVUL 1ATBA 2J2UB 4BDXA 3ALSA 1V1HA 5I46L 3G8KA 3IKNA 2BZ6L 3NJPC 1IOEL 2KL7A 4A94C 3P5IA 4KI1E 4Z0KB 1YUGA 4GJ0A 2I9BA 1URKA 3DBZA 2WPKE 3TBDA 4Z0LA 2E3XB 4NG9L 4GKOG 2DDUA 3KQEL 2ORJA 2XR5A 4FM5A 3RS1A 3LN1A 1QIUA 4O02B 1P9JA 1LMJA 2BQ6A 1F7EA 3P5DA 2Y82B 5JW1A 4WQQA 1FE2A 3V65B 3P5FA 1YTTA 3PAKA 1BYFA 1WT9B 1JA3A 4WRFA 2RIEA 3ALUA 3V64C 2PR3B 1HCGB 4WREA 3NTBA 2VH6B 5IKQA 2VWLL 2OX9A 1IQHL 4RRZA 2PF5A 2WPME 3LC5B 1O7CT 1U0OB 2IT6A 1BF9A 1HRFA 3LN0A 1FAXL 1HX2A 1HTNA 4J6NA 4N33A 3VYKA 2P94L 3IKRA 1SB2A 3OLUA 1LITA 1H8UA 2UWOB 4J6PA 5FFTA 1IQEL 2J34B 3CADA 3GPRC 1YO8A 4IOPB 4NGAL 4ZESA 3NTGA 1G1SA 2HOXA 3KMB1 4CUDA 2BOXA 1G2MB 2Y5HL 2NPRA 1YPQA 4J6KA 3ZYIB 4S0UA 2Y5GL 3WHDA 3P5EA 1B08A 4QKHA 1E5UI 1LMMA 1F7MA 1JL9A 3ZYGA 1LPZA 2N40A 4JYUL 4N34A 2VJ3A 4QKGA 2KV4A 3KQDL 5F1AA 4C16A 2FLGA 1P4LD 1EQHA 1IOXA 3ELAL 1FIHA 1IQLL 1DY1A 1NFUB 4MMZB 3WBPA 2W2OE 2J95B 1X2WB 1WHFA 2VUZA 1UKMA 5L2YL 1UZJA 5CKNA 1MQ5L 1PTHA 1J35A 4DN8A 4GU3A 2WYJB 1L5GB 2P3TA 3GISX 1KMB1 5IKRA 1U0OA 2YGOA 2W26B 1I0UA 4M10A 3FFGL 2C6UA 4COXA 1NFWB 1XDTR 1YUFA 2BOUA 2K2TA 1DX5I 1BNLA 2WPHE 1PRHA 4WRCA 2BPDA 2P93L 2BOKL 2J4IB 4IOPA 1PXXA 3P5HA 4MMYB 2GGXA 3F6UL 4XLWA 3HO5A 4ZRWA 1YPOA 1DIYA 1NZIA 6COXA 1G1RA 1UZQA 1NQLB 2FLRL 2FZZL 1RJHA 1N1IA 2OS9A 4J6QA 3TGFA 1DDXA 2H9EL 5JVZA 1XPHA 4G1MB 4UWWA 2YHFA 3TZIA 4JZEL 3WWKB 3QH0A 3MQEA 3IJEB 3FCSB 3KL6B 1F00I 4N36A 1TOZA 3DEMA 4OTJA 5L2ZL 2UWLB 2OYEP 2J38B 2VH0B 4BTTA 3G8LA 4N37A 4N35A 3N8XA 3SW2A 1X2WA 4BTIA 2BO2A 1F0RB 2I9AA 3C22A 3HPTA 5B1XA 5CKMA 1V7PB 1QO3C 2HORA 4EZMG 3BPSE 1AFB1 1BCJ1 4RUTA 1IGZA 1JZNA 1IP0A 1MSBA 1IXXB 1K37A 1K36A 1ESLA 1YXKA 4YLIA 3R05A 1OZ7A 1JV2B 3POYA 5JB9E 1A3PA 1KWYA 3N8YB 2WPJE 4XBMA 5JB8E 1Q4GA 3F1SB 2W2NE 1T8DA 1V4LB 1IJQA 4ZETA 2BRSA 3SOQA 2MSBA 1CVWL 3G83A 1YGCL 1P1ZD 2WFTA 3H5CB 2BSFA 2P28B 2XC0L 4WUWA 1EQGA 4Y79B 1HJ7A 3CDGF 2VRPA 2RNLA 4BXWA 1DVAL 1UEXB 1NT0A 4RS0A 1IJKC 1UMRA 2E3XC 3QCWA 1GK5A 1RDJ1 2PHBB 3FF9A 5FFSA 1M1XB 1HAEA 2AYLA 1E87A 1HYRA 5KIRA 2WG3C 3BT2A 1FAKL 2GGUA 1CCFA 4E52A 4NA9L 2TGFA 1PW9A 3M9ZA 2B7DL 5F2QA 2KV3A 2W3IB 2ORKA 3FF8C 5B1WA 1CX2A 4YT6L 3N8VA 3KRKA 1YPUA 4KZVA 1Y17A 1FVUB 1V7PA 1MUQA 1FIFA 1EGFA 5L30L 2XBVL 4ISIL 3LTGD 5CISA 1IXXA 1MPUA 3P5GA 5KN5C 2J94B 2WYGB 1RDI1 1TLGA 3LIWB 4KMB1 1JBUL 1EPGA 4J6JA 3VYJA 1DV8A 4Y7AB 1CVUA 1EGGA 3N8YA 1UOSB 3RR3A 1NPEB 1APQA 1TPGA 1Z6EL 2Y5FL 4WCOA 1V4LA 1LPGA 4PDCA 1IQJL 3Q7DA 1U8CB 3LAQA 1AFD1 1DY2A 1EGIA 2OYUP 1R14A 1X2TB 1XKAL 1K9JA 3KCGL 2BOHA 5IKVA 3NCWA 1ZAQA 3KQCL 3N8ZA 1WMYA 1CQEA 3P7FA 2GO0A 1CCVA 1IQNL 1TN3A 4QKIA 5EGMB 2BPHA 1FM5A 2ZQKA 3CFWA 1HZ8A 5M62A 4ISHL 1LK9A 3GPRB 1K9IA 1TLEA 1WT9A 2JKHL 2P3FN 4YT7L 1LPKA 5FDQA 3WBQA 3HS6A 3LTFB 1FVUA 3BX4B 1DY0A 1IODB 4JZDL 4ZHAB 1EPIA 1KX0A 1ATDA 3C8KD 2FLBL 4AQTA 1XFEA 4RRXA 3KQGA 3WH3A 4OTYA 1IQKL 3BDWB 2WFXB 1SL6A 4MTHA 2BQWA 2W2ME 2Y7ZB 2D1JB 3K7BA 1IVOC 1ATEA 1UV0A 4TGFA 2YGPA 1EZQB 1AUTL 2PUQL 4Z6AL
chains in the Genus database with same CATH topology
1O7BT 4UXMA 3C9AC 1R13A 1UMRC 3S6XA 1HT8A 4RRWA 1C5MF 1HQ8A 4AK8A 3T3AA 3WSRA 2XBWL 2KB9A 3P7HA 1G1TA 2F9BL 1C3AB 1KCGA 1IQFL 1EAIC 1KZA1 4C9FA 1EMOA 3BT1A 2FD6A 4D90A 1J34B 3CCKA 3PAQA 3GPRA 1E8IA 2RHPA 1V3XB 2P3FL 4ZRVA 3VLGA 4LORA 4BDWA 3BX4A 2Y7XB 3M36L 2ADXA 4ZH8B 2Y38A 4G96A 2VVVL 3BDWA 1BCH1 4Y6DB 3LC3B 1WHEA 2MHPA 1T8CA 2Y81B 2BMGA 4Y7BB 1FJSL 2WPIE 2KNIA 3PARA 3IKQA 2EI7B 1RDN1 1JWIB 1XARA 3SOVA 1EMNA 1B9WA 1PWBA 4KZWA 1U0NB 2K2SB 3GPRD 2RICA 1HAFA 1KWZA 2W2QE 3UBUB 3FD4A 4M17A 2EI6B 3WWKA 4LMFA 5E8DA 5JVYA 3G81A 4MMXB 3TH3L 1IQGL 3TK5B 3IITB 1CWVA 3VPPA 3U7UG 4BXSA 2H2TB 1J34A 4CSYA 1KZB1 2H2RA 3HS7A 1RTM1 2VWOL 3TK6B 1HUPA 2LS8A 3KK6A 1WU1B 4M18A 1KLIL 4J6MA 4BTUA 1BJ3B 1IJKB 3G84A 1RDL1 1W8BL 4GJXA 4Y71B 4CUEA 4M1GA 3NT1A 1HREA 4N38A 2MGPA 5K0HB 1B6EA 5J6GG 5K8YA 2M74A 1NFYB 3GCWE 4X8TL 3HUPA 2P26A 2XC4L 3ALTA 3CS7L 1KOEA 4CAJA 3Q3KB 1JWIA 5B1RA 1Z6CA 3CENL 5CKQA 1UKMB 2EI8B 1KZE1 1IGXA 1J35B 1KZD1 1IQML 1ADXA 1UEXA 3PGHA 3UBUA 2XC5L 1BV4A 3FF7C 5JBBE 3HO3A 1N7DA 4LQFA 5KTIA 3ZHGA 2BQ7A 3MDLA 1PFXL 1BUUA 4N32A 5KTHA 4PH9A 3N8WB 4LU5A 3WH2A 5JBAE 2YGQA 5COXA 3U73A 3ENSA 2WZPP 1FSBA 2I83A 1NFXB 1TDQB 1APOA 1FFMA 1KWTA 2UWPB 3P5BL 4CUFA 1ATAA 1SZBA 1KWWA 2P3UA 1X7AL 1BJ3A 4M11A 2WPLE 2BPEA 4YZUB 2Y80B 2G00L 3WBRA 1KIGL 3FBYA 2XR6A 1L3YA 2RA0L 4A7IA 1DQBA 1UOSA 4ZXXL 3EGFA 2CL8A 3L9JC 3ZHGD 1GZ2A 4O1ZA 1QFKL 1F02I 1MOXC 4JYVL 2MTIA 3K9XA 2XBYL 5JBCE 1FF7A 1KWXA 1KWUA 1LQDA 5FFRA 3C8JA 1X2TA 2RIBA 1PGEA 1EPHA 4X8SL 1W7XL 5IKTA 3WWKC 1HT5A 1OZ7B 2VWNL 2VWMK 1MQ6L 4YMDA 4PP8A 1O5DL 1F0SB 3CDGE 2VUVA 1YUKB 1AFA1 3N8WA 1IQIL 2P95L 2Q1JB 2RIDA 1UZKA 2AFPA 3CA7A 1U67A 4WUXA 1UZPA 1OB1C 4D0FA 2W3KB 1J9CL 1XKBA 2IT5A 4GI0A 1KZC1 4RRYA 3QMOA 2VRPB 1IODA 3ASIA 2KMB1 1P0SL 4XL1A 3PBFA 4GK1A 1KX1A 4E1GA 1G2LB 3KQBL 1RDK1 2CJIB 2ZIBA 3M37L 4ZXYL 1SL5A 4WR9A 5LGKE 2MGRA 4X8VL 1YXJA 3IKPA 3GCXE 3NCXA 3HO4A 1WK1A 3OLTA 1EPJA 5F19A 1RFNB 2H9EC 1EBVA 4ZAEB 1WMZA 2W86A 2M94A 4X8UL 2PY2A 3P7GA 2VVCK 1KLJL 1KG0C 1G1QA 1RDO1 1U0NC 4JZFL 1Y17B 2OX8A 1RDM1 3ZYJB 1KWVA 1CEJA 2RIAA 1KLOA 1QDDA 2GD4A 1COUA 3HS5A 2P16L 1C3AA 4J6LA 3SOBB 4D0EA 1KSNB 1SB2B 1SL4A 2ZWKA 4G9AA 2W2PE 4QKJA 4Y76B 2XBXL 2WG4B 2VVUL 1ATBA 2J2UB 4BDXA 3ALSA 5I46L 3G8KA 3IKNA 2BZ6L 3NJPC 1IOEL 2KL7A 4A94C 3P5IA 4KI1E 4Z0KB 1YUGA 4GJ0A 2I9BA 1URKA 3DBZA 2WPKE 3TBDA 4Z0LA 2E3XB 4NG9L 4GKOG 2DDUA 3KQEL 2ORJA 2XR5A 4FM5A 3RS1A 3LN1A 4O02B 1P9JA 1LMJA 2BQ6A 1F7EA 3P5DA 2Y82B 5JW1A 4WQQA 1FE2A 3V65B 3P5FA 1YTTA 3PAKA 1BYFA 1WT9B 1JA3A 4WRFA 2RIEA 3ALUA 3V64C 2PR3B 1HCGB 4WREA 3NTBA 2VH6B 5IKQA 2VWLL 2OX9A 1IQHL 4RRZA 2PF5A 2WPME 3LC5B 1O7CT 1U0OB 2IT6A 1BF9A 1HRFA 3LN0A 1FAXL 1HX2A 1HTNA 4J6NA 4N33A 3VYKA 2P94L 3IKRA 1SB2A 3OLUA 1LITA 1H8UA 2UWOB 4J6PA 5FFTA 1IQEL 2J34B 3CADA 3GPRC 1YO8A 4IOPB 4NGAL 4ZESA 3NTGA 1G1SA 3KMB1 4CUDA 2BOXA 1G2MB 2Y5HL 2NPRA 1YPQA 4J6KA 3ZYIB 4S0UA 2Y5GL 3WHDA 3P5EA 1B08A 4QKHA 1E5UI 1LMMA 1F7MA 1JL9A 3ZYGA 1LPZA 2N40A 4JYUL 4N34A 2VJ3A 4QKGA 2KV4A 3KQDL 5F1AA 4C16A 2FLGA 1P4LD 1EQHA 1IOXA 3ELAL 1FIHA 1IQLL 1DY1A 1NFUB 4MMZB 3WBPA 2W2OE 2J95B 1X2WB 1WHFA 2VUZA 1UKMA 5L2YL 1UZJA 5CKNA 1MQ5L 1PTHA 1J35A 4DN8A 2WYJB 1L5GB 2P3TA 3GISX 1KMB1 5IKRA 1U0OA 2YGOA 2W26B 1I0UA 4M10A 3FFGL 2C6UA 4COXA 1NFWB 1XDTR 1YUFA 2BOUA 2K2TA 1DX5I 1BNLA 2WPHE 1PRHA 4WRCA 2BPDA 2P93L 2BOKL 2J4IB 4IOPA 1PXXA 3P5HA 4MMYB 2GGXA 3F6UL 4XLWA 3HO5A 4ZRWA 1YPOA 1DIYA 1NZIA 6COXA 1G1RA 1UZQA 1NQLB 2FLRL 2FZZL 1RJHA 1N1IA 2OS9A 4J6QA 3TGFA 1DDXA 2H9EL 5JVZA 1XPHA 4G1MB 4UWWA 2YHFA 3TZIA 4JZEL 3WWKB 3QH0A 3MQEA 3IJEB 3FCSB 3KL6B 1F00I 4N36A 1TOZA 3DEMA 4OTJA 5L2ZL 2UWLB 2OYEP 2J38B 2VH0B 4BTTA 3G8LA 4N37A 4N35A 3N8XA 3SW2A 1X2WA 4BTIA 2BO2A 1F0RB 2I9AA 3C22A 3HPTA 5B1XA 5CKMA 1V7PB 1QO3C 4EZMG 3BPSE 1AFB1 1BCJ1 4RUTA 1IGZA 1JZNA 1IP0A 1MSBA 1IXXB 1K37A 1K36A 1ESLA 1YXKA 4YLIA 3R05A 1OZ7A 1JV2B 3POYA 5JB9E 1A3PA 1KWYA 3N8YB 2WPJE 4XBMA 5JB8E 1Q4GA 3F1SB 2W2NE 1T8DA 1V4LB 1IJQA 4ZETA 2BRSA 3SOQA 2MSBA 1CVWL 3G83A 1YGCL 1P1ZD 2WFTA 3H5CB 2P28B 4WUWA 2XC0L 1EQGA 4Y79B 1HJ7A 3CDGF 2VRPA 2RNLA 4BXWA 1DVAL 1UEXB 1NT0A 4RS0A 1IJKC 1UMRA 2E3XC 3QCWA 1GK5A 1RDJ1 2PHBB 3FF9A 5FFSA 1M1XB 1HAEA 2AYLA 1E87A 1HYRA 5KIRA 2WG3C 3BT2A 1FAKL 2GGUA 1CCFA 4E52A 4NA9L 2TGFA 1PW9A 3M9ZA 2B7DL 5F2QA 2KV3A 2W3IB 2ORKA 3FF8C 5B1WA 1CX2A 4YT6L 3N8VA 3KRKA 1YPUA 4KZVA 1Y17A 1FVUB 1V7PA 1MUQA 1FIFA 1EGFA 5L30L 2XBVL 4ISIL 3LTGD 5CISA 1IXXA 1MPUA 3P5GA 5KN5C 2J94B 2WYGB 1RDI1 1TLGA 3LIWB 4KMB1 1JBUL 1EPGA 4J6JA 3VYJA 1DV8A 4Y7AB 1CVUA 1EGGA 3N8YA 1UOSB 3RR3A 1NPEB 1APQA 1TPGA 1Z6EL 2Y5FL 4WCOA 1V4LA 1LPGA 4PDCA 1IQJL 3Q7DA 1U8CB 3LAQA 1AFD1 1DY2A 1EGIA 2OYUP 1R14A 1X2TB 1XKAL 1K9JA 3KCGL 2BOHA 5IKVA 3NCWA 1ZAQA 3KQCL 3N8ZA 1WMYA 1CQEA 3P7FA 2GO0A 1CCVA 1IQNL 1TN3A 4QKIA 5EGMB 2BPHA 1FM5A 2ZQKA 3CFWA 1HZ8A 5M62A 4ISHL 3GPRB 1K9IA 1TLEA 1WT9A 2JKHL 2P3FN 4YT7L 1LPKA 5FDQA 3WBQA 3HS6A 3LTFB 1FVUA 3BX4B 1DY0A 1IODB 4JZDL 4ZHAB 1EPIA 1KX0A 1ATDA 3C8KD 2FLBL 4AQTA 1XFEA 4RRXA 3KQGA 3WH3A 4OTYA 1IQKL 3BDWB 2WFXB 1SL6A 4MTHA 2BQWA 2W2ME 2Y7ZB 2D1JB 3K7BA 1IVOC 1ATEA 1UV0A 4TGFA 2YGPA 1EZQB 1AUTL 2PUQL 4Z6AL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7B T;  4UXM A;  3C9A C;  1R13 A;  1UMR C;  1HT8 A;  4RRW A;  1C5M F;  1HQ8 A;  4AK8 A;  3T3A A;  3WSR A;  2XBW L;  2KB9 A;  3P7H A;  1G1T A;  2F9B L;  1C3A B;  1KCG A;  1IQF L;  1EAI C;  1KZA 1;  4C9F A;  1EMO A;  3BT1 A;  2FD6 A;  4D90 A;  1J34 B;  3CCK A;  3PAQ A;  3GPR A;  1E8I A;  2RHP A;  1V3X B;  2P3F L;  4ZRV A;  3VLG A;  4LOR A;  4BDW A;  3BX4 A;  2Y7X B;  3M36 L;  2ADX A;  4ZH8 B;  2Y38 A;  4G96 A;  2VVV L;  3BDW A;  1BCH 1;  4Y6D B;  3LC3 B;  1WHE A;  2MHP A;  1T8C A;  2Y81 B;  2BMG A;  4Y7B B;  1FJS L;  2WPI E;  3PAR A;  3IKQ A;  2EI7 B;  1RDN 1;  1JWI B;  1XAR A;  3SOV A;  1EMN A;  1B9W A;  1PWB A;  4KZW A;  1U0N B;  2K2S B;  3GPR D;  2RIC A;  1HAF A;  1KWZ A;  2W2Q E;  3UBU B;  3FD4 A;  4M17 A;  2EI6 B;  3WWK A;  4LMF A;  5E8D A;  5JVY A;  3G81 A;  4MMX B;  3TH3 L;  1IQG L;  3TK5 B;  3IIT B;  1CWV A;  3VPP A;  3U7U G;  4BXS A;  2H2T B;  1J34 A;  4CSY A;  1KZB 1;  2H2R A;  3HS7 A;  1RTM 1;  2VWO L;  3TK6 B;  1HUP A;  2LS8 A;  3KK6 A;  1WU1 B;  4M18 A;  1KLI L;  4J6M A;  4BTU A;  1BJ3 B;  1IJK B;  3G84 A;  1RDL 1;  1W8B L;  4GJX A;  4Y71 B;  4CUE A;  4M1G A;  3NT1 A;  1HRE A;  4N38 A;  2MGP A;  5K0H B;  1B6E A;  5J6G G;  5K8Y A;  2M74 A;  1NFY B;  3GCW E;  4X8T L;  3HUP A;  2P26 A;  2XC4 L;  3ALT A;  3CS7 L;  1KOE A;  4CAJ A;  3Q3K B;  1JWI A;  5B1R A;  1Z6C A;  3CEN L;  5CKQ A;  1UKM B;  2EI8 B;  1KZE 1;  1IGX A;  1J35 B;  1KZD 1;  1IQM L;  1ADX A;  1UEX A;  3PGH A;  3UBU A;  2XC5 L;  1BV4 A;  3FF7 C;  5JBB E;  3HO3 A;  1N7D A;  4LQF A;  5KTI A;  3ZHG A;  2BQ7 A;  3MDL A;  1PFX L;  1BUU A;  4N32 A;  5KTH A;  4PH9 A;  3N8W B;  4LU5 A;  3WH2 A;  5JBA E;  5COX A;  3U73 A;  3ENS A;  1FSB A;  2I83 A;  1NFX B;  1TDQ B;  1APO A;  1FFM A;  1KWT A;  2UWP B;  3P5B L;  4CUF A;  1ATA A;  1SZB A;  1KWW A;  2P3U A;  1X7A L;  1BJ3 A;  4M11 A;  2WPL E;  2BPE A;  4YZU B;  2Y80 B;  2G00 L;  3WBR A;  1KIG L;  3FBY A;  2XR6 A;  1L3Y A;  2RA0 L;  4A7I A;  1DQB A;  1UOS A;  4ZXX L;  3EGF A;  2CL8 A;  3L9J C;  3ZHG D;  1GZ2 A;  4O1Z A;  1QFK L;  1F02 I;  1MOX C;  4JYV L;  2MTI A;  3K9X A;  2XBY L;  5JBC E;  1FF7 A;  1KWX A;  1KWU A;  1LQD A;  5FFR A;  3C8J A;  1X2T A;  2RIB A;  1PGE A;  1EPH A;  4X8S L;  1W7X L;  5IKT A;  3WWK C;  1HT5 A;  1OZ7 B;  2VWN L;  2VWM K;  1MQ6 L;  4YMD A;  4PP8 A;  1O5D L;  1F0S B;  3CDG E;  2VUV A;  1YUK B;  1AFA 1;  3N8W A;  1IQI L;  2P95 L;  2Q1J B;  2RID A;  1UZK A;  2AFP A;  3CA7 A;  1U67 A;  4WUX A;  1UZP A;  1OB1 C;  4D0F A;  2W3K B;  1J9C L;  1XKB A;  2IT5 A;  4GI0 A;  1KZC 1;  4RRY A;  3QMO A;  2VRP B;  1IOD A;  3ASI A;  2KMB 1;  1P0S L;  4XL1 A;  3PBF A;  4GK1 A;  1KX1 A;  4E1G A;  1G2L B;  3KQB L;  1RDK 1;  2CJI B;  2ZIB A;  3M37 L;  4ZXY L;  1SL5 A;  4WR9 A;  5LGK E;  2MGR A;  4X8V L;  1YXJ A;  3IKP A;  3GCX E;  3NCX A;  3HO4 A;  1WK1 A;  3OLT A;  1EPJ A;  5F19 A;  1RFN B;  1WMZ A;  1EBV A;  4ZAE B;  2M94 A;  2W86 A;  2PY2 A;  4X8U L;  3P7G A;  2VVC K;  1KLJ L;  1KG0 C;  1G1Q A;  1RDO 1;  1U0N C;  4JZF L;  1Y17 B;  2OX8 A;  1RDM 1;  3ZYJ B;  1KWV A;  1CEJ A;  2RIA A;  1KLO A;  1QDD A;  2GD4 A;  1COU A;  3HS5 A;  2P16 L;  1C3A A;  4J6L A;  3SOB B;  4D0E A;  1KSN B;  1SB2 B;  1SL4 A;  2ZWK A;  4G9A A;  2W2P E;  4QKJ A;  4Y76 B;  2XBX L;  2WG4 B;  2VVU L;  1ATB A;  2J2U B;  4BDX A;  3ALS A;  5I46 L;  3G8K A;  3IKN A;  2BZ6 L;  3NJP C;  1IOE L;  2KL7 A;  3P5I A;  4KI1 E;  4Z0K B;  1YUG A;  4GJ0 A;  2I9B A;  1URK A;  3DBZ A;  2WPK E;  3TBD A;  4Z0L A;  2E3X B;  4NG9 L;  4GKO G;  2DDU A;  3KQE L;  2ORJ A;  2XR5 A;  4FM5 A;  3RS1 A;  3LN1 A;  4O02 B;  1P9J A;  1LMJ A;  2BQ6 A;  1F7E A;  3P5D A;  2Y82 B;  5JW1 A;  4WQQ A;  1FE2 A;  3V65 B;  3P5F A;  1YTT A;  3PAK A;  1BYF A;  1WT9 B;  1JA3 A;  4WRF A;  2RIE A;  3ALU A;  3V64 C;  2PR3 B;  1HCG B;  4WRE A;  3NTB A;  2VH6 B;  5IKQ A;  2VWL L;  2OX9 A;  1IQH L;  4RRZ A;  2PF5 A;  2WPM E;  3LC5 B;  1O7C T;  1U0O B;  2IT6 A;  1BF9 A;  1HRF A;  3LN0 A;  1FAX L;  1HX2 A;  1HTN A;  4J6N A;  4N33 A;  3VYK A;  2P94 L;  3IKR A;  1SB2 A;  3OLU A;  1LIT A;  1H8U A;  2UWO B;  4J6P A;  5FFT A;  1IQE L;  2J34 B;  3CAD A;  3GPR C;  1YO8 A;  4IOP B;  4NGA L;  4ZES A;  3NTG A;  1G1S A;  3KMB 1;  4CUD A;  2BOX A;  1G2M B;  2Y5H L;  2NPR A;  1YPQ A;  4J6K A;  3ZYI B;  4S0U A;  2Y5G L;  3WHD A;  3P5E A;  1B08 A;  4QKH A;  1E5U I;  1F7M A;  1JL9 A;  3ZYG A;  1LPZ A;  2N40 A;  4JYU L;  4N34 A;  2VJ3 A;  4QKG A;  2KV4 A;  3KQD L;  5F1A A;  4C16 A;  2FLG A;  1P4L D;  1EQH A;  1IOX A;  3ELA L;  1FIH A;  1IQL L;  1DY1 A;  1NFU B;  4MMZ B;  3WBP A;  2W2O E;  2J95 B;  1X2W B;  1WHF A;  2VUZ A;  1UKM A;  5L2Y L;  1UZJ A;  5CKN A;  1MQ5 L;  1PTH A;  1J35 A;  4DN8 A;  2WYJ B;  1L5G B;  2P3T A;  3GIS X;  1KMB 1;  5IKR A;  1U0O A;  2YGO A;  2W26 B;  1I0U A;  4M10 A;  3FFG L;  2C6U A;  4COX A;  1NFW B;  1XDT R;  1YUF A;  2BOU A;  2K2T A;  1DX5 I;  1BNL A;  2WPH E;  1PRH A;  4WRC A;  2BPD A;  2P93 L;  2BOK L;  2J4I B;  4IOP A;  1PXX A;  3P5H A;  4MMY B;  2GGX A;  3F6U L;  4XLW A;  3HO5 A;  4ZRW A;  1YPO A;  1DIY A;  1NZI A;  6COX A;  1G1R A;  1UZQ A;  1NQL B;  2FLR L;  2FZZ L;  1RJH A;  1N1I A;  2OS9 A;  4J6Q A;  3TGF A;  1DDX A;  2H9E L;  5JVZ A;  1XPH A;  4G1M B;  4UWW A;  2YHF A;  3TZI A;  4JZE L;  3WWK B;  3QH0 A;  3MQE A;  3IJE B;  3FCS B;  3KL6 B;  1F00 I;  4N36 A;  1TOZ A;  3DEM A;  4OTJ A;  5L2Z L;  2UWL B;  2OYE P;  2J38 B;  2VH0 B;  4BTT A;  3G8L A;  4N37 A;  4N35 A;  3N8X A;  3SW2 A;  1X2W A;  4BTI A;  2BO2 A;  1F0R B;  2I9A A;  3C22 A;  3HPT A;  5B1X A;  5CKM A;  1V7P B;  1QO3 C;  4EZM G;  3BPS E;  1AFB 1;  1BCJ 1;  4RUT A;  1IGZ A;  1JZN A;  1IP0 A;  1MSB A;  1IXX B;  1K37 A;  1K36 A;  1ESL A;  1YXK A;  4YLI A;  3R05 A;  1OZ7 A;  1JV2 B;  3POY A;  5JB9 E;  1A3P A;  1KWY A;  3N8Y B;  2WPJ E;  4XBM A;  5JB8 E;  1Q4G A;  3F1S B;  2W2N E;  1T8D A;  1V4L B;  1IJQ A;  4ZET A;  2BRS A;  3SOQ A;  2MSB A;  1CVW L;  3G83 A;  1YGC L;  1P1Z D;  2WFT A;  3H5C B;  2P28 B;  4WUW A;  2XC0 L;  1EQG A;  4Y79 B;  1HJ7 A;  3CDG F;  2VRP A;  2RNL A;  4BXW A;  1DVA L;  1UEX B;  1NT0 A;  4RS0 A;  1IJK C;  1UMR A;  2E3X C;  3QCW A;  1GK5 A;  1RDJ 1;  2PHB B;  3FF9 A;  5FFS A;  1M1X B;  1HAE A;  2AYL A;  1E87 A;  1HYR A;  5KIR A;  2WG3 C;  3BT2 A;  1FAK L;  2GGU A;  1CCF A;  4E52 A;  4NA9 L;  2TGF A;  1PW9 A;  3M9Z A;  2B7D L;  5F2Q A;  2KV3 A;  2W3I B;  2ORK A;  3FF8 C;  5B1W A;  1CX2 A;  4YT6 L;  3N8V A;  3KRK A;  1YPU A;  4KZV A;  1Y17 A;  1FVU B;  1V7P A;  1MUQ A;  1FIF A;  1EGF A;  5L30 L;  2XBV L;  4ISI L;  3LTG D;  5CIS A;  1IXX A;  1MPU A;  3P5G A;  5KN5 C;  2J94 B;  2WYG B;  1RDI 1;  1TLG A;  3LIW B;  4KMB 1;  1JBU L;  1EPG A;  4J6J A;  3VYJ A;  1DV8 A;  4Y7A B;  1CVU A;  1EGG A;  3N8Y A;  1UOS B;  3RR3 A;  1NPE B;  1APQ A;  1TPG A;  1Z6E L;  2Y5F L;  4WCO A;  1V4L A;  1LPG A;  4PDC A;  1IQJ L;  3Q7D A;  1U8C B;  3LAQ A;  1AFD 1;  1DY2 A;  1EGI A;  2OYU P;  1R14 A;  1X2T B;  1XKA L;  1K9J A;  3KCG L;  2BOH A;  5IKV A;  3NCW A;  1ZAQ A;  3KQC L;  3N8Z A;  1WMY A;  1CQE A;  3P7F A;  2GO0 A;  1CCV A;  1IQN L;  1TN3 A;  4QKI A;  5EGM B;  2BPH A;  1FM5 A;  2ZQK A;  3CFW A;  1HZ8 A;  5M62 A;  4ISH L;  3GPR B;  1K9I A;  1TLE A;  1WT9 A;  2JKH L;  2P3F N;  4YT7 L;  1LPK A;  5FDQ A;  3WBQ A;  3HS6 A;  3LTF B;  1FVU A;  3BX4 B;  1DY0 A;  1IOD B;  4JZD L;  4ZHA B;  1EPI A;  1KX0 A;  1ATD A;  3C8K D;  2FLB L;  4AQT A;  1XFE A;  4RRX A;  3KQG A;  3WH3 A;  4OTY A;  1IQK L;  3BDW B;  2WFX B;  1SL6 A;  4MTH A;  2BQW A;  2W2M E;  2Y7Z B;  2D1J B;  3K7B A;  1IVO C;  1ATE A;  1UV0 A;  4TGF A;  2YGP A;  1EZQ B;  1AUT L;  2PUQ L;  4Z6A L; 
#chains in the Genus database with same CATH topology
 1O7B T;  4UXM A;  3C9A C;  1R13 A;  1UMR C;  3S6X A;  1HT8 A;  4RRW A;  1C5M F;  1HQ8 A;  4AK8 A;  3T3A A;  3WSR A;  2XBW L;  2KB9 A;  3P7H A;  1G1T A;  2F9B L;  1C3A B;  1KCG A;  1IQF L;  2VRS A;  1EAI C;  2JJL A;  1KZA 1;  4C9F A;  1EMO A;  3BT1 A;  2FD6 A;  4D90 A;  1J34 B;  3CCK A;  3PAQ A;  3GPR A;  1E8I A;  2RHP A;  1V3X B;  2P3F L;  4ZRV A;  3VLG A;  4LOR A;  4BDW A;  3BX4 A;  2Y7X B;  3M36 L;  2ADX A;  4ZH8 B;  2Y38 A;  4G96 A;  2VVV L;  3BDW A;  1BCH 1;  4Y6D B;  3LC3 B;  1WHE A;  2MHP A;  1T8C A;  2Y81 B;  2BMG A;  4Y7B B;  1FJS L;  2WPI E;  2KNI A;  3PAR A;  3IKQ A;  2EI7 B;  1RDN 1;  1JWI B;  1XAR A;  3SOV A;  1EMN A;  1B9W A;  1PWB A;  4KZW A;  1U0N B;  2K2S B;  3GPR D;  2RIC A;  1HAF A;  1KWZ A;  2W2Q E;  3UBU B;  3FD4 A;  4M17 A;  2EI6 B;  3WWK A;  1V1I A;  4LMF A;  5E8D A;  5JVY A;  3G81 A;  4MMX B;  3TH3 L;  1IQG L;  3TK5 B;  3IIT B;  1CWV A;  3VPP A;  3U7U G;  4BXS A;  2H2T B;  1J34 A;  4CSY A;  1KZB 1;  2H2R A;  3HS7 A;  1RTM 1;  2VWO L;  3TK6 B;  1HUP A;  2LS8 A;  4GU4 A;  3KK6 A;  1WU1 B;  4M18 A;  1KKE A;  1KLI L;  4J6M A;  4BTU A;  1BJ3 B;  1IJK B;  3G84 A;  1RDL 1;  1W8B L;  4GJX A;  4Y71 B;  4CUE A;  4M1G A;  3NT1 A;  1HRE A;  4N38 A;  2MGP A;  5K0H B;  1B6E A;  5J6G G;  5K8Y A;  2M74 A;  1NFY B;  3GCW E;  4X8T L;  3HUP A;  2P26 A;  2XC4 L;  3ALT A;  3CS7 L;  1KOE A;  4CAJ A;  3Q3K B;  1JWI A;  5B1R A;  1Z6C A;  3CEN L;  5CKQ A;  1UKM B;  2EI8 B;  1KZE 1;  1IGX A;  1J35 B;  1KZD 1;  1IQM L;  1ADX A;  1UEX A;  3PGH A;  3UBU A;  2XC5 L;  1BV4 A;  3FF7 C;  5JBB E;  3HO3 A;  1N7D A;  4LQF A;  5KTI A;  3ZHG A;  2BQ7 A;  3MDL A;  1PFX L;  1BUU A;  4N32 A;  5KTH A;  2BT7 A;  4PH9 A;  3N8W B;  4LU5 A;  3WH2 A;  5JBA E;  2YGQ A;  5COX A;  3U73 A;  3ENS A;  2WZP P;  1FSB A;  2I83 A;  1NFX B;  1TDQ B;  1APO A;  1FFM A;  1KWT A;  2UWP B;  3P5B L;  4CUF A;  1ATA A;  1SZB A;  1KWW A;  2P3U A;  1X7A L;  1BJ3 A;  4M11 A;  2WPL E;  2BPE A;  4YZU B;  2Y80 B;  2G00 L;  3WBR A;  1KIG L;  3FBY A;  2XR6 A;  1L3Y A;  2RA0 L;  4A7I A;  1DQB A;  1UOS A;  4ZXX L;  3EGF A;  2CL8 A;  3L9J C;  3ZHG D;  1GZ2 A;  4O1Z A;  1QFK L;  1F02 I;  1MOX C;  4JYV L;  2MTI A;  3K9X A;  2XBY L;  5JBC E;  1FF7 A;  1KWX A;  1KWU A;  1LQD A;  5FFR A;  3C8J A;  1X2T A;  2RIB A;  1PGE A;  1EPH A;  4X8S L;  1W7X L;  5IKT A;  3WWK C;  1HT5 A;  1OZ7 B;  2VWN L;  2VWM K;  1MQ6 L;  4YMD A;  4PP8 A;  1O5D L;  1F0S B;  3CDG E;  2VUV A;  1YUK B;  1AFA 1;  3N8W A;  1IQI L;  2P95 L;  2Q1J B;  2RID A;  1UZK A;  2AFP A;  3CA7 A;  1U67 A;  4WUX A;  1UZP A;  1OB1 C;  4D0F A;  2W3K B;  1J9C L;  1XKB A;  2IT5 A;  4GI0 A;  1KZC 1;  4RRY A;  3QMO A;  2VRP B;  1IOD A;  3ASI A;  2KMB 1;  1P0S L;  4XL1 A;  3PBF A;  4GK1 A;  1KX1 A;  4E1G A;  1G2L B;  3KQB L;  1RDK 1;  2CJI B;  2ZIB A;  3M37 L;  4ZXY L;  1SL5 A;  4WR9 A;  5LGK E;  2MGR A;  4X8V L;  1YXJ A;  3IKP A;  3GCX E;  2BT8 A;  3NCX A;  3HO4 A;  1WK1 A;  3OLT A;  1EPJ A;  5F19 A;  1RFN B;  2H9E C;  1EBV A;  4ZAE B;  1WMZ A;  2W86 A;  2M94 A;  4X8U L;  2PY2 A;  3P7G A;  2VVC K;  1KLJ L;  1KG0 C;  1G1Q A;  1RDO 1;  1U0N C;  4JZF L;  1Y17 B;  2OX8 A;  1RDM 1;  3ZYJ B;  1KWV A;  1CEJ A;  2RIA A;  1KLO A;  1QDD A;  2GD4 A;  1COU A;  3HS5 A;  2P16 L;  1C3A A;  4J6L A;  3SOB B;  4D0E A;  1KSN B;  1SB2 B;  1SL4 A;  2ZWK A;  4G9A A;  2W2P E;  4QKJ A;  4Y76 B;  2XBX L;  2WG4 B;  2VVU L;  1ATB A;  2J2U B;  4BDX A;  3ALS A;  1V1H A;  5I46 L;  3G8K A;  3IKN A;  2BZ6 L;  3NJP C;  1IOE L;  2KL7 A;  4A94 C;  3P5I A;  4KI1 E;  4Z0K B;  1YUG A;  4GJ0 A;  2I9B A;  1URK A;  3DBZ A;  2WPK E;  3TBD A;  4Z0L A;  2E3X B;  4NG9 L;  4GKO G;  2DDU A;  3KQE L;  2ORJ A;  2XR5 A;  4FM5 A;  3RS1 A;  3LN1 A;  1QIU A;  4O02 B;  1P9J A;  1LMJ A;  2BQ6 A;  1F7E A;  3P5D A;  2Y82 B;  5JW1 A;  4WQQ A;  1FE2 A;  3V65 B;  3P5F A;  1YTT A;  3PAK A;  1BYF A;  1WT9 B;  1JA3 A;  4WRF A;  2RIE A;  3ALU A;  3V64 C;  2PR3 B;  1HCG B;  4WRE A;  3NTB A;  2VH6 B;  5IKQ A;  2VWL L;  2OX9 A;  1IQH L;  4RRZ A;  2PF5 A;  2WPM E;  3LC5 B;  1O7C T;  1U0O B;  2IT6 A;  1BF9 A;  1HRF A;  3LN0 A;  1FAX L;  1HX2 A;  1HTN A;  4J6N A;  4N33 A;  3VYK A;  2P94 L;  3IKR A;  1SB2 A;  3OLU A;  1LIT A;  1H8U A;  2UWO B;  4J6P A;  5FFT A;  1IQE L;  2J34 B;  3CAD A;  3GPR C;  1YO8 A;  4IOP B;  4NGA L;  4ZES A;  3NTG A;  1G1S A;  2HOX A;  3KMB 1;  4CUD A;  2BOX A;  1G2M B;  2Y5H L;  2NPR A;  1YPQ A;  4J6K A;  3ZYI B;  4S0U A;  2Y5G L;  3WHD A;  3P5E A;  1B08 A;  4QKH A;  1E5U I;  1LMM A;  1F7M A;  1JL9 A;  3ZYG A;  1LPZ A;  2N40 A;  4JYU L;  4N34 A;  2VJ3 A;  4QKG A;  2KV4 A;  3KQD L;  5F1A A;  4C16 A;  2FLG A;  1P4L D;  1EQH A;  1IOX A;  3ELA L;  1FIH A;  1IQL L;  1DY1 A;  1NFU B;  4MMZ B;  3WBP A;  2W2O E;  2J95 B;  1X2W B;  1WHF A;  2VUZ A;  1UKM A;  5L2Y L;  1UZJ A;  5CKN A;  1MQ5 L;  1PTH A;  1J35 A;  4DN8 A;  4GU3 A;  2WYJ B;  1L5G B;  2P3T A;  3GIS X;  1KMB 1;  5IKR A;  1U0O A;  2YGO A;  2W26 B;  1I0U A;  4M10 A;  3FFG L;  2C6U A;  4COX A;  1NFW B;  1XDT R;  1YUF A;  2BOU A;  2K2T A;  1DX5 I;  1BNL A;  2WPH E;  1PRH A;  4WRC A;  2BPD A;  2P93 L;  2BOK L;  2J4I B;  4IOP A;  1PXX A;  3P5H A;  4MMY B;  2GGX A;  3F6U L;  4XLW A;  3HO5 A;  4ZRW A;  1YPO A;  1DIY A;  1NZI A;  6COX A;  1G1R A;  1UZQ A;  1NQL B;  2FLR L;  2FZZ L;  1RJH A;  1N1I A;  2OS9 A;  4J6Q A;  3TGF A;  1DDX A;  2H9E L;  5JVZ A;  1XPH A;  4G1M B;  4UWW A;  2YHF A;  3TZI A;  4JZE L;  3WWK B;  3QH0 A;  3MQE A;  3IJE B;  3FCS B;  3KL6 B;  1F00 I;  4N36 A;  1TOZ A;  3DEM A;  4OTJ A;  5L2Z L;  2UWL B;  2OYE P;  2J38 B;  2VH0 B;  4BTT A;  3G8L A;  4N37 A;  4N35 A;  3N8X A;  3SW2 A;  1X2W A;  4BTI A;  2BO2 A;  1F0R B;  2I9A A;  3C22 A;  3HPT A;  5B1X A;  5CKM A;  1V7P B;  1QO3 C;  2HOR A;  4EZM G;  3BPS E;  1AFB 1;  1BCJ 1;  4RUT A;  1IGZ A;  1JZN A;  1IP0 A;  1MSB A;  1IXX B;  1K37 A;  1K36 A;  1ESL A;  1YXK A;  4YLI A;  3R05 A;  1OZ7 A;  1JV2 B;  3POY A;  5JB9 E;  1A3P A;  1KWY A;  3N8Y B;  2WPJ E;  4XBM A;  5JB8 E;  1Q4G A;  3F1S B;  2W2N E;  1T8D A;  1V4L B;  1IJQ A;  4ZET A;  2BRS A;  3SOQ A;  2MSB A;  1CVW L;  3G83 A;  1YGC L;  1P1Z D;  2WFT A;  3H5C B;  2BSF A;  2P28 B;  2XC0 L;  4WUW A;  1EQG A;  4Y79 B;  1HJ7 A;  3CDG F;  2VRP A;  2RNL A;  4BXW A;  1DVA L;  1UEX B;  1NT0 A;  4RS0 A;  1IJK C;  1UMR A;  2E3X C;  3QCW A;  1GK5 A;  1RDJ 1;  2PHB B;  3FF9 A;  5FFS A;  1M1X B;  1HAE A;  2AYL A;  1E87 A;  1HYR A;  5KIR A;  2WG3 C;  3BT2 A;  1FAK L;  2GGU A;  1CCF A;  4E52 A;  4NA9 L;  2TGF A;  1PW9 A;  3M9Z A;  2B7D L;  5F2Q A;  2KV3 A;  2W3I B;  2ORK A;  3FF8 C;  5B1W A;  1CX2 A;  4YT6 L;  3N8V A;  3KRK A;  1YPU A;  4KZV A;  1Y17 A;  1FVU B;  1V7P A;  1MUQ A;  1FIF A;  1EGF A;  5L30 L;  2XBV L;  4ISI L;  3LTG D;  5CIS A;  1IXX A;  1MPU A;  3P5G A;  5KN5 C;  2J94 B;  2WYG B;  1RDI 1;  1TLG A;  3LIW B;  4KMB 1;  1JBU L;  1EPG A;  4J6J A;  3VYJ A;  1DV8 A;  4Y7A B;  1CVU A;  1EGG A;  3N8Y A;  1UOS B;  3RR3 A;  1NPE B;  1APQ A;  1TPG A;  1Z6E L;  2Y5F L;  4WCO A;  1V4L A;  1LPG A;  4PDC A;  1IQJ L;  3Q7D A;  1U8C B;  3LAQ A;  1AFD 1;  1DY2 A;  1EGI A;  2OYU P;  1R14 A;  1X2T B;  1XKA L;  1K9J A;  3KCG L;  2BOH A;  5IKV A;  3NCW A;  1ZAQ A;  3KQC L;  3N8Z A;  1WMY A;  1CQE A;  3P7F A;  2GO0 A;  1CCV A;  1IQN L;  1TN3 A;  4QKI A;  5EGM B;  2BPH A;  1FM5 A;  2ZQK A;  3CFW A;  1HZ8 A;  5M62 A;  4ISH L;  1LK9 A;  3GPR B;  1K9I A;  1TLE A;  1WT9 A;  2JKH L;  2P3F N;  4YT7 L;  1LPK A;  5FDQ A;  3WBQ A;  3HS6 A;  3LTF B;  1FVU A;  3BX4 B;  1DY0 A;  1IOD B;  4JZD L;  4ZHA B;  1EPI A;  1KX0 A;  1ATD A;  3C8K D;  2FLB L;  4AQT A;  1XFE A;  4RRX A;  3KQG A;  3WH3 A;  4OTY A;  1IQK L;  3BDW B;  2WFX B;  1SL6 A;  4MTH A;  2BQW A;  2W2M E;  2Y7Z B;  2D1J B;  3K7B A;  1IVO C;  1ATE A;  1UV0 A;  4TGF A;  2YGP A;  1EZQ B;  1AUT L;  2PUQ L;  4Z6A L; 
#chains in the Genus database with same CATH homology
 1O7B T;  4UXM A;  3C9A C;  1R13 A;  1UMR C;  3S6X A;  1HT8 A;  4RRW A;  1C5M F;  1HQ8 A;  4AK8 A;  3T3A A;  3WSR A;  2XBW L;  2KB9 A;  3P7H A;  1G1T A;  2F9B L;  1C3A B;  1KCG A;  1IQF L;  1EAI C;  1KZA 1;  4C9F A;  1EMO A;  3BT1 A;  2FD6 A;  4D90 A;  1J34 B;  3CCK A;  3PAQ A;  3GPR A;  1E8I A;  2RHP A;  1V3X B;  2P3F L;  4ZRV A;  3VLG A;  4LOR A;  4BDW A;  3BX4 A;  2Y7X B;  3M36 L;  2ADX A;  4ZH8 B;  2Y38 A;  4G96 A;  2VVV L;  3BDW A;  1BCH 1;  4Y6D B;  3LC3 B;  1WHE A;  2MHP A;  1T8C A;  2Y81 B;  2BMG A;  4Y7B B;  1FJS L;  2WPI E;  2KNI A;  3PAR A;  3IKQ A;  2EI7 B;  1RDN 1;  1JWI B;  1XAR A;  3SOV A;  1EMN A;  1B9W A;  1PWB A;  4KZW A;  1U0N B;  2K2S B;  3GPR D;  2RIC A;  1HAF A;  1KWZ A;  2W2Q E;  3UBU B;  3FD4 A;  4M17 A;  2EI6 B;  3WWK A;  4LMF A;  5E8D A;  5JVY A;  3G81 A;  4MMX B;  3TH3 L;  1IQG L;  3TK5 B;  3IIT B;  1CWV A;  3VPP A;  3U7U G;  4BXS A;  2H2T B;  1J34 A;  4CSY A;  1KZB 1;  2H2R A;  3HS7 A;  1RTM 1;  2VWO L;  3TK6 B;  1HUP A;  2LS8 A;  3KK6 A;  1WU1 B;  4M18 A;  1KLI L;  4J6M A;  4BTU A;  1BJ3 B;  1IJK B;  3G84 A;  1RDL 1;  1W8B L;  4GJX A;  4Y71 B;  4CUE A;  4M1G A;  3NT1 A;  1HRE A;  4N38 A;  2MGP A;  5K0H B;  1B6E A;  5J6G G;  5K8Y A;  2M74 A;  1NFY B;  3GCW E;  4X8T L;  3HUP A;  2P26 A;  2XC4 L;  3ALT A;  3CS7 L;  1KOE A;  4CAJ A;  3Q3K B;  1JWI A;  5B1R A;  1Z6C A;  3CEN L;  5CKQ A;  1UKM B;  2EI8 B;  1KZE 1;  1IGX A;  1J35 B;  1KZD 1;  1IQM L;  1ADX A;  1UEX A;  3PGH A;  3UBU A;  2XC5 L;  1BV4 A;  3FF7 C;  5JBB E;  3HO3 A;  1N7D A;  4LQF A;  5KTI A;  3ZHG A;  2BQ7 A;  3MDL A;  1PFX L;  1BUU A;  4N32 A;  5KTH A;  4PH9 A;  3N8W B;  4LU5 A;  3WH2 A;  5JBA E;  2YGQ A;  5COX A;  3U73 A;  3ENS A;  2WZP P;  1FSB A;  2I83 A;  1NFX B;  1TDQ B;  1APO A;  1FFM A;  1KWT A;  2UWP B;  3P5B L;  4CUF A;  1ATA A;  1SZB A;  1KWW A;  2P3U A;  1X7A L;  1BJ3 A;  4M11 A;  2WPL E;  2BPE A;  4YZU B;  2Y80 B;  2G00 L;  3WBR A;  1KIG L;  3FBY A;  2XR6 A;  1L3Y A;  2RA0 L;  4A7I A;  1DQB A;  1UOS A;  4ZXX L;  3EGF A;  2CL8 A;  3L9J C;  3ZHG D;  1GZ2 A;  4O1Z A;  1QFK L;  1F02 I;  1MOX C;  4JYV L;  2MTI A;  3K9X A;  2XBY L;  5JBC E;  1FF7 A;  1KWX A;  1KWU A;  1LQD A;  5FFR A;  3C8J A;  1X2T A;  2RIB A;  1PGE A;  1EPH A;  4X8S L;  1W7X L;  5IKT A;  3WWK C;  1HT5 A;  1OZ7 B;  2VWN L;  2VWM K;  1MQ6 L;  4YMD A;  4PP8 A;  1O5D L;  1F0S B;  3CDG E;  2VUV A;  1YUK B;  1AFA 1;  3N8W A;  1IQI L;  2P95 L;  2Q1J B;  2RID A;  1UZK A;  2AFP A;  3CA7 A;  1U67 A;  4WUX A;  1UZP A;  1OB1 C;  4D0F A;  2W3K B;  1J9C L;  1XKB A;  2IT5 A;  4GI0 A;  1KZC 1;  4RRY A;  3QMO A;  2VRP B;  1IOD A;  3ASI A;  2KMB 1;  1P0S L;  4XL1 A;  3PBF A;  4GK1 A;  1KX1 A;  4E1G A;  1G2L B;  3KQB L;  1RDK 1;  2CJI B;  2ZIB A;  3M37 L;  4ZXY L;  1SL5 A;  4WR9 A;  5LGK E;  2MGR A;  4X8V L;  1YXJ A;  3IKP A;  3GCX E;  3NCX A;  3HO4 A;  1WK1 A;  3OLT A;  1EPJ A;  5F19 A;  1RFN B;  2H9E C;  1EBV A;  4ZAE B;  1WMZ A;  2W86 A;  2M94 A;  4X8U L;  2PY2 A;  3P7G A;  2VVC K;  1KLJ L;  1KG0 C;  1G1Q A;  1RDO 1;  1U0N C;  4JZF L;  1Y17 B;  2OX8 A;  1RDM 1;  3ZYJ B;  1KWV A;  1CEJ A;  2RIA A;  1KLO A;  1QDD A;  2GD4 A;  1COU A;  3HS5 A;  2P16 L;  1C3A A;  4J6L A;  3SOB B;  4D0E A;  1KSN B;  1SB2 B;  1SL4 A;  2ZWK A;  4G9A A;  2W2P E;  4QKJ A;  4Y76 B;  2XBX L;  2WG4 B;  2VVU L;  1ATB A;  2J2U B;  4BDX A;  3ALS A;  5I46 L;  3G8K A;  3IKN A;  2BZ6 L;  3NJP C;  1IOE L;  2KL7 A;  4A94 C;  3P5I A;  4KI1 E;  4Z0K B;  1YUG A;  4GJ0 A;  2I9B A;  1URK A;  3DBZ A;  2WPK E;  3TBD A;  4Z0L A;  2E3X B;  4NG9 L;  4GKO G;  2DDU A;  3KQE L;  2ORJ A;  2XR5 A;  4FM5 A;  3RS1 A;  3LN1 A;  4O02 B;  1P9J A;  1LMJ A;  2BQ6 A;  1F7E A;  3P5D A;  2Y82 B;  5JW1 A;  4WQQ A;  1FE2 A;  3V65 B;  3P5F A;  1YTT A;  3PAK A;  1BYF A;  1WT9 B;  1JA3 A;  4WRF A;  2RIE A;  3ALU A;  3V64 C;  2PR3 B;  1HCG B;  4WRE A;  3NTB A;  2VH6 B;  5IKQ A;  2VWL L;  2OX9 A;  1IQH L;  4RRZ A;  2PF5 A;  2WPM E;  3LC5 B;  1O7C T;  1U0O B;  2IT6 A;  1BF9 A;  1HRF A;  3LN0 A;  1FAX L;  1HX2 A;  1HTN A;  4J6N A;  4N33 A;  3VYK A;  2P94 L;  3IKR A;  1SB2 A;  3OLU A;  1LIT A;  1H8U A;  2UWO B;  4J6P A;  5FFT A;  1IQE L;  2J34 B;  3CAD A;  3GPR C;  1YO8 A;  4IOP B;  4NGA L;  4ZES A;  3NTG A;  1G1S A;  3KMB 1;  4CUD A;  2BOX A;  1G2M B;  2Y5H L;  2NPR A;  1YPQ A;  4J6K A;  3ZYI B;  4S0U A;  2Y5G L;  3WHD A;  3P5E A;  1B08 A;  4QKH A;  1E5U I;  1LMM A;  1F7M A;  1JL9 A;  3ZYG A;  1LPZ A;  2N40 A;  4JYU L;  4N34 A;  2VJ3 A;  4QKG A;  2KV4 A;  3KQD L;  5F1A A;  4C16 A;  2FLG A;  1P4L D;  1EQH A;  1IOX A;  3ELA L;  1FIH A;  1IQL L;  1DY1 A;  1NFU B;  4MMZ B;  3WBP A;  2W2O E;  2J95 B;  1X2W B;  1WHF A;  2VUZ A;  1UKM A;  5L2Y L;  1UZJ A;  5CKN A;  1MQ5 L;  1PTH A;  1J35 A;  4DN8 A;  2WYJ B;  1L5G B;  2P3T A;  3GIS X;  1KMB 1;  5IKR A;  1U0O A;  2YGO A;  2W26 B;  1I0U A;  4M10 A;  3FFG L;  2C6U A;  4COX A;  1NFW B;  1XDT R;  1YUF A;  2BOU A;  2K2T A;  1DX5 I;  1BNL A;  2WPH E;  1PRH A;  4WRC A;  2BPD A;  2P93 L;  2BOK L;  2J4I B;  4IOP A;  1PXX A;  3P5H A;  4MMY B;  2GGX A;  3F6U L;  4XLW A;  3HO5 A;  4ZRW A;  1YPO A;  1DIY A;  1NZI A;  6COX A;  1G1R A;  1UZQ A;  1NQL B;  2FLR L;  2FZZ L;  1RJH A;  1N1I A;  2OS9 A;  4J6Q A;  3TGF A;  1DDX A;  2H9E L;  5JVZ A;  1XPH A;  4G1M B;  4UWW A;  2YHF A;  3TZI A;  4JZE L;  3WWK B;  3QH0 A;  3MQE A;  3IJE B;  3FCS B;  3KL6 B;  1F00 I;  4N36 A;  1TOZ A;  3DEM A;  4OTJ A;  5L2Z L;  2UWL B;  2OYE P;  2J38 B;  2VH0 B;  4BTT A;  3G8L A;  4N37 A;  4N35 A;  3N8X A;  3SW2 A;  1X2W A;  4BTI A;  2BO2 A;  1F0R B;  2I9A A;  3C22 A;  3HPT A;  5B1X A;  5CKM A;  1V7P B;  1QO3 C;  4EZM G;  3BPS E;  1AFB 1;  1BCJ 1;  4RUT A;  1IGZ A;  1JZN A;  1IP0 A;  1MSB A;  1IXX B;  1K37 A;  1K36 A;  1ESL A;  1YXK A;  4YLI A;  3R05 A;  1OZ7 A;  1JV2 B;  3POY A;  5JB9 E;  1A3P A;  1KWY A;  3N8Y B;  2WPJ E;  4XBM A;  5JB8 E;  1Q4G A;  3F1S B;  2W2N E;  1T8D A;  1V4L B;  1IJQ A;  4ZET A;  2BRS A;  3SOQ A;  2MSB A;  1CVW L;  3G83 A;  1YGC L;  1P1Z D;  2WFT A;  3H5C B;  2P28 B;  4WUW A;  2XC0 L;  1EQG A;  4Y79 B;  1HJ7 A;  3CDG F;  2VRP A;  2RNL A;  4BXW A;  1DVA L;  1UEX B;  1NT0 A;  4RS0 A;  1IJK C;  1UMR A;  2E3X C;  3QCW A;  1GK5 A;  1RDJ 1;  2PHB B;  3FF9 A;  5FFS A;  1M1X B;  1HAE A;  2AYL A;  1E87 A;  1HYR A;  5KIR A;  2WG3 C;  3BT2 A;  1FAK L;  2GGU A;  1CCF A;  4E52 A;  4NA9 L;  2TGF A;  1PW9 A;  3M9Z A;  2B7D L;  5F2Q A;  2KV3 A;  2W3I B;  2ORK A;  3FF8 C;  5B1W A;  1CX2 A;  4YT6 L;  3N8V A;  3KRK A;  1YPU A;  4KZV A;  1Y17 A;  1FVU B;  1V7P A;  1MUQ A;  1FIF A;  1EGF A;  5L30 L;  2XBV L;  4ISI L;  3LTG D;  5CIS A;  1IXX A;  1MPU A;  3P5G A;  5KN5 C;  2J94 B;  2WYG B;  1RDI 1;  1TLG A;  3LIW B;  4KMB 1;  1JBU L;  1EPG A;  4J6J A;  3VYJ A;  1DV8 A;  4Y7A B;  1CVU A;  1EGG A;  3N8Y A;  1UOS B;  3RR3 A;  1NPE B;  1APQ A;  1TPG A;  1Z6E L;  2Y5F L;  4WCO A;  1V4L A;  1LPG A;  4PDC A;  1IQJ L;  3Q7D A;  1U8C B;  3LAQ A;  1AFD 1;  1DY2 A;  1EGI A;  2OYU P;  1R14 A;  1X2T B;  1XKA L;  1K9J A;  3KCG L;  2BOH A;  5IKV A;  3NCW A;  1ZAQ A;  3KQC L;  3N8Z A;  1WMY A;  1CQE A;  3P7F A;  2GO0 A;  1CCV A;  1IQN L;  1TN3 A;  4QKI A;  5EGM B;  2BPH A;  1FM5 A;  2ZQK A;  3CFW A;  1HZ8 A;  5M62 A;  4ISH L;  3GPR B;  1K9I A;  1TLE A;  1WT9 A;  2JKH L;  2P3F N;  4YT7 L;  1LPK A;  5FDQ A;  3WBQ A;  3HS6 A;  3LTF B;  1FVU A;  3BX4 B;  1DY0 A;  1IOD B;  4JZD L;  4ZHA B;  1EPI A;  1KX0 A;  1ATD A;  3C8K D;  2FLB L;  4AQT A;  1XFE A;  4RRX A;  3KQG A;  3WH3 A;  4OTY A;  1IQK L;  3BDW B;  2WFX B;  1SL6 A;  4MTH A;  2BQW A;  2W2M E;  2Y7Z B;  2D1J B;  3K7B A;  1IVO C;  1ATE A;  1UV0 A;  4TGF A;  2YGP A;  1EZQ B;  1AUT L;  2PUQ L;  4Z6A L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...