3CFZA

Crystal structure of m. jannaschii periplasmic binding protein moda/wtpa with bound tungstate
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
289
structure length
289
Chain Sequence
KIVLKIFHAGSLSVPFEEYEKMFEKEHPNVDVEREPAGSVACVRKIIDLGKKADILASADYSLIPQMMMPKYADWYVMFARNEIVLAYTDKSKYKDEINSTNWYKILQRPDVKIGFSNPNDDPCGYRTQMVLQLAELYYKDPTIYDNLVLKHSNIKVEENNGTYLILVPKELDVDTNKLFVRSKETDLLAPLEAGAFDYLFIYKSVANQHHLKYIELPKEINLGYYEYADTYKKVALKIIAKNKTINAKPIVYGMTVPTNAPHKKEAIEFVKFVLGHPEVLENNGQPAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0100 protein MJ1186
publication title Distorted octahedral coordination of tungstate in a subfamily of specific binding proteins.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transport protein
total genus 97
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 2008-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3cfzA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3cfzA02
3JZJA 3HHFA 4YMAA 1POTA 4HCWA 2Q9TA 4PE5B 5FHMA 3QK6A 3FIRA 1LSTA 3FATA 2X7PA 5I57B 5CC2A 4KFQA 3USDA 4GXAA 3T9UA 5KDTB 4G8MA 4G68B 1MM7A 4ELQA 2BJJX 2W7YA 1I6QA 1OMPA 3OD7A 4XTCQ 4F22A 4YB7A 3IOUA 1B4ZA 3VVDA 5CI5A 1NNKA 3IB1A 3C34A 2UVGA 4FE8A 4ZEKA 1A99A 1US5A 4AB6A 1FQCA 5L8DA 1QUKA 2F5XA 1FQFA 3PMXA 1MPBA 4F1YA 1MH3A 4LVQA 2O84X 4IB2A 3VVEA 1F9BA 2F34A 3CG1A 3K6XA 2UYFA 1XHYA 5B70A 2XXQA 1R6ZA 1LBBA 3ILTB 1TFDA 4FJPA 1QUJA 4TLMB 2FYIA 3KG2A 4R9GA 4F1VA 3OEMA 2I0BA 2Y7WA 1MY0A 1MQGA 1H44A 4EXKA 5AA4B 1FTKA 2Y84A 4G8HA 3OSRA 3T9XB 4XXUA 2ONKE 3QUFA 4ZS9A 2HZLA 4TOZA 5H8NB 1B52A 1GV8A 2ANJA 1Y4CA 4BDRA 3GLBA 3TYHA 2F7BA 4JXIA 3THIA 4ZZEA 1B1HA 4JWYA 3AXFA 4F31B 4P0IA 4R6HA 4GRKA 1B1XA 4X1BA 3RGYA 4OERA 2HAUA 3KFMA 3C35A 3V89B 2QS2A 1NNFA 4F2QA 3DP8A 2YJPA 5HPQA 4FAJA 1B40A 1JQFA 2RC7A 1A55A 1B0HA 3K1MA 3EF7A 4HCYA 1PBPA 4F2OA 1FQEA 2Y7RA 5ICTA 1MM6A 3ZSFA 4ZDMA 3PPRA 3TQLA 5DVIA 3EHUA 5TP9B 2NXOA 1EZOA 1SW4A 4P11A 3IOTA 1UIUA 1M5EA 2QPQA 3FJMA 3MVWA 1LAXA 1UIVA 4C0RA 3SDFA 4R74A 3MJNA 4NF5A 1LLSA 1R1NA 4LATA 3KOTA 3C36A 1GTKA 2O6AA 3MW0A 3D4GA 5FHOA 3UGWA 3DELB 1FTOA 2GRVA 1N0TA 3I5OA 3RT8A 2M8CA 3FUZA 4R9FA 1BKAA 4NF8B 3K6VA 4Q8RA 3FV2A 4THIA 4UACA 2QMXA 2XXTA 1B46A 1JEVA 1B51A 4DZ1A 1P1NA 1B58A 2UYEA 3Q26A 5H8HB 3G3FA 1ZJLA 5I2NA 1PBQA 3G3HA 4KR5A 3PUZE 4WXJA 1DMBA 2ZXTA 3BKIB 4MF3A 3MP1A 1NNTA 3VXCA 4GQOA 1DTGA 3LSFB 1LAFE 4R72A 4KYSA 3V8XB 5CMMA 3PGFA 2P0SA 1ANFA 1N04A 4IO4A 3K2DA 4IO6A 4XIGQ 4WEPA 3TUSA 5I59A 1UTHB 5ISUA 3O97A 5TU0A 1SI0A 2Y7PA 3TKDA 2OLBA 5AE4A 3RUMA 1MDQA 1N76A 1VE4A 3OEKA 2B65A 1RKMA 5ICQA 3T9HB 4E0XA 3V83A 4RY1A 3VDFA 4FEBA 3HN0A 4FECA 4H8JA 3OELA 3FXRA 3PD8A 3HPIA 2DXRA 5I57A 2IEEA 4X1DA 1Z7NE 1H3DA 3TTKA 2Z8FA 1SW5A 2F7CA 3TCGA 3OMBA 5DVJA 4G68A 1MPDA 4DXBA 1FQBA 4OMBA 4QFPA 1ZTYA 3HHGA 2GFEA 3MVXA 4GOTA 4HW8A 2XXYA 1HSLA 5H8QB 2PVUA 2V25A 5L9OA 3RY3A 4DCYA 2F8DA 1A54A 2THIA 2F97A 3K1PA 5DEXB 3MQ9A 2ZYMA 1FTJA 4EXLA 4RPNA 3L6HA 4P0GA 4UA8A 4F18A 5A5XB 5CBRA 3JYRA 1IXIA 2XX9A 3B6WA 4LZ5A 4DXCA 4U1OA 4NF6B 3CFXA 1EZPA 1MQJA 4F3GA 1CE2A 4Q5TA 1H45A 2QS3A 1B3GA 1P1UA 1SYHA 3RTFB 1GGGA 3CFLA 4ESXA 3OSQA 1B5IA 2R9JA 2HQ0A 3W9VA 5AA4A 2X26A 4G68C 3GXAA 1P1WA 3IL1B 2F78A 3SEWA 1OVBA 1S7YA 3G3KA 3FXQA 5H8NA 2D21A 1SD3A 2Q88A 4OEUA 1QKBA 5BWJA 3ODBA 3HCQA 4QF9A 1EU8A 1O64A 1B9JA 5DYHA 1N7WA 4YU0A 1PDAA 4OZ9A 4DCXA 1IITA 2O7UA 4G8NA 3IJXB 2DS9A 2O68A 2ABHA 3U8QA 3LSLA 4GVOA 2ONRA 4POXA 4GLIA 1PC3A 3EN3A 4N13A 1CB6A 3KN7A 4ZZAA 4FORA 5J1DA 3SEUA 3MC2A 2DVCA 1JW5A 1SW1A 1Y4TA 3A09A 1B7ZA 2I6EA 4U4SA 4QFKA 4FEDA 4GXSB 5I58B 3PMWA 4PFYA 1USYE 4G77A 4XKNA 1LFHA 3QIMA 1MRPA 3C9HA 3TQWA 4LP2B 2F35A 3PUWE 3E13X 4PFTA 1B3EA 3K1NA 4JB7A 1XC1A 3IB0A 5CMKA 2WKYA 3BBRA 1URDA 4OFLA 5BUUA 1ZIUA 3PPQA 2LAOA 1Z7ME 4NWDA 1GVCA 1MY3A 4QRZA 3KZGA 3SKPA 3T93B 4ISUA 3T22A 2XXRA 3CVGA 4BDLA 2E1SA 1BP5A 4OYVA 3A3UA 5H8SA 1Y1MA 5H8HA 3O2AA 4QSCA 3KOSA 4GF8A 4WKMA 3VLWA 4I1DA 1D9VA 5IAIA 4R6YA 1SW2A 3LSWA 4ESWA 1LGBC 3K6UA 3CSGA 3P7IA 3VLUA 3CSBA 3IJOB 3SESA 4NTLA 1ATGA 3R7XA 3QXMA 2Q2AA 2DE3A 4ONYA 3LUYA 1Y1ZA 3L6GA 4YAHX 5AA2D 4M1VA 1SVXB 2Z23A 2UVJA 1LAHE 5KCJB 3C32A 1O7TA 3FJGA 5F7VA 3GBBA 3MWBA 4MBPA 4ZEBA 2FNCA 1XOCA 1D9YA 3SETA 3FZVA 3K4UA 2V3TA 1JVYA 4QSDA 3SEXA 1IXCA 3K02A 2H99A 1FTLA 2XX8A 2O51A 4ELPA 3H6WA 3IOVA 2QL3A 3G3GA 1JW1A 3RLFE 2I3WA 1MQHA 5H8QA 5FTIA 1A8EA 2ZYOA 4QSEA 3U1OA 1YCJA 5DEXA 2Z8DA 4IO7A 5AA3A 3TFLA 4NEDA 5I56B 3H7MA 2RKMA 5A5XA 3RNNA 4WEDA 4PFWA 3ZKLA 4NF6A 4R2FA 1B32A 1AH5A 4O3CA 1OQHA 4U1ZA 4AQ4A 3TTMA 2ALUA 3EHSA 2O7IA 4KQPA 3FXUA 4C1TA 2OK2A 4PQJA 3MP8A 4EQ7A 2D3IA 1YTVA 3H4ZA 3FASA 3UK4A 3U94A 1H76A 3UA8A 2FA7A 2AL5A 3PU5A 2NVUB 1QUIA 2UXAA 3PPPA 2GH9A 3QAXA 3E9XA 2I0CA 1XT8A 5DVFA 2B3FA 1BLFA 3O9PA 3MVZA 3SEVA 2QSXA 4KI0E 3UIFA 1BTJA 3ILUB 3K00A 5LOMA 3TTLA 4F3BA 3O6IA 4JWOA 2DVZA 1AMFA 2DWAA 4OEVA 1SDXA 2PX1A 1MXZA 4DLDA 1VFEA 5I84A 4IGTA 3LBSA 5JEIA 3UORA 4PP0A 1MXWA 3PUYE 3QUJA 1LFGA 4JDFA 4KD5A 4N6PA 1XVXA 3T9VA 2I4CA 1DTZA 3KSJA 1MXYA 3R6UA 2AYSA 2I48A 4IO2A 5I58A 3D4CA 3G3IA 5DT6A 2VP1A 4L17A 1YPNA 4NF4A 3PUVE 1JEUA 5K2YA 1EZ9A 2OWSA 3OOAA 1Q35A 2V3QA 1QJMA 2CZLA 2AIXA 3CG3A 3VE1B 3Q27A 1P1QA 3CFZA 3LR1A 3KBRA 1NFTA 1YAEA 3S9MC 1FQDA 4BDOA 4FATA 5M2VA 3MUQA 1M5BA 3WAFA 3B6QA 3FVKA 4G2ZA 2REJA 3S9LC 4HTGA 4KCCA 2X7QA 5TPAB 1B0LA 5KDTA 5FHNA 4OTEA 3TTRA 2I4BA 3C4MA 1MPCA 1MY2A 4NMYA 4YKKA 3LC8A 4JSOA 2DXYA 2XD3A 4Q30B 4YKJA 5AA2B 3B6TA 2Z8EA 1NH8A 4POWA 1A8FA 3KN8A 2UVIA 4RPOA 2QS1A 1LFIA 3CI8A 4AB5A 4RA1A 3A3CA 1B3HA 3ECRA 1TWYA 1VFDA 4EDPA 1L5TA 4H0WA 5KCJA 3PPNA 5KZTA 4LA9A 4QFNA 3MPKA 1TFAA 4OFOA 2ZYKA 3FJ7A 2F7AA 3O28A 1MXVA 1IEJA 2IA4A 4MH5A 4U2RA 5ITOA 1DOTA 3GBAA 1JETA 2Q89A 4EF2A 3H06B 3PD9A 4RXLA 1GR2A 1LB8A 2PBWA 3S2VA 4ECFA 3N5LA 4OHNA 1Y9UA 3CR9A 4KYDA 4MLVA 2HZKA 2QRYA 3C33A 4EF1A 3EHTA 2OWTA 4JBZA 4NF5B 3RT6B 3CRBA 1DPEA 2Q8JA 1VR5A 4JWXA 1P99A 3ONMA 5CM6A 1A7LA 2H98A 3IR1A 3U92A 1R9QA 4C1UA 2XX7A 3TEPA 3TZAA 1O63A 3VFJA 5I56A 2AL4A 1Y20A 4I9DA 1NMUA 4KPTA 4ND9A 2H25A 1EH3A 2NWJA 1UTBB 1WVJA 4OVJA 4O3BA 1B7HA 1PB8A 1SI1A 2O1MA 2HCAA 3PV0E 4U23A 4H5FA 3MBPA 1B7UA 5TP9A 1N3XA 2VD3A 1IXGA 1ZBMA 4F3SA 3OENA 4F39A 3OO7A 3TMGA 3IO4A 3IOWA 2OJTA 1MDP1 1LBCA 4U21A 5JK4A 2ESNA 2F36A 3PPOA 1FW0A 3N6UA 5HBCA 1I6BA 3FGSA 1A40A 3PMVA 3ZKKA 3RPWA 1WDNA 3I3VA 1M5FA 3O66A 4F29A 1OLCA 2PMSA 1ZU0A 3DM0A 4DDDA 2O1LA 1N3WA 4IO5A 1B5JA 3V5AA 3M3KA 4YZZA 4OESA 2REGA 2DP8A 4NF8A 1RYXA 2Z22A 4MFIA 1II5A 1M5CA 2XXWA 4R2BA 1ZMGA 4RJZA 4FIMA 3ZS6A 4X9TA 3FD3A 4ZEFA 3N94A 3UN6A 3K0VA 3CIJA 4IO3A 3RN8A 2G29A 3WAEA 3M3FA 1TT1A 4H67A 3VXBA 2ZNUA 5F1QA 1URSA 4QFOA 3H3GA 3TELA 1OLAA 3H6TA 4YB5A 2ONSA 3KGCA 2RC8A 3DLNA 4IGRA 1VSOA 3MZBA 1NNPA 5EYFA 3S4UA 5CMCA 1UTHA 3QYTA 3O6HA 4OENA 3DP4A 1QULA 1MG1A 3TODA 2RCBA 1KWHA 2DWHA 3JV9A 4GWOA 3MAMA 2XXVA 3H6UA 1IQ7A 3E4RA 3IK6B 4BLAA 4X48A 2R71A 4GFRA 3OO9A 1TXFA 1XVYA 2KLFA 1PB7A 1ZLQA 3KEIA 4BDMA 1QW0A 3OO6A 5TPAA 3TTNA 3B7DA 4LZ7A 1B05A 5JTYB 3T96B 2P2AA 4XKPA 4TLLB 5ITPA 3H6VA 1US4A 4N07A 4Z7EA 3MPLA 2E0SA 3K01A 5HM4B 2OCUA 4G4PA 2HEUA 3F11A 1URGA 3SEYA 1MQIA 3VV5A 1IIWA 5AA2A 3O6GA 1IXHA 2A5TB 1MH4A 1AIVA 4H65A 4PFUA 1ELJA 3EQ1A 1B5HA 4LUBA 5DTBA 2P1SA 1B4HA 3QSLA 1POY1 5FTHA 4Z0IA 2V84A 5H8FB 1DSNA 4RYAA 4GD5A 2XD2A 1USYH 4GL0A 4H8IA 1B6HA 4O3AA 1LAGE 2R6GE 1S50A 2Y7KA 1BIYA 4LQ5A 3S9EA 1FCKA 3VVFA 1SYIA 1FTMA 1MY1A 1B2HA 4YICA 4RK2A 5CRYA 5ELVA 2XXXA 3IO6A 4H1XA 1AOVA 4KYEA 1H43A 4K3FA 2PT1A 5AA1A 1MQDA 4F3PA 4QFLA 4F1UA 2A5SA 1MS7A 4I8CA 1I6AA 2CMOA 2Q2CA 2ZNSA 4HS7A 5IKBA 5I2KB 5EHMA 3MVYA 2PYYA 2H4IA 1PEBA 2QS4A 3TCFA 2OBGA 3KSXA 4Q0CA 2DSFA 1OQGA 4KHZE 1UTBA 1QKAA 3K6WA 2NUVA 5L9MA 2YLNA 3HSTA 4E0WA 1LCFA 4IY6A 2I3VA 3H03A 1N84A 1QVSA 4GIZA 3UP9A 4DXUA 2GHBA 2HAVA 1DPPA 4OETA 3T66A 2UVHA 1Y3NA 1P1OA 2O69A 3KN3A 1N7XA 4ZE8A 3TDJA 3I6VA 4XKQA 1LCTA 2DE4A 4JSDA 5L9SA 2OZZA 3SERA 3IX1A 3IB2A 4EQBA 2HFBA 2RC9A 2RINA 4QHQA 3Q29A 1ZKBA 4OQOA 1JNFA 2Y7IA 4EUOA 2F6PA 4XKRA 4F19A 2XXPA 3MZ1A 1M5DA 4TQUQ 4MLQA 4YB6A 2DE2A 1AL3A 3O29A 5CBSA 4EQ9A 1D4NA 2XXUA 2HXWA 3BFTA 3KJ7A 1XS5A 2XHDA 4I62A 3U72A 3C31A 4GL8A 3W9WA 2V93A 1NKXA 3HO7A 3M8UA 4YKIA 4RNSA 2D5WA 1HSJA 2DWIA 4U22A 4ELRA 3E3KA 1SBPA 3IAZA 3MP6A 1FQAA 1R9LA 3S9NC 1RYOA 1B3LA 4R6KA 1WODA 1MXXA 4ZE9A 3G7WA 4BDNA 1SQYA 4LQ2A 2H9BA 1UQWA 2I49A 2VHAA 4YMBA 3MZ9A 1IUDA 1PB9A 2XXHA 3DP6A 1B3FA 3TAJA 4M4GA 4R73A 1I69A 4DE8A 2PT2A 4ZEDA 2DQVA 4OFJA 3W15C 3N6TA 3PUXE 4H6DA 1MXUA 3OXNA 4LONB 3HV1A 4NWCA 4PETA 5JTYA 5EHSA 2I58A 4LZ8A 4NE4A 3Q25A 4RK9A 1T0KA 3RTWB 2ZNTA 4YKPA 3TPAA 2QJEA 4R75A 2RF1A 2A5TA 4KCDA 1NL5A 2G93A 2XXIA 2F6GA 5H8FA 3FVNA 4H5GA 3Q28A 1IZ1A 1OVTA 2ZMBA 1MY4A 3KJTA 3LSXA 2NOOA 3U93A 1Y3QA 2GHAA 2RCAA 1J1NA 5K2XA 2QMWA 3RQTA 3N26A 3VLVA 4U4XA 2VD2A 2VGQA 3IORA 2B3BA 2DOJA 4BDQA 3BFUA 1JVXA 5I2NB 1NH7A 1S9TA 5CMBA 3FV1A 1LB9A 1Y3PA 2DYXA 3GZGA 2YPNA 4ZEIA 1HSEA 3M3LA 4OXVA 4OWDA 4DIGA 3OO8A 2H5YA 4NF4B 3TCHA 1Q1KA 3G3JA 3R26A 2ZYNA 4IY5A 2VOZA 3FVOA 1OIBA 5I59B 3EPEA 4ZECA 1D3KA 2V3UA 1JW4A 4ELOA 5B7DA 5I2KA 3FVGA 2DWJA
chains in the Genus database with same CATH superfamily
3JZJA 3HHFA 4YMAA 1NI9A 1POTA 4HCWA 2Q9TA 4PAKA 4PE5B 5FHMA 3QK6A 1FBFA 3FIRA 1LSTA 3FATA 1NUWA 2X7PA 4XEQA 5I57B 5CC2A 2Q8MA 4KFQA 1KZ8A 4NHBA 3USDA 4GXAA 3T9UA 3A29A 5KDTB 4G8MA 4G68B 1MM7A 4MCOA 4PFRA 4ELQA 2BJJX 2W7YA 1I6QA 1OMPA 3OD7A 4XTCQ 4F22A 4YB7A 3IOUA 1B4ZA 1FPKA 3VVDA 5CI5A 4N4UA 1NNKA 3IB1A 3C34A 2UVGA 4FE8A 4ZEKA 1A99A 1US5A 4AB6A 1FQCA 5L8DA 1QUKA 4MEVA 2F5XA 1FQFA 3PMXA 1FTAA 1MPBA 4F1YA 1MH3A 5FBPA 4LVQA 2O84X 4IB2A 3VVEA 2PCRA 1F9BA 2F34A 3CG1A 3K6XA 5EYGA 2UYFA 2BJIA 1XHYA 2HHMA 5B70A 4H46A 4MIJA 2XXQA 1R6ZA 1LBBA 1NV3A 3ILTB 1TFDA 4FJPA 1QUJA 4TLMB 2FYIA 3KG2A 4R9GA 2VPNA 4F1VA 3OEMA 4O8MA 2I0BA 2Y7WA 1MY0A 1MQGA 1H44A 4EXKA 1NUXA 5AA4B 2CZHA 1FTKA 2Y84A 1JP4A 4G8HA 3OSRA 3T9XB 4XXUA 2ONKE 3QUFA 4ZS9A 2HZLA 4TOZA 5H8NB 1B52A 1GV8A 2ANJA 1Y4CA 4BDRA 3GLBA 3TYHA 5LTCA 4OVQA 2F7BA 4JXIA 3THIA 4ZZEA 1B1HA 4JWYA 3AXFA 4F31B 4P0IA 4R6HA 4GRKA 1B1XA 4X1BA 3RGYA 4OERA 2HAUA 3KFMA 3C35A 3V89B 2QS2A 1NNFA 4F2QA 3DP8A 2WX9A 2YJPA 5HPQA 1NV7A 4FAJA 1B40A 1JQFA 4OVRA 2RC7A 1LEVA 1A55A 4NGUA 1B0HA 3K1MA 3EF7A 5IZ1A 2F3DA 4HCYA 4I3EA 1PBPA 4F2OA 1FQEA 2Y7RA 5ICTA 1MM6A 3ZSFA 4ZDMA 3PPRA 3TQLA 5DVIA 4GWUA 3E79A 3EHUA 5TP9B 1G0HA 2NXOA 1EZOA 1SW4A 4P11A 3IOTA 1UIUA 1M5EA 2QPQA 3FJMA 3MVWA 1LAXA 1UIVA 4C0RA 3SDFA 4R74A 3MJNA 4NF5A 1LLSA 1R1NA 4LATA 3KOTA 3C36A 5DW8A 1GTKA 2O6AA 4P1EA 3MW0A 3D4GA 4XF5A 2WYPA 2P3VA 5FHOA 3UGWA 3DELB 1FTOA 2GRVA 1N0TA 3I5OA 3RT8A 2M8CA 3FUZA 4R9FA 1BKAA 4NF8B 3K6VA 4Q8RA 4HE2A 3FV2A 4THIA 4UACA 2QMXA 2XXTA 1B46A 1JEVA 1B51A 4PC9A 4DZ1A 1P1NA 2QVUA 1B58A 2UYEA 2XXKA 3Q26A 5H8HB 3G3FA 1ZJLA 2KQZA 5I2NA 1PBQA 3G3HA 4KR5A 3PUZE 4WXJA 1DMBA 2ZXTA 3BKIB 4MF3A 3MP1A 1NNTA 3VXCA 4GQOA 1DTGA 3LSFB 1LAFE 4R72A 4KYSA 3V8XB 3SZPA 5CMMA 3PGFA 2P0SA 4HXVA 1ANFA 1N04A 3FXBA 4IO4A 4GWWA 3K2DA 4IO6A 4PBQA 4XIGQ 4WEPA 3TUSA 5I59A 4PAIA 1UTHB 5ISUA 3O97A 1FPIA 3RPLB 2B4LA 4NG7A 5TU0A 1SI0A 2Y7PA 3TKDA 2OLBA 5AE4A 3RUMA 1MDQA 1N76A 1VE4A 3OEKA 2B65A 1RKMA 4P56A 5ICQA 3T9HB 4E0XA 3V83A 4RY1A 3VDFA 4FEBA 3HN0A 4FECA 4H8JA 3OELA 3FXRA 4N8YA 3PD8A 3HPIA 2DXRA 5I57A 2IEEA 4X1DA 1Z7NE 1H3DA 3TTKA 5ET7A 2Z8FA 1SW5A 2F7CA 3TCGA 3OMBA 2JJKA 5DVJA 1FPGA 4G68A 4PGNA 1MPDA 4DXBA 1FQBA 4OMBA 4QFPA 1ZTYA 3HHGA 2GFEA 3MVXA 4PGPA 4GOTA 4HW8A 2XXYA 1HSLA 5H8QB 2PVUA 2V25A 5L9OA 3RY3A 4DCYA 2F8DA 1A54A 2THIA 2F97A 4MNPA 3K1PA 5DEXB 2WEFA 3MQ9A 2ZYMA 1FTJA 4EXLA 4RPNA 3L6HA 4P0GA 4UA8A 4F18A 5A5XB 5CBRA 3JYRA 1IXIA 2XX9A 1FPLA 3B6WA 4LZ5A 4DXCA 4U1OA 4NF6B 1LBXA 3CFXA 1EZPA 1MQJA 4F3GA 1CE2A 1RDZA 4Q5TA 1Q9DA 3B8BA 3MSTA 1H45A 2QS3A 1B3GA 1NV1A 1FBCA 1P1UA 4GX3A 1SYHA 3RTFB 1GGGA 4O7IA 3CFLA 4ESXA 3OSQA 4I3YA 1B5IA 2R9JA 2HQ0A 3W9VA 2B4MA 5AA4A 2X26A 4G68C 3GXAA 1P1WA 3IL1B 2F78A 3SEWA 4KXPA 1OVBA 4QBAA 1S7YA 3G3KA 3FXQA 5H8NA 2D21A 1SD3A 2Q88A 4OEUA 1QKBA 5BWJA 3ODBA 3HCQA 4QF9A 4O94A 1EU8A 1O64A 1B9JA 5DYHA 1N7WA 4YU0A 4X04A 1PDAA 4OZ9A 4DCXA 1IITA 2O7UA 1NV5A 4NN3A 4G8NA 3IJXB 2DS9A 2O68A 2ABHA 3U8QA 3LSLA 4GVOA 2ONRA 4POXA 4GBWA 4GLIA 1PC3A 3EN3A 4N13A 5A5LA 1CB6A 2F3BA 3KN7A 4ZZAA 4FORA 5J1DA 3SEUA 3MC2A 2DVCA 4PAFA 1JW5A 4MX6A 1SW1A 1Y4TA 3A09A 1B7ZA 2I6EA 4U4SA 4QFKA 4FEDA 4GXSB 5I58B 4X8RA 3PMWA 1NV0A 4PFYA 1USYE 4N8GA 4G77A 4XKNA 1LFHA 3D1RA 3QIMA 1MRPA 3C9HA 3TQWA 4LP2B 3LUZA 2FVZA 2F35A 3PUWE 3E13X 2OWZA 1G0IA 4PFTA 1B3EA 3K1NA 4JB7A 1XC1A 3IB0A 5CMKA 2WKYA 3BBRA 1URDA 4OFLA 1SPIA 4PDDA 5BUUA 2HXRA 1ZIUA 5IZ3B 3PPQA 2LAOA 1Z7ME 4NWDA 1GVCA 1MY3A 4QRZA 4N91A 3KZGA 3SKPA 4PDHA 3T93B 4ISUA 3T22A 2XXRA 4G61A 3CVGA 4BDLA 2E1SA 1BP5A 4OYVA 3KC1A 3A3UA 2Q74A 4N6DA 5H8SA 1Y1MA 5H8HA 3O2AA 4QSCA 3KOSA 4GF8A 4WKMA 3VLWA 4I1DA 1D9VA 5IAIA 2QVRA 1FBHA 4R6YA 1SW2A 3LSWA 4ESWA 2QFLA 1LGBC 3K6UA 3CSGA 3P7IA 3VLUA 3CSBA 3IJOB 3SESA 4NTLA 1ATGA 3R7XA 3QXMA 2Q2AA 2DE3A 4ONYA 3LUYA 1LBZA 1Y1ZA 3L6GA 4YAHX 5IZZA 5AA2D 3T0JA 4M1VA 1SVXB 2Z23A 2UVJA 1LAHE 3RPLA 4PE3A 5KCJB 3C32A 1O7TA 1FRPA 3FJGA 1QGXA 5F7VA 3GBBA 3MWBA 4MBPA 4ZEBA 2FNCA 1XOCA 1D9YA 3FZVA 3SETA 3K4UA 2V3TA 1JVYA 4QSDA 1LBWA 3SEXA 1IXCA 1IMEA 3K02A 2H99A 1FTLA 4GX6A 4N15A 2XX8A 4MNCA 2O51A 4ELPA 3H6WA 3IOVA 2QL3A 3G3GA 1JW1A 3RLFE 2I3WA 1EYJA 5EYHA 1MQHA 5H8QA 5FTIA 1A8EA 2ZYOA 4QSEA 3U1OA 2CZIA 4GWSA 1YCJA 5DEXA 2Z8DA 4IO7A 5AA3A 2HPGA 3TFLA 4NEDA 3B50A 5I56B 3H7MA 2RKMA 5A5XA 2WBBA 3RNNA 4WEDA 4PFWA 3ZKLA 4NF6A 4R2FA 1B32A 1AH5A 4O3CA 1OQHA 4U1ZA 4AQ4A 3TTMA 4DI4B 2QVVA 2ALUA 3EHSA 2O7IA 2MKZA 1NV2A 4KQPA 3FXUA 4C1TA 2OK2A 4PQJA 2DDKA 3MP8A 4EQ7A 2D3IA 1YYZA 1YTVA 3H4ZA 3FASA 2VPOA 3UK4A 3U94A 5ESYA 1H76A 3UA8A 2CZKA 2FA7A 2AL5A 3PU5A 2NVUB 1QUIA 3HFUA 2UXAA 4PCDA 5LDZA 3PPPA 2GH9A 1D9QA 3QAXA 3E9XA 2I0CA 1XT8A 5DVFA 1FSAA 2B3FA 1BLFA 5ET8A 3O9PA 3MVZA 3SEVA 2QSXA 5F24A 4KI0E 3UIFA 4PTKA 4JVDA 1BTJA 3ILUB 3K00A 5LOMA 2WBDA 4OVSA 3TTLA 4F3BA 3O6IA 4JWOA 1FJ9A 2DVZA 1K9YA 1AMFA 2DWAA 4OEVA 1SDXA 2PX1A 1MXZA 4DLDA 4P9KA 1VFEA 5I84A 4IGTA 3LBSA 5JEIA 3UORA 4PP0A 1MXWA 3PUYE 3QUJA 1LFGA 4JDFA 4KD5A 4N6PA 1XVXA 3T9VA 2I4CA 1DTZA 3KSJA 1MXYA 3R6UA 2AYSA 2I48A 4IO2A 3KC0A 5I58A 3D4CA 3G3IA 5DT6A 2VP1A 4PF8A 4L17A 1YPNA 4NF4A 3PUVE 1JEUA 5K2YA 1EZ9A 2OWSA 3OOAA 1Q35A 2V3QA 1QJMA 2CZLA 2AIXA 3CG3A 3VE1B 3LV0A 2CEYA 3Q27A 1P1QA 3CFZA 3LR1A 3KBRA 3BIHA 1NFTA 4HE1A 4UABA 1YAEA 2FIXA 3S9MC 1FQDA 4BDOA 4FATA 1FPFA 5M2VA 3MUQA 5IZ3A 1M5BA 1FBEA 3WAFA 2V4CA 5I7IA 1YZ0A 3B6QA 3FVKA 4G2ZA 2REJA 3S9LC 4HTGA 4KCCA 2X7QA 5TPAB 1B0LA 5KDTA 5FHNA 3ROJA 4OTEA 3TTRA 2I4BA 3C4MA 1MPCA 1MY2A 4NMYA 4YKKA 3LC8A 4JSOA 2DXYA 2XD3A 4Q30B 4YKJA 5AA2B 4LN5A 3B6TA 2Z8EA 5IGAA 1NH8A 4POWA 1A8FA 3KN8A 2UVIA 4PBHA 4RPOA 2FIEA 2QS1A 2ZZWA 1LFIA 3CI8A 1FBGA 4AB5A 4RA1A 4N17A 3A3CA 1YXIA 1B3HA 3ECRA 1TWYA 1VFDA 4EDPA 1L5TA 4H0WA 3KBZA 5KCJA 3PPNA 5KZTA 4LA9A 4QFNA 1FPEA 3MPKA 1TFAA 4OFOA 4IR8A 2ZYKA 3FJ7A 2F7AA 3O28A 3E78A 1MXVA 1IEJA 3PTYA 1XI6A 2IA4A 4MH5A 4U2RA 5ITOA 1DOTA 3GBAA 1JETA 2Q89A 4EF2A 3H06B 3PD9A 4RXLA 1GR2A 1LB8A 2PBWA 3S2VA 3NOHA 4ECFA 3N5LA 4MNIA 4OHNA 1Y9UA 3CR9A 4KYDA 4MLVA 2HZKA 2QRYA 3C33A 4EF1A 3EHTA 2OWTA 4JBZA 4NF5B 3RT6B 3CRBA 1DPEA 2Q8JA 1VR5A 4GWZA 4JWXA 1P99A 3ONMA 5CM6A 1A7LA 2H98A 3IR1A 3U92A 1R9QA 4C1UA 2XX7A 3TEPA 3TZAA 1VDWA 3EKIA 1O63A 3VFJA 5I56A 2AL4A 1Y20A 4I9DA 1RDYA 1NMUA 5EQ8A 4KPTA 4ND9A 2H25A 1NV4A 1EH3A 2NWJA 1UTBB 1WVJA 4OVJA 4O3BA 4MJOA 1B7HA 4FBPA 1PB8A 1SI1A 2O1MA 2HCAA 3PV0E 4U23A 3T1BA 4H5FA 3MBPA 1B7UA 5TP9A 1N3XA 2VT5A 2VD3A 1IXGA 1ZBMA 4F3SA 2PFYA 3OENA 4F39A 3OO7A 3TMGA 3IO4A 3IOWA 2OJTA 5EQAA 1MDP1 4OANA 1RDXA 1LBCA 4U21A 5JK4A 2ESNA 2F36A 3PPOA 1FW0A 3N6UA 2WYKA 5HBCA 1I6BA 1DCUA 3FGSA 1A40A 3PMVA 3ZKKA 3RPWA 1WDNA 3I3VA 1M5FA 3O66A 4F29A 1OLCA 4XFEA 2PMSA 1ZU0A 3DM0A 4DDDA 2O1LA 1N3WA 1K9ZA 4IO5A 1B5JA 3V5AA 3M3KA 4YZZA 4OESA 2REGA 2DP8A 4NF8A 1RYXA 2Z22A 4MFIA 2R8TA 1II5A 1M5CA 2XXWA 4R2BA 1ZMGA 1FPBA 4RJZA 1DBZA 4FIMA 3ZS6A 4X9TA 3FD3A 4ZEFA 3N94A 3UN6A 3K0VA 4MMPA 3CIJA 4IO3A 4JVCA 3RN8A 2G29A 3WAEA 3M3FA 1TT1A 4H67A 3VXBA 2ZNUA 5F1QA 1URSA 4QFOA 3H3GA 3TELA 1OLAA 3H6TA 4P3LA 4YB5A 2ONSA 2XWKA 1BK4A 2Y5KA 3RYDA 3KGCA 2RC8A 3DLNA 4IGRA 1VSOA 3MZBA 1NNPA 4QXDA 5EYFA 3S4UA 5CMCA 1UTHA 4NAPA 3QYTA 4HE0A 5ET5A 4DI3D 3O6HA 4OENA 3DP4A 1QULA 1MG1A 3TODA 2RCBA 5I5PA 1KWHA 2DWHA 1FBPA 3JV9A 4GWOA 5J16A 3MAMA 3ISPA 1EYIA 2XXVA 3H6UA 1IQ7A 3E4RA 3IK6B 4BLAA 1FPJA 4X48A 2R71A 4GFRA 3OO9A 1TXFA 1XVYA 2KLFA 1PB7A 1ZLQA 3KEIA 4BDMA 1QW0A 3OO6A 5TPAA 1LBVA 4N6KA 3TTNA 3B7DA 4LZ7A 1B05A 5JTYB 3T96B 2P2AA 4XKPA 4TLLB 5ITPA 3H6VA 4N07A 1US4A 4MHFA 4Z7EA 3MPLA 2E0SA 3K01A 5HM4B 2OCUA 4G4PA 1NUZA 2HEUA 3F11A 1URGA 3SEYA 1MQIA 4JVIA 3VV5A 1IIWA 5AA2A 3O6GA 1IXHA 2A5TB 1MH4A 1AIVA 4H65A 4PFUA 1ELJA 3EQ1A 1B5HA 4LUBA 5DTBA 2P1SA 4PFIA 1B4HA 3QSLA 1POY1 5FTHA 4Z0IA 2V84A 5H8FB 1DSNA 4RYAA 4GD5A 2XD2A 1USYH 3QMFA 4GL0A 4H8IA 1B6HA 1DK4A 4O3AA 1LAGE 2R6GE 4GWXA 1S50A 2Y7KA 1BIYA 4LQ5A 4OVPA 3S9EA 1FCKA 4OA4A 3VVFA 1SYIA 1FTMA 1MY1A 1B2HA 4YICA 4RK2A 5CRYA 4NF0A 2OX3A 5T3JA 3MYUA 5ELVA 2XXXA 3IO6A 5IM2A 4H1XA 3CHGA 1AOVA 4KYEA 1H43A 4K3FA 2PT1A 5AA1A 1MQDA 1LBYA 4F3PA 4QFLA 4F1UA 1FBDA 3U65A 2A5SA 1MS7A 4I8CA 1I6AA 2CMOA 2Q2CA 2ZNSA 4HS7A 3GYYA 5IKBA 5I2KB 1AWBA 5EHMA 2PFZA 1IMDA 3MVYA 2PYYA 2H4IA 2ZZXA 1PEBA 2QS4A 3TCFA 2OBGA 2XA5A 3KSXA 4Q0CA 2DSFA 1OQGA 4KHZE 1UTBA 2KR0A 1QKAA 3K6WA 2NUVA 5L9MA 5EQ9A 2YLNA 3HSTA 4PFBA 4E0WA 1LCFA 4IY6A 2GQ1A 2I3VA 3H03A 1KA0A 1N84A 1QVSA 4GIZA 3UP9A 4DXUA 2GHBA 4O7MA 2HAVA 1DPPA 4NX1A 4OETA 3T66A 2UVHA 1Y3NA 1P1OA 2O69A 3KN3A 1FPDA 1IMFA 2ZZVA 1N7XA 5I3SA 4ZE8A 3TDJA 3I6VA 4XKQA 1LCTA 2DE4A 4JSDA 5L9SA 2OZZA 3SERA 3IX1A 3IB2A 4EQBA 2HFBA 2RC9A 1INPA 2RINA 4QHQA 3Q29A 1ZKBA 4OQOA 4NQ8A 1JNFA 2Y7IA 4EUOA 2F6PA 1NV6A 4XKRA 4F19A 2XXPA 3MZ1A 1M5DA 4H45A 4TQUQ 4MLQA 4YB6A 2DE2A 1AL3A 2XWOA 3O29A 3IFAA 4AS5A 5CBSA 4GX4A 4EQ9A 1D4NA 2XXUA 2HXWA 3BFTA 3KJ7A 1XS5A 2XHDA 4I62A 1IMCA 3U72A 3C31A 4GL8A 3W9WA 2V93A 4GBVA 1NKXA 3HO7A 2FHYA 3M8UA 4YKIA 4RNSA 2D5WA 1HSJA 2DWIA 4U22A 4ELRA 3E3KA 4N81A 2Y5LA 1SBPA 3IAZA 3MP6A 1FQAA 1R9LA 3S9NC 1RYOA 1B3LA 4R6KA 2P3NA 1WODA 1MXXA 4ZE9A 3G7WA 4BDNA 1SQYA 4LQ2A 2H9BA 1UQWA 2I49A 2VHAA 4YMBA 3MZ9A 1IUDA 1PB9A 2XXHA 3DP6A 1FJ6A 1B3FA 4GWYA 3TAJA 4M4GA 4R73A 1I69A 4DE8A 2PT2A 2FBPA 3BIGA 4ZEDA 2DQVA 4OFJA 3W15C 3N6TA 1KA1A 2XWIA 1CNQA 3PUXE 4H6DA 1MXUA 3OXNA 4LONB 3HV1A 4NWCA 4PETA 5JTYA 5EHSA 3FBPA 2I58A 4LZ8A 4NE4A 3Q25A 4RK9A 1T0KA 3RTWB 2ZNTA 4YKPA 3TPAA 2QJEA 4R75A 2RF1A 2A5TA 1IMBA 4MAGA 4KCDA 4I40A 1NL5A 2G93A 2XXIA 2F6GA 5H8FA 3FVNA 2L5VA 4H5GA 3Q28A 1IZ1A 1OVTA 2ZMBA 1MY4A 5ET6A 3KJTA 3LSXA 2NOOA 3U93A 1Y3QA 2GHAA 2RCAA 1J1NA 5K2XA 4OVTA 4PF6A 2QMWA 3RQTA 3N26A 3VLVA 4P47A 4U4XA 2VD2A 2VGQA 3IORA 2B3BA 2DOJA 4BDQA 3BFUA 1EYKA 1JVXA 5I2NB 2XWVA 3IFCA 1NH7A 1S9TA 5CMBA 3FV1A 1LB9A 1IMAA 1Y3PA 2DYXA 3GZGA 4AS4A 4P1LA 2CEXA 2YPNA 4ZEIA 1HSEA 3M3LA 4OXVA 4OWDA 5EQ7A 4DIGA 3OO8A 2H5YA 4NF4B 3TCHA 1Q1KA 1NUYA 3G3JA 3R26A 2ZYNA 4IY5A 2VOZA 3FVOA 1OIBA 5I59B 3EPEA 4ZECA 1D3KA 2V3UA 4P8BA 1JW4A 4ELOA 5B7DA 5I2KA 3FVGA 2DWJA
chains in the Genus database with same CATH topology
3JZJA 3HHFA 4YMAA 1POTA 4HCWA 2Q9TA 4PE5B 5FHMA 3QK6A 3FIRA 1LSTA 3FATA 2X7PA 5I57B 5CC2A 4KFQA 3USDA 4GXAA 3T9UA 5KDTB 4G8MA 4G68B 1MM7A 4ELQA 2BJJX 2W7YA 1I6QA 1OMPA 3OD7A 4XTCQ 4F22A 4YB7A 3IOUA 1B4ZA 3VVDA 5CI5A 1NNKA 3IB1A 3C34A 2UVGA 4FE8A 4ZEKA 1A99A 1US5A 4AB6A 1FQCA 5L8DA 1QUKA 2F5XA 1FQFA 3PMXA 1MPBA 4F1YA 1MH3A 4LVQA 2O84X 4IB2A 3VVEA 1F9BA 2F34A 3CG1A 3K6XA 2UYFA 1XHYA 5B70A 2XXQA 1R6ZA 1LBBA 3ILTB 1TFDA 4FJPA 1QUJA 4TLMB 2FYIA 3KG2A 4R9GA 4F1VA 3OEMA 2I0BA 2Y7WA 1MY0A 1MQGA 1H44A 4EXKA 5AA4B 1FTKA 2Y84A 4G8HA 3OSRA 3T9XB 4XXUA 2ONKE 3QUFA 4ZS9A 2HZLA 4TOZA 5H8NB 1B52A 1GV8A 2ANJA 1Y4CA 4BDRA 3GLBA 3TYHA 2F7BA 4JXIA 3THIA 4ZZEA 1B1HA 4JWYA 3AXFA 4F31B 4P0IA 4R6HA 4GRKA 1B1XA 4X1BA 3RGYA 4OERA 2HAUA 3KFMA 3C35A 3V89B 2QS2A 1NNFA 4F2QA 3DP8A 2YJPA 5HPQA 4FAJA 1B40A 1JQFA 2RC7A 1A55A 1B0HA 3K1MA 3EF7A 4HCYA 1PBPA 4F2OA 1FQEA 2Y7RA 5ICTA 1MM6A 3ZSFA 4ZDMA 3PPRA 3TQLA 5DVIA 3EHUA 5TP9B 2NXOA 1EZOA 1SW4A 4P11A 3IOTA 1UIUA 1M5EA 2QPQA 3FJMA 3MVWA 1LAXA 1UIVA 4C0RA 3SDFA 4R74A 3MJNA 4NF5A 1LLSA 1R1NA 4LATA 3KOTA 3C36A 1GTKA 2O6AA 3MW0A 3D4GA 5FHOA 3UGWA 3DELB 1FTOA 2GRVA 1N0TA 3I5OA 3RT8A 2M8CA 3FUZA 4R9FA 1BKAA 4NF8B 3K6VA 4Q8RA 3FV2A 4THIA 4UACA 2QMXA 2XXTA 1B46A 1JEVA 1B51A 4DZ1A 1P1NA 1B58A 2UYEA 3Q26A 5H8HB 3G3FA 1ZJLA 5I2NA 1PBQA 3G3HA 4KR5A 3PUZE 4WXJA 1DMBA 2ZXTA 3BKIB 4MF3A 3MP1A 1NNTA 3VXCA 4GQOA 1DTGA 3LSFB 1LAFE 4R72A 4KYSA 3V8XB 5CMMA 3PGFA 2P0SA 1ANFA 1N04A 4IO4A 3K2DA 4IO6A 4XIGQ 4WEPA 3TUSA 5I59A 1UTHB 5ISUA 3O97A 5TU0A 1SI0A 2Y7PA 3TKDA 2OLBA 5AE4A 3RUMA 1MDQA 1N76A 1VE4A 3OEKA 2B65A 1RKMA 5ICQA 3T9HB 4E0XA 3V83A 4RY1A 3VDFA 4FEBA 3HN0A 4FECA 4H8JA 3OELA 3FXRA 3PD8A 3HPIA 2DXRA 5I57A 2IEEA 4X1DA 1Z7NE 1H3DA 3TTKA 2Z8FA 1SW5A 2F7CA 3TCGA 3OMBA 5DVJA 4G68A 1MPDA 4DXBA 1FQBA 4OMBA 4QFPA 1ZTYA 3HHGA 2GFEA 3MVXA 4GOTA 4HW8A 2XXYA 1HSLA 5H8QB 2PVUA 2V25A 5L9OA 3RY3A 4DCYA 2F8DA 1A54A 2THIA 2F97A 3K1PA 5DEXB 3MQ9A 2ZYMA 1FTJA 4EXLA 4RPNA 3L6HA 4P0GA 4UA8A 4F18A 5A5XB 5CBRA 3JYRA 1IXIA 2XX9A 3B6WA 4LZ5A 4DXCA 4U1OA 4NF6B 3CFXA 1EZPA 1MQJA 4F3GA 1CE2A 4Q5TA 1H45A 2QS3A 1B3GA 1P1UA 1SYHA 3RTFB 1GGGA 3CFLA 4ESXA 3OSQA 1B5IA 2R9JA 2HQ0A 3W9VA 5AA4A 2X26A 4G68C 3GXAA 1P1WA 3IL1B 2F78A 3SEWA 1OVBA 1S7YA 3G3KA 3FXQA 5H8NA 2D21A 1SD3A 2Q88A 4OEUA 1QKBA 5BWJA 3ODBA 3HCQA 4QF9A 1EU8A 1O64A 1B9JA 5DYHA 1N7WA 4YU0A 1PDAA 4OZ9A 4DCXA 1IITA 2O7UA 4G8NA 3IJXB 2DS9A 2O68A 2ABHA 3U8QA 3LSLA 4GVOA 2ONRA 4POXA 4GLIA 1PC3A 3EN3A 4N13A 1CB6A 3KN7A 4ZZAA 4FORA 5J1DA 3SEUA 3MC2A 2DVCA 1JW5A 1SW1A 1Y4TA 3A09A 1B7ZA 2I6EA 4U4SA 4QFKA 4FEDA 4GXSB 5I58B 3PMWA 4PFYA 1USYE 4G77A 4XKNA 1LFHA 3QIMA 1MRPA 3C9HA 3TQWA 4LP2B 2F35A 3PUWE 3E13X 4PFTA 1B3EA 3K1NA 4JB7A 1XC1A 3IB0A 5CMKA 2WKYA 3BBRA 1URDA 4OFLA 5BUUA 1ZIUA 3PPQA 2LAOA 1Z7ME 4NWDA 1GVCA 1MY3A 4QRZA 3KZGA 3SKPA 3T93B 4ISUA 3T22A 2XXRA 3CVGA 4BDLA 2E1SA 1BP5A 4OYVA 3A3UA 5H8SA 1Y1MA 5H8HA 3O2AA 4QSCA 3KOSA 4GF8A 4WKMA 3VLWA 4I1DA 1D9VA 5IAIA 4R6YA 1SW2A 3LSWA 4ESWA 1LGBC 3K6UA 3CSGA 3P7IA 3VLUA 3CSBA 3IJOB 3SESA 4NTLA 1ATGA 3R7XA 3QXMA 2Q2AA 2DE3A 4ONYA 3LUYA 1Y1ZA 3L6GA 4YAHX 5AA2D 4M1VA 1SVXB 2Z23A 2UVJA 1LAHE 5KCJB 3C32A 1O7TA 3FJGA 5F7VA 3GBBA 3MWBA 4MBPA 4ZEBA 2FNCA 1XOCA 1D9YA 3SETA 3FZVA 3K4UA 2V3TA 1JVYA 4QSDA 3SEXA 1IXCA 3K02A 2H99A 1FTLA 2XX8A 2O51A 4ELPA 3H6WA 3IOVA 2QL3A 3G3GA 1JW1A 3RLFE 2I3WA 1MQHA 5H8QA 5FTIA 1A8EA 2ZYOA 4QSEA 3U1OA 1YCJA 5DEXA 2Z8DA 4IO7A 5AA3A 3TFLA 4NEDA 5I56B 3H7MA 2RKMA 5A5XA 3RNNA 4WEDA 4PFWA 3ZKLA 4NF6A 4R2FA 1B32A 1AH5A 4O3CA 1OQHA 4U1ZA 4AQ4A 3TTMA 2ALUA 3EHSA 2O7IA 4KQPA 3FXUA 4C1TA 2OK2A 4PQJA 3MP8A 4EQ7A 2D3IA 1YTVA 3H4ZA 3FASA 3UK4A 3U94A 1H76A 3UA8A 2FA7A 2AL5A 3PU5A 2NVUB 1QUIA 2UXAA 3PPPA 2GH9A 3QAXA 3E9XA 2I0CA 1XT8A 5DVFA 2B3FA 1BLFA 3O9PA 3MVZA 3SEVA 2QSXA 4KI0E 3UIFA 1BTJA 3ILUB 3K00A 5LOMA 3TTLA 4F3BA 3O6IA 4JWOA 2DVZA 1AMFA 2DWAA 4OEVA 1SDXA 2PX1A 1MXZA 4DLDA 1VFEA 5I84A 4IGTA 3LBSA 5JEIA 3UORA 4PP0A 1MXWA 3PUYE 3QUJA 1LFGA 4JDFA 4KD5A 4N6PA 1XVXA 3T9VA 2I4CA 1DTZA 3KSJA 1MXYA 3R6UA 2AYSA 2I48A 4IO2A 5I58A 3D4CA 3G3IA 5DT6A 2VP1A 4L17A 1YPNA 4NF4A 3PUVE 1JEUA 5K2YA 1EZ9A 2OWSA 3OOAA 1Q35A 2V3QA 1QJMA 2CZLA 2AIXA 3CG3A 3VE1B 3Q27A 1P1QA 3CFZA 3LR1A 3KBRA 1NFTA 1YAEA 3S9MC 1FQDA 4BDOA 4FATA 5M2VA 3MUQA 1M5BA 3WAFA 3B6QA 3FVKA 4G2ZA 2REJA 3S9LC 4HTGA 4KCCA 2X7QA 5TPAB 1B0LA 5KDTA 5FHNA 4OTEA 3TTRA 2I4BA 3C4MA 1MPCA 1MY2A 4NMYA 4YKKA 3LC8A 4JSOA 2DXYA 2XD3A 4Q30B 4YKJA 5AA2B 3B6TA 2Z8EA 1NH8A 4POWA 1A8FA 3KN8A 2UVIA 4RPOA 2QS1A 1LFIA 3CI8A 4AB5A 4RA1A 3A3CA 1B3HA 3ECRA 1TWYA 1VFDA 4EDPA 1L5TA 4H0WA 5KCJA 3PPNA 5KZTA 4LA9A 4QFNA 3MPKA 1TFAA 4OFOA 2ZYKA 3FJ7A 2F7AA 3O28A 1MXVA 1IEJA 2IA4A 4MH5A 4U2RA 5ITOA 1DOTA 3GBAA 1JETA 2Q89A 4EF2A 3H06B 3PD9A 4RXLA 1GR2A 1LB8A 2PBWA 3S2VA 4ECFA 3N5LA 4OHNA 1Y9UA 3CR9A 4KYDA 4MLVA 2HZKA 2QRYA 3C33A 4EF1A 3EHTA 2OWTA 4JBZA 4NF5B 3RT6B 3CRBA 1DPEA 2Q8JA 1VR5A 4JWXA 1P99A 3ONMA 5CM6A 1A7LA 2H98A 3IR1A 3U92A 1R9QA 4C1UA 2XX7A 3TEPA 3TZAA 1O63A 3VFJA 5I56A 2AL4A 1Y20A 4I9DA 1NMUA 4KPTA 4ND9A 2H25A 1EH3A 2NWJA 1UTBB 1WVJA 4OVJA 4O3BA 1B7HA 1PB8A 1SI1A 2O1MA 2HCAA 3PV0E 4U23A 4H5FA 3MBPA 1B7UA 5TP9A 1N3XA 2VD3A 1IXGA 1ZBMA 4F3SA 3OENA 4F39A 3OO7A 3TMGA 3IO4A 3IOWA 2OJTA 1MDP1 1LBCA 4U21A 5JK4A 2ESNA 2F36A 3PPOA 1FW0A 3N6UA 5HBCA 1I6BA 3FGSA 1A40A 3PMVA 3ZKKA 3RPWA 1WDNA 3I3VA 1M5FA 3O66A 4F29A 1OLCA 2PMSA 1ZU0A 3DM0A 4DDDA 2O1LA 1N3WA 4IO5A 1B5JA 3V5AA 3M3KA 4YZZA 4OESA 2REGA 2DP8A 4NF8A 1RYXA 2Z22A 4MFIA 1II5A 1M5CA 2XXWA 4R2BA 1ZMGA 4RJZA 4FIMA 3ZS6A 4X9TA 3FD3A 4ZEFA 3N94A 3UN6A 3K0VA 3CIJA 4IO3A 3RN8A 2G29A 3WAEA 3M3FA 1TT1A 4H67A 3VXBA 2ZNUA 5F1QA 1URSA 4QFOA 3H3GA 3TELA 1OLAA 3H6TA 4YB5A 2ONSA 3KGCA 2RC8A 3DLNA 4IGRA 1VSOA 3MZBA 1NNPA 5EYFA 3S4UA 5CMCA 1UTHA 3QYTA 3O6HA 4OENA 3DP4A 1QULA 1MG1A 3TODA 2RCBA 1KWHA 2DWHA 3JV9A 4GWOA 3MAMA 2XXVA 3H6UA 1IQ7A 3E4RA 3IK6B 4BLAA 4X48A 2R71A 4GFRA 3OO9A 1TXFA 1XVYA 2KLFA 1PB7A 1ZLQA 3KEIA 4BDMA 1QW0A 3OO6A 5TPAA 3TTNA 3B7DA 4LZ7A 1B05A 5JTYB 3T96B 2P2AA 4XKPA 4TLLB 5ITPA 3H6VA 1US4A 4N07A 4Z7EA 3MPLA 2E0SA 3K01A 5HM4B 2OCUA 4G4PA 2HEUA 3F11A 1URGA 3SEYA 1MQIA 3VV5A 1IIWA 5AA2A 3O6GA 1IXHA 2A5TB 1MH4A 1AIVA 4H65A 4PFUA 1ELJA 3EQ1A 1B5HA 4LUBA 5DTBA 2P1SA 1B4HA 3QSLA 1POY1 5FTHA 4Z0IA 2V84A 5H8FB 1DSNA 4RYAA 4GD5A 2XD2A 1USYH 4GL0A 4H8IA 1B6HA 4O3AA 1LAGE 2R6GE 1S50A 2Y7KA 1BIYA 4LQ5A 3S9EA 1FCKA 3VVFA 1SYIA 1FTMA 1MY1A 1B2HA 4YICA 4RK2A 5CRYA 5ELVA 2XXXA 3IO6A 4H1XA 1AOVA 4KYEA 1H43A 4K3FA 2PT1A 5AA1A 1MQDA 4F3PA 4QFLA 4F1UA 2A5SA 1MS7A 4I8CA 1I6AA 2CMOA 2Q2CA 2ZNSA 4HS7A 5IKBA 5I2KB 5EHMA 3MVYA 2PYYA 2H4IA 1PEBA 2QS4A 3TCFA 2OBGA 3KSXA 4Q0CA 2DSFA 1OQGA 4KHZE 1UTBA 1QKAA 3K6WA 2NUVA 5L9MA 2YLNA 3HSTA 4E0WA 1LCFA 4IY6A 2I3VA 3H03A 1N84A 1QVSA 4GIZA 3UP9A 4DXUA 2GHBA 2HAVA 1DPPA 4OETA 3T66A 2UVHA 1Y3NA 1P1OA 2O69A 3KN3A 1N7XA 4ZE8A 3TDJA 3I6VA 4XKQA 1LCTA 2DE4A 4JSDA 5L9SA 2OZZA 3SERA 3IX1A 3IB2A 4EQBA 2HFBA 2RC9A 2RINA 4QHQA 3Q29A 1ZKBA 4OQOA 1JNFA 2Y7IA 4EUOA 2F6PA 4XKRA 4F19A 2XXPA 3MZ1A 1M5DA 4TQUQ 4MLQA 4YB6A 2DE2A 1AL3A 3O29A 5CBSA 4EQ9A 1D4NA 2XXUA 2HXWA 3BFTA 3KJ7A 1XS5A 2XHDA 4I62A 3U72A 3C31A 4GL8A 3W9WA 2V93A 1NKXA 3HO7A 3M8UA 4YKIA 4RNSA 2D5WA 1HSJA 2DWIA 4U22A 4ELRA 3E3KA 1SBPA 3IAZA 3MP6A 1FQAA 1R9LA 3S9NC 1RYOA 1B3LA 4R6KA 1WODA 1MXXA 4ZE9A 3G7WA 4BDNA 1SQYA 4LQ2A 2H9BA 1UQWA 2I49A 2VHAA 4YMBA 3MZ9A 1IUDA 1PB9A 2XXHA 3DP6A 1B3FA 3TAJA 4M4GA 4R73A 1I69A 4DE8A 2PT2A 4ZEDA 2DQVA 4OFJA 3W15C 3N6TA 3PUXE 4H6DA 1MXUA 3OXNA 4LONB 3HV1A 4NWCA 4PETA 5JTYA 5EHSA 2I58A 4LZ8A 4NE4A 3Q25A 4RK9A 1T0KA 3RTWB 2ZNTA 4YKPA 3TPAA 2QJEA 4R75A 2RF1A 2A5TA 4KCDA 1NL5A 2G93A 2XXIA 2F6GA 5H8FA 3FVNA 4H5GA 3Q28A 1IZ1A 1OVTA 2ZMBA 1MY4A 3KJTA 3LSXA 2NOOA 3U93A 1Y3QA 2GHAA 2RCAA 1J1NA 5K2XA 2QMWA 3RQTA 3N26A 3VLVA 4U4XA 2VD2A 2VGQA 3IORA 2B3BA 2DOJA 4BDQA 3BFUA 1JVXA 5I2NB 1NH7A 1S9TA 5CMBA 3FV1A 1LB9A 1Y3PA 2DYXA 3GZGA 2YPNA 4ZEIA 1HSEA 3M3LA 4OXVA 4OWDA 4DIGA 3OO8A 2H5YA 4NF4B 3TCHA 1Q1KA 3G3JA 3R26A 2ZYNA 4IY5A 2VOZA 3FVOA 1OIBA 5I59B 3EPEA 4ZECA 1D3KA 2V3UA 1JW4A 4ELOA 5B7DA 5I2KA 3FVGA 2DWJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JZJ A;  3HHF A;  4YMA A;  1POT A;  4HCW A;  2Q9T A;  4PE5 B;  5FHM A;  3QK6 A;  3FIR A;  1LST A;  3FAT A;  2X7P A;  5I57 B;  5CC2 A;  4KFQ A;  3USD A;  4GXA A;  3T9U A;  5KDT B;  4G8M A;  4G68 B;  1MM7 A;  4ELQ A;  2BJJ X;  2W7Y A;  1I6Q A;  1OMP A;  3OD7 A;  4XTC Q;  4F22 A;  4YB7 A;  3IOU A;  1B4Z A;  3VVD A;  5CI5 A;  1NNK A;  3IB1 A;  3C34 A;  2UVG A;  4FE8 A;  4ZEK A;  1A99 A;  1US5 A;  4AB6 A;  1FQC A;  5L8D A;  1QUK A;  2F5X A;  1FQF A;  3PMX A;  1MPB A;  4F1Y A;  1MH3 A;  4LVQ A;  2O84 X;  4IB2 A;  3VVE A;  1F9B A;  2F34 A;  3CG1 A;  3K6X A;  2UYF A;  1XHY A;  5B70 A;  2XXQ A;  1R6Z A;  1LBB A;  3ILT B;  1TFD A;  4FJP A;  1QUJ A;  4TLM B;  2FYI A;  3KG2 A;  4R9G A;  4F1V A;  3OEM A;  2I0B A;  2Y7W A;  1MY0 A;  1MQG A;  1H44 A;  4EXK A;  5AA4 B;  1FTK A;  2Y84 A;  4G8H A;  3OSR A;  3T9X B;  4XXU A;  2ONK E;  3QUF A;  4ZS9 A;  2HZL A;  4TOZ A;  5H8N B;  1B52 A;  1GV8 A;  2ANJ A;  1Y4C A;  4BDR A;  3GLB A;  3TYH A;  2F7B A;  4JXI A;  3THI A;  4ZZE A;  1B1H A;  4JWY A;  3AXF A;  4F31 B;  4P0I A;  4R6H A;  4GRK A;  1B1X A;  4X1B A;  3RGY A;  4OER A;  2HAU A;  3KFM A;  3C35 A;  3V89 B;  2QS2 A;  1NNF A;  4F2Q A;  3DP8 A;  2YJP A;  5HPQ A;  4FAJ A;  1B40 A;  1JQF A;  2RC7 A;  1A55 A;  1B0H A;  3K1M A;  3EF7 A;  4HCY A;  1PBP A;  4F2O A;  1FQE A;  2Y7R A;  5ICT A;  1MM6 A;  3ZSF A;  4ZDM A;  3PPR A;  3TQL A;  5DVI A;  3EHU A;  5TP9 B;  2NXO A;  1EZO A;  1SW4 A;  4P11 A;  3IOT A;  1UIU A;  1M5E A;  2QPQ A;  3FJM A;  3MVW A;  1LAX A;  1UIV A;  4C0R A;  3SDF A;  4R74 A;  3MJN A;  4NF5 A;  1LLS A;  1R1N A;  4LAT A;  3KOT A;  3C36 A;  1GTK A;  2O6A A;  3MW0 A;  3D4G A;  5FHO A;  3UGW A;  3DEL B;  1FTO A;  2GRV A;  1N0T A;  3I5O A;  3RT8 A;  2M8C A;  3FUZ A;  4R9F A;  1BKA A;  4NF8 B;  3K6V A;  4Q8R A;  3FV2 A;  4THI A;  4UAC A;  2QMX A;  2XXT A;  1B46 A;  1JEV A;  1B51 A;  4DZ1 A;  1P1N A;  1B58 A;  2UYE A;  3Q26 A;  5H8H B;  3G3F A;  1ZJL A;  5I2N A;  1PBQ A;  3G3H A;  4KR5 A;  3PUZ E;  4WXJ A;  1DMB A;  2ZXT A;  3BKI B;  4MF3 A;  3MP1 A;  1NNT A;  3VXC A;  4GQO A;  1DTG A;  3LSF B;  1LAF E;  4R72 A;  4KYS A;  3V8X B;  5CMM A;  3PGF A;  2P0S A;  1ANF A;  1N04 A;  4IO4 A;  3K2D A;  4IO6 A;  4XIG Q;  4WEP A;  3TUS A;  5I59 A;  1UTH B;  5ISU A;  3O97 A;  5TU0 A;  1SI0 A;  2Y7P A;  3TKD A;  2OLB A;  5AE4 A;  3RUM A;  1MDQ A;  1N76 A;  1VE4 A;  3OEK A;  2B65 A;  1RKM A;  5ICQ A;  3T9H B;  4E0X A;  3V83 A;  4RY1 A;  3VDF A;  4FEB A;  3HN0 A;  4FEC A;  4H8J A;  3OEL A;  3FXR A;  3PD8 A;  3HPI A;  2DXR A;  5I57 A;  2IEE A;  4X1D A;  1Z7N E;  1H3D A;  3TTK A;  2Z8F A;  1SW5 A;  2F7C A;  3TCG A;  3OMB A;  5DVJ A;  4G68 A;  1MPD A;  4DXB A;  1FQB A;  4OMB A;  4QFP A;  1ZTY A;  3HHG A;  2GFE A;  3MVX A;  4GOT A;  4HW8 A;  2XXY A;  1HSL A;  5H8Q B;  2PVU A;  2V25 A;  5L9O A;  3RY3 A;  4DCY A;  2F8D A;  1A54 A;  2THI A;  2F97 A;  3K1P A;  5DEX B;  3MQ9 A;  2ZYM A;  1FTJ A;  4EXL A;  4RPN A;  3L6H A;  4P0G A;  4UA8 A;  4F18 A;  5A5X B;  5CBR A;  3JYR A;  1IXI A;  2XX9 A;  3B6W A;  4LZ5 A;  4DXC A;  4U1O A;  4NF6 B;  3CFX A;  1EZP A;  1MQJ A;  4F3G A;  1CE2 A;  4Q5T A;  1H45 A;  2QS3 A;  1B3G A;  1P1U A;  1SYH A;  3RTF B;  1GGG A;  3CFL A;  4ESX A;  3OSQ A;  1B5I A;  2R9J A;  2HQ0 A;  3W9V A;  5AA4 A;  2X26 A;  4G68 C;  3GXA A;  1P1W A;  3IL1 B;  2F78 A;  3SEW A;  1OVB A;  1S7Y A;  3G3K A;  3FXQ A;  5H8N A;  2D21 A;  1SD3 A;  2Q88 A;  4OEU A;  1QKB A;  5BWJ A;  3ODB A;  3HCQ A;  4QF9 A;  1EU8 A;  1O64 A;  1B9J A;  5DYH A;  1N7W A;  4YU0 A;  1PDA A;  4OZ9 A;  4DCX A;  1IIT A;  2O7U A;  4G8N A;  3IJX B;  2DS9 A;  2O68 A;  2ABH A;  3U8Q A;  3LSL A;  4GVO A;  2ONR A;  4POX A;  4GLI A;  1PC3 A;  3EN3 A;  4N13 A;  1CB6 A;  3KN7 A;  4ZZA A;  4FOR A;  5J1D A;  3SEU A;  3MC2 A;  2DVC A;  1JW5 A;  1SW1 A;  1Y4T A;  3A09 A;  1B7Z A;  2I6E A;  4U4S A;  4QFK A;  4FED A;  4GXS B;  5I58 B;  3PMW A;  4PFY A;  1USY E;  4G77 A;  4XKN A;  1LFH A;  3QIM A;  1MRP A;  3C9H A;  3TQW A;  4LP2 B;  2F35 A;  3PUW E;  3E13 X;  4PFT A;  1B3E A;  3K1N A;  4JB7 A;  1XC1 A;  3IB0 A;  5CMK A;  2WKY A;  3BBR A;  1URD A;  4OFL A;  5BUU A;  1ZIU A;  3PPQ A;  2LAO A;  1Z7M E;  4NWD A;  1GVC A;  1MY3 A;  4QRZ A;  3KZG A;  3SKP A;  3T93 B;  4ISU A;  3T22 A;  2XXR A;  3CVG A;  4BDL A;  2E1S A;  1BP5 A;  4OYV A;  3A3U A;  5H8S A;  1Y1M A;  5H8H A;  3O2A A;  4QSC A;  3KOS A;  4GF8 A;  4WKM A;  3VLW A;  4I1D A;  1D9V A;  5IAI A;  4R6Y A;  1SW2 A;  3LSW A;  4ESW A;  1LGB C;  3K6U A;  3CSG A;  3P7I A;  3VLU A;  3CSB A;  3IJO B;  3SES A;  4NTL A;  1ATG A;  3R7X A;  3QXM A;  2Q2A A;  2DE3 A;  4ONY A;  3LUY A;  1Y1Z A;  3L6G A;  4YAH X;  5AA2 D;  4M1V A;  1SVX B;  2Z23 A;  2UVJ A;  1LAH E;  5KCJ B;  3C32 A;  1O7T A;  3FJG A;  5F7V A;  3GBB A;  3MWB A;  4MBP A;  4ZEB A;  2FNC A;  1XOC A;  1D9Y A;  3SET A;  3FZV A;  3K4U A;  2V3T A;  1JVY A;  4QSD A;  3SEX A;  1IXC A;  3K02 A;  2H99 A;  1FTL A;  2XX8 A;  2O51 A;  4ELP A;  3H6W A;  3IOV A;  2QL3 A;  3G3G A;  1JW1 A;  3RLF E;  2I3W A;  1MQH A;  5H8Q A;  5FTI A;  1A8E A;  2ZYO A;  4QSE A;  3U1O A;  1YCJ A;  5DEX A;  2Z8D A;  4IO7 A;  5AA3 A;  3TFL A;  4NED A;  5I56 B;  3H7M A;  2RKM A;  5A5X A;  3RNN A;  4WED A;  4PFW A;  3ZKL A;  4NF6 A;  4R2F A;  1B32 A;  1AH5 A;  4O3C A;  1OQH A;  4U1Z A;  4AQ4 A;  3TTM A;  2ALU A;  3EHS A;  2O7I A;  4KQP A;  3FXU A;  4C1T A;  2OK2 A;  4PQJ A;  3MP8 A;  4EQ7 A;  2D3I A;  1YTV A;  3H4Z A;  3FAS A;  3UK4 A;  3U94 A;  1H76 A;  3UA8 A;  2FA7 A;  2AL5 A;  3PU5 A;  2NVU B;  1QUI A;  2UXA A;  3PPP A;  2GH9 A;  3QAX A;  3E9X A;  2I0C A;  1XT8 A;  5DVF A;  2B3F A;  1BLF A;  3O9P A;  3MVZ A;  3SEV A;  2QSX A;  4KI0 E;  3UIF A;  1BTJ A;  3ILU B;  3K00 A;  5LOM A;  3TTL A;  4F3B A;  3O6I A;  4JWO A;  2DVZ A;  1AMF A;  2DWA A;  4OEV A;  1SDX A;  2PX1 A;  1MXZ A;  4DLD A;  1VFE A;  5I84 A;  4IGT A;  3LBS A;  5JEI A;  3UOR A;  4PP0 A;  1MXW A;  3PUY E;  3QUJ A;  1LFG A;  4JDF A;  4KD5 A;  4N6P A;  1XVX A;  3T9V A;  2I4C A;  1DTZ A;  3KSJ A;  1MXY A;  3R6U A;  2AYS A;  2I48 A;  4IO2 A;  5I58 A;  3D4C A;  3G3I A;  5DT6 A;  2VP1 A;  4L17 A;  1YPN A;  4NF4 A;  3PUV E;  1JEU A;  5K2Y A;  1EZ9 A;  2OWS A;  3OOA A;  1Q35 A;  2V3Q A;  1QJM A;  2CZL A;  2AIX A;  3CG3 A;  3VE1 B;  3Q27 A;  1P1Q A;  3CFZ A;  3LR1 A;  3KBR A;  1NFT A;  1YAE A;  3S9M C;  1FQD A;  4BDO A;  4FAT A;  5M2V A;  3MUQ A;  1M5B A;  3WAF A;  3B6Q A;  3FVK A;  4G2Z A;  2REJ A;  3S9L C;  4HTG A;  4KCC A;  2X7Q A;  5TPA B;  1B0L A;  5KDT A;  5FHN A;  4OTE A;  3TTR A;  2I4B A;  3C4M A;  1MPC A;  1MY2 A;  4NMY A;  4YKK A;  3LC8 A;  4JSO A;  2DXY A;  2XD3 A;  4Q30 B;  4YKJ A;  5AA2 B;  3B6T A;  2Z8E A;  1NH8 A;  4POW A;  1A8F A;  3KN8 A;  2UVI A;  4RPO A;  2QS1 A;  1LFI A;  3CI8 A;  4AB5 A;  4RA1 A;  3A3C A;  1B3H A;  3ECR A;  1TWY A;  1VFD A;  4EDP A;  1L5T A;  4H0W A;  5KCJ A;  3PPN A;  5KZT A;  4LA9 A;  4QFN A;  3MPK A;  1TFA A;  4OFO A;  2ZYK A;  3FJ7 A;  2F7A A;  3O28 A;  1MXV A;  1IEJ A;  2IA4 A;  4MH5 A;  4U2R A;  5ITO A;  1DOT A;  3GBA A;  1JET A;  2Q89 A;  4EF2 A;  3H06 B;  3PD9 A;  4RXL A;  1GR2 A;  1LB8 A;  2PBW A;  3S2V A;  4ECF A;  3N5L A;  4OHN A;  1Y9U A;  3CR9 A;  4KYD A;  4MLV A;  2HZK A;  2QRY A;  3C33 A;  4EF1 A;  3EHT A;  2OWT A;  4JBZ A;  4NF5 B;  3RT6 B;  3CRB A;  1DPE A;  2Q8J A;  1VR5 A;  4JWX A;  1P99 A;  3ONM A;  5CM6 A;  1A7L A;  2H98 A;  3IR1 A;  3U92 A;  1R9Q A;  4C1U A;  2XX7 A;  3TEP A;  3TZA A;  1O63 A;  3VFJ A;  5I56 A;  2AL4 A;  1Y20 A;  4I9D A;  1NMU A;  4KPT A;  4ND9 A;  2H25 A;  1EH3 A;  2NWJ A;  1UTB B;  1WVJ A;  4OVJ A;  4O3B A;  1B7H A;  1PB8 A;  1SI1 A;  2O1M A;  2HCA A;  3PV0 E;  4U23 A;  4H5F A;  3MBP A;  1B7U A;  5TP9 A;  1N3X A;  2VD3 A;  1IXG A;  1ZBM A;  4F3S A;  3OEN A;  4F39 A;  3OO7 A;  3TMG A;  3IO4 A;  3IOW A;  2OJT A;  1MDP 1;  1LBC A;  4U21 A;  5JK4 A;  2ESN A;  2F36 A;  3PPO A;  1FW0 A;  3N6U A;  5HBC A;  1I6B A;  3FGS A;  1A40 A;  3PMV A;  3ZKK A;  3RPW A;  1WDN A;  3I3V A;  1M5F A;  3O66 A;  4F29 A;  1OLC A;  2PMS A;  1ZU0 A;  3DM0 A;  4DDD A;  2O1L A;  1N3W A;  4IO5 A;  1B5J A;  3V5A A;  3M3K A;  4YZZ A;  4OES A;  2REG A;  2DP8 A;  4NF8 A;  1RYX A;  2Z22 A;  4MFI A;  1II5 A;  1M5C A;  2XXW A;  4R2B A;  1ZMG A;  4RJZ A;  4FIM A;  3ZS6 A;  4X9T A;  3FD3 A;  4ZEF A;  3N94 A;  3UN6 A;  3K0V A;  3CIJ A;  4IO3 A;  3RN8 A;  2G29 A;  3WAE A;  3M3F A;  1TT1 A;  4H67 A;  3VXB A;  2ZNU A;  5F1Q A;  1URS A;  4QFO A;  3H3G A;  3TEL A;  1OLA A;  3H6T A;  4YB5 A;  2ONS A;  3KGC A;  2RC8 A;  3DLN A;  4IGR A;  1VSO A;  3MZB A;  1NNP A;  5EYF A;  3S4U A;  5CMC A;  1UTH A;  3QYT A;  3O6H A;  4OEN A;  3DP4 A;  1QUL A;  1MG1 A;  3TOD A;  2RCB A;  1KWH A;  2DWH A;  3JV9 A;  4GWO A;  3MAM A;  2XXV A;  3H6U A;  1IQ7 A;  3E4R A;  3IK6 B;  4BLA A;  4X48 A;  2R71 A;  4GFR A;  3OO9 A;  1TXF A;  1XVY A;  2KLF A;  1PB7 A;  1ZLQ A;  3KEI A;  4BDM A;  1QW0 A;  3OO6 A;  5TPA A;  3TTN A;  3B7D A;  4LZ7 A;  1B05 A;  5JTY B;  3T96 B;  2P2A A;  4XKP A;  4TLL B;  5ITP A;  3H6V A;  1US4 A;  4N07 A;  4Z7E A;  3MPL A;  2E0S A;  3K01 A;  5HM4 B;  2OCU A;  4G4P A;  2HEU A;  3F11 A;  1URG A;  3SEY A;  1MQI A;  3VV5 A;  1IIW A;  5AA2 A;  3O6G A;  1IXH A;  2A5T B;  1MH4 A;  1AIV A;  4H65 A;  4PFU A;  1ELJ A;  3EQ1 A;  1B5H A;  4LUB A;  5DTB A;  2P1S A;  1B4H A;  3QSL A;  1POY 1;  5FTH A;  4Z0I A;  2V84 A;  5H8F B;  1DSN A;  4RYA A;  4GD5 A;  2XD2 A;  1USY H;  4GL0 A;  4H8I A;  1B6H A;  4O3A A;  1LAG E;  2R6G E;  1S50 A;  2Y7K A;  1BIY A;  4LQ5 A;  3S9E A;  1FCK A;  3VVF A;  1SYI A;  1FTM A;  1MY1 A;  1B2H A;  4YIC A;  4RK2 A;  5CRY A;  5ELV A;  2XXX A;  3IO6 A;  4H1X A;  1AOV A;  4KYE A;  1H43 A;  4K3F A;  2PT1 A;  5AA1 A;  1MQD A;  4F3P A;  4QFL A;  4F1U A;  2A5S A;  1MS7 A;  4I8C A;  1I6A A;  2CMO A;  2Q2C A;  2ZNS A;  4HS7 A;  5IKB A;  5I2K B;  5EHM A;  3MVY A;  2PYY A;  2H4I A;  1PEB A;  2QS4 A;  3TCF A;  2OBG A;  3KSX A;  4Q0C A;  2DSF A;  1OQG A;  4KHZ E;  1UTB A;  1QKA A;  3K6W A;  2NUV A;  5L9M A;  2YLN A;  3HST A;  4E0W A;  1LCF A;  4IY6 A;  2I3V A;  3H03 A;  1N84 A;  1QVS A;  4GIZ A;  3UP9 A;  4DXU A;  2GHB A;  2HAV A;  1DPP A;  4OET A;  3T66 A;  2UVH A;  1Y3N A;  1P1O A;  2O69 A;  3KN3 A;  1N7X A;  4ZE8 A;  3TDJ A;  3I6V A;  4XKQ A;  1LCT A;  2DE4 A;  4JSD A;  5L9S A;  2OZZ A;  3SER A;  3IX1 A;  3IB2 A;  4EQB A;  2HFB A;  2RC9 A;  2RIN A;  4QHQ A;  3Q29 A;  1ZKB A;  4OQO A;  1JNF A;  2Y7I A;  4EUO A;  2F6P A;  4XKR A;  4F19 A;  2XXP A;  3MZ1 A;  1M5D A;  4TQU Q;  4MLQ A;  4YB6 A;  2DE2 A;  1AL3 A;  3O29 A;  5CBS A;  4EQ9 A;  1D4N A;  2XXU A;  2HXW A;  3BFT A;  3KJ7 A;  1XS5 A;  2XHD A;  4I62 A;  3U72 A;  3C31 A;  4GL8 A;  3W9W A;  2V93 A;  1NKX A;  3HO7 A;  3M8U A;  4YKI A;  4RNS A;  2D5W A;  1HSJ A;  2DWI A;  4U22 A;  4ELR A;  3E3K A;  1SBP A;  3IAZ A;  3MP6 A;  1FQA A;  1R9L A;  3S9N C;  1RYO A;  1B3L A;  4R6K A;  1WOD A;  1MXX A;  4ZE9 A;  3G7W A;  4BDN A;  1SQY A;  4LQ2 A;  2H9B A;  1UQW A;  2I49 A;  2VHA A;  4YMB A;  3MZ9 A;  1IUD A;  1PB9 A;  2XXH A;  3DP6 A;  1B3F A;  3TAJ A;  4M4G A;  4R73 A;  1I69 A;  4DE8 A;  2PT2 A;  4ZED A;  2DQV A;  4OFJ A;  3W15 C;  3N6T A;  3PUX E;  4H6D A;  1MXU A;  3OXN A;  4LON B;  3HV1 A;  4NWC A;  4PET A;  5JTY A;  5EHS A;  2I58 A;  4LZ8 A;  4NE4 A;  3Q25 A;  4RK9 A;  1T0K A;  3RTW B;  2ZNT A;  4YKP A;  3TPA A;  2QJE A;  4R75 A;  2RF1 A;  2A5T A;  4KCD A;  1NL5 A;  2G93 A;  2XXI A;  2F6G A;  5H8F A;  3FVN A;  4H5G A;  3Q28 A;  1IZ1 A;  1OVT A;  2ZMB A;  1MY4 A;  3KJT A;  3LSX A;  2NOO A;  3U93 A;  1Y3Q A;  2GHA A;  2RCA A;  1J1N A;  5K2X A;  2QMW A;  3RQT A;  3N26 A;  3VLV A;  4U4X A;  2VD2 A;  2VGQ A;  3IOR A;  2B3B A;  2DOJ A;  4BDQ A;  3BFU A;  1JVX A;  5I2N B;  1NH7 A;  1S9T A;  5CMB A;  3FV1 A;  1LB9 A;  1Y3P A;  2DYX A;  3GZG A;  2YPN A;  4ZEI A;  1HSE A;  3M3L A;  4OXV A;  4OWD A;  4DIG A;  3OO8 A;  2H5Y A;  4NF4 B;  3TCH A;  1Q1K A;  3G3J A;  3R26 A;  2ZYN A;  4IY5 A;  2VOZ A;  3FVO A;  1OIB A;  5I59 B;  3EPE A;  4ZEC A;  1D3K A;  2V3U A;  1JW4 A;  4ELO A;  5B7D A;  5I2K A;  3FVG A;  2DWJ A; 
#chains in the Genus database with same CATH topology
 3JZJ A;  3HHF A;  4YMA A;  1NI9 A;  1POT A;  4HCW A;  2Q9T A;  4PAK A;  4PE5 B;  5FHM A;  3QK6 A;  1FBF A;  3FIR A;  1LST A;  3FAT A;  1NUW A;  2X7P A;  4XEQ A;  5I57 B;  5CC2 A;  2Q8M A;  4KFQ A;  1KZ8 A;  4NHB A;  3USD A;  4GXA A;  3T9U A;  3A29 A;  5KDT B;  4G8M A;  4G68 B;  1MM7 A;  4MCO A;  4PFR A;  4ELQ A;  2BJJ X;  2W7Y A;  1I6Q A;  1OMP A;  3OD7 A;  4XTC Q;  4F22 A;  4YB7 A;  3IOU A;  1B4Z A;  1FPK A;  3VVD A;  5CI5 A;  4N4U A;  1NNK A;  3IB1 A;  3C34 A;  2UVG A;  4FE8 A;  4ZEK A;  1A99 A;  1US5 A;  4AB6 A;  1FQC A;  5L8D A;  1QUK A;  4MEV A;  2F5X A;  1FQF A;  3PMX A;  1FTA A;  1MPB A;  4F1Y A;  1MH3 A;  5FBP A;  4LVQ A;  2O84 X;  4IB2 A;  3VVE A;  2PCR A;  1F9B A;  2F34 A;  3CG1 A;  3K6X A;  5EYG A;  2UYF A;  2BJI A;  1XHY A;  2HHM A;  5B70 A;  4H46 A;  4MIJ A;  2XXQ A;  1R6Z A;  1LBB A;  1NV3 A;  3ILT B;  1TFD A;  4FJP A;  1QUJ A;  4TLM B;  2FYI A;  3KG2 A;  4R9G A;  2VPN A;  4F1V A;  3OEM A;  4O8M A;  2I0B A;  2Y7W A;  1MY0 A;  1MQG A;  1H44 A;  4EXK A;  1NUX A;  5AA4 B;  2CZH A;  1FTK A;  2Y84 A;  1JP4 A;  4G8H A;  3OSR A;  3T9X B;  4XXU A;  2ONK E;  3QUF A;  4ZS9 A;  2HZL A;  4TOZ A;  5H8N B;  1B52 A;  1GV8 A;  2ANJ A;  1Y4C A;  4BDR A;  3GLB A;  3TYH A;  5LTC A;  4OVQ A;  2F7B A;  4JXI A;  3THI A;  4ZZE A;  1B1H A;  4JWY A;  3AXF A;  4F31 B;  4P0I A;  4R6H A;  4GRK A;  1B1X A;  4X1B A;  3RGY A;  4OER A;  2HAU A;  3KFM A;  3C35 A;  3V89 B;  2QS2 A;  1NNF A;  4F2Q A;  3DP8 A;  2WX9 A;  2YJP A;  5HPQ A;  1NV7 A;  4FAJ A;  1B40 A;  1JQF A;  4OVR A;  2RC7 A;  1LEV A;  1A55 A;  4NGU A;  1B0H A;  3K1M A;  3EF7 A;  5IZ1 A;  2F3D A;  4HCY A;  4I3E A;  1PBP A;  4F2O A;  1FQE A;  2Y7R A;  5ICT A;  1MM6 A;  3ZSF A;  4ZDM A;  3PPR A;  3TQL A;  5DVI A;  4GWU A;  3E79 A;  3EHU A;  5TP9 B;  1G0H A;  2NXO A;  1EZO A;  1SW4 A;  4P11 A;  3IOT A;  1UIU A;  1M5E A;  2QPQ A;  3FJM A;  3MVW A;  1LAX A;  1UIV A;  4C0R A;  3SDF A;  4R74 A;  3MJN A;  4NF5 A;  1LLS A;  1R1N A;  4LAT A;  3KOT A;  3C36 A;  5DW8 A;  1GTK A;  2O6A A;  4P1E A;  3MW0 A;  3D4G A;  4XF5 A;  2WYP A;  2P3V A;  5FHO A;  3UGW A;  3DEL B;  1FTO A;  2GRV A;  1N0T A;  3I5O A;  3RT8 A;  2M8C A;  3FUZ A;  4R9F A;  1BKA A;  4NF8 B;  3K6V A;  4Q8R A;  4HE2 A;  3FV2 A;  4THI A;  4UAC A;  2QMX A;  2XXT A;  1B46 A;  1JEV A;  1B51 A;  4PC9 A;  4DZ1 A;  1P1N A;  2QVU A;  1B58 A;  2UYE A;  2XXK A;  3Q26 A;  5H8H B;  3G3F A;  1ZJL A;  2KQZ A;  5I2N A;  1PBQ A;  3G3H A;  4KR5 A;  3PUZ E;  4WXJ A;  1DMB A;  2ZXT A;  3BKI B;  4MF3 A;  3MP1 A;  1NNT A;  3VXC A;  4GQO A;  1DTG A;  3LSF B;  1LAF E;  4R72 A;  4KYS A;  3V8X B;  3SZP A;  5CMM A;  3PGF A;  2P0S A;  4HXV A;  1ANF A;  1N04 A;  3FXB A;  4IO4 A;  4GWW A;  3K2D A;  4IO6 A;  4PBQ A;  4XIG Q;  4WEP A;  3TUS A;  5I59 A;  4PAI A;  1UTH B;  5ISU A;  3O97 A;  1FPI A;  3RPL B;  2B4L A;  4NG7 A;  5TU0 A;  1SI0 A;  2Y7P A;  3TKD A;  2OLB A;  5AE4 A;  3RUM A;  1MDQ A;  1N76 A;  1VE4 A;  3OEK A;  2B65 A;  1RKM A;  4P56 A;  5ICQ A;  3T9H B;  4E0X A;  3V83 A;  4RY1 A;  3VDF A;  4FEB A;  3HN0 A;  4FEC A;  4H8J A;  3OEL A;  3FXR A;  4N8Y A;  3PD8 A;  3HPI A;  2DXR A;  5I57 A;  2IEE A;  4X1D A;  1Z7N E;  1H3D A;  3TTK A;  5ET7 A;  2Z8F A;  1SW5 A;  2F7C A;  3TCG A;  3OMB A;  2JJK A;  5DVJ A;  1FPG A;  4G68 A;  4PGN A;  1MPD A;  4DXB A;  1FQB A;  4OMB A;  4QFP A;  1ZTY A;  3HHG A;  2GFE A;  3MVX A;  4PGP A;  4GOT A;  4HW8 A;  2XXY A;  1HSL A;  5H8Q B;  2PVU A;  2V25 A;  5L9O A;  3RY3 A;  4DCY A;  2F8D A;  1A54 A;  2THI A;  2F97 A;  4MNP A;  3K1P A;  5DEX B;  2WEF A;  3MQ9 A;  2ZYM A;  1FTJ A;  4EXL A;  4RPN A;  3L6H A;  4P0G A;  4UA8 A;  4F18 A;  5A5X B;  5CBR A;  3JYR A;  1IXI A;  2XX9 A;  1FPL A;  3B6W A;  4LZ5 A;  4DXC A;  4U1O A;  4NF6 B;  1LBX A;  3CFX A;  1EZP A;  1MQJ A;  4F3G A;  1CE2 A;  1RDZ A;  4Q5T A;  1Q9D A;  3B8B A;  3MST A;  1H45 A;  2QS3 A;  1B3G A;  1NV1 A;  1FBC A;  1P1U A;  4GX3 A;  1SYH A;  3RTF B;  1GGG A;  4O7I A;  3CFL A;  4ESX A;  3OSQ A;  4I3Y A;  1B5I A;  2R9J A;  2HQ0 A;  3W9V A;  2B4M A;  5AA4 A;  2X26 A;  4G68 C;  3GXA A;  1P1W A;  3IL1 B;  2F78 A;  3SEW A;  4KXP A;  1OVB A;  4QBA A;  1S7Y A;  3G3K A;  3FXQ A;  5H8N A;  2D21 A;  1SD3 A;  2Q88 A;  4OEU A;  1QKB A;  5BWJ A;  3ODB A;  3HCQ A;  4QF9 A;  4O94 A;  1EU8 A;  1O64 A;  1B9J A;  5DYH A;  1N7W A;  4YU0 A;  4X04 A;  1PDA A;  4OZ9 A;  4DCX A;  1IIT A;  2O7U A;  1NV5 A;  4NN3 A;  4G8N A;  3IJX B;  2DS9 A;  2O68 A;  2ABH A;  3U8Q A;  3LSL A;  4GVO A;  2ONR A;  4POX A;  4GBW A;  4GLI A;  1PC3 A;  3EN3 A;  4N13 A;  5A5L A;  1CB6 A;  2F3B A;  3KN7 A;  4ZZA A;  4FOR A;  5J1D A;  3SEU A;  3MC2 A;  2DVC A;  4PAF A;  1JW5 A;  4MX6 A;  1SW1 A;  1Y4T A;  3A09 A;  1B7Z A;  2I6E A;  4U4S A;  4QFK A;  4FED A;  4GXS B;  5I58 B;  4X8R A;  3PMW A;  1NV0 A;  4PFY A;  1USY E;  4N8G A;  4G77 A;  4XKN A;  1LFH A;  3D1R A;  3QIM A;  1MRP A;  3C9H A;  3TQW A;  4LP2 B;  3LUZ A;  2FVZ A;  2F35 A;  3PUW E;  3E13 X;  2OWZ A;  1G0I A;  4PFT A;  1B3E A;  3K1N A;  4JB7 A;  1XC1 A;  3IB0 A;  5CMK A;  2WKY A;  3BBR A;  1URD A;  4OFL A;  1SPI A;  4PDD A;  5BUU A;  2HXR A;  1ZIU A;  5IZ3 B;  3PPQ A;  2LAO A;  1Z7M E;  4NWD A;  1GVC A;  1MY3 A;  4QRZ A;  4N91 A;  3KZG A;  3SKP A;  4PDH A;  3T93 B;  4ISU A;  3T22 A;  2XXR A;  4G61 A;  3CVG A;  4BDL A;  2E1S A;  1BP5 A;  4OYV A;  3KC1 A;  3A3U A;  2Q74 A;  4N6D A;  5H8S A;  1Y1M A;  5H8H A;  3O2A A;  4QSC A;  3KOS A;  4GF8 A;  4WKM A;  3VLW A;  4I1D A;  1D9V A;  5IAI A;  2QVR A;  1FBH A;  4R6Y A;  1SW2 A;  3LSW A;  4ESW A;  2QFL A;  1LGB C;  3K6U A;  3CSG A;  3P7I A;  3VLU A;  3CSB A;  3IJO B;  3SES A;  4NTL A;  1ATG A;  3R7X A;  3QXM A;  2Q2A A;  2DE3 A;  4ONY A;  3LUY A;  1LBZ A;  1Y1Z A;  3L6G A;  4YAH X;  5IZZ A;  5AA2 D;  3T0J A;  4M1V A;  1SVX B;  2Z23 A;  2UVJ A;  1LAH E;  3RPL A;  4PE3 A;  5KCJ B;  3C32 A;  1O7T A;  1FRP A;  3FJG A;  1QGX A;  5F7V A;  3GBB A;  3MWB A;  4MBP A;  4ZEB A;  2FNC A;  1XOC A;  1D9Y A;  3FZV A;  3SET A;  3K4U A;  2V3T A;  1JVY A;  4QSD A;  1LBW A;  3SEX A;  1IXC A;  1IME A;  3K02 A;  2H99 A;  1FTL A;  4GX6 A;  4N15 A;  2XX8 A;  4MNC A;  2O51 A;  4ELP A;  3H6W A;  3IOV A;  2QL3 A;  3G3G A;  1JW1 A;  3RLF E;  2I3W A;  1EYJ A;  5EYH A;  1MQH A;  5H8Q A;  5FTI A;  1A8E A;  2ZYO A;  4QSE A;  3U1O A;  2CZI A;  4GWS A;  1YCJ A;  5DEX A;  2Z8D A;  4IO7 A;  5AA3 A;  2HPG A;  3TFL A;  4NED A;  3B50 A;  5I56 B;  3H7M A;  2RKM A;  5A5X A;  2WBB A;  3RNN A;  4WED A;  4PFW A;  3ZKL A;  4NF6 A;  4R2F A;  1B32 A;  1AH5 A;  4O3C A;  1OQH A;  4U1Z A;  4AQ4 A;  3TTM A;  4DI4 B;  2QVV A;  2ALU A;  3EHS A;  2O7I A;  2MKZ A;  1NV2 A;  4KQP A;  3FXU A;  4C1T A;  2OK2 A;  4PQJ A;  2DDK A;  3MP8 A;  4EQ7 A;  2D3I A;  1YYZ A;  1YTV A;  3H4Z A;  3FAS A;  2VPO A;  3UK4 A;  3U94 A;  5ESY A;  1H76 A;  3UA8 A;  2CZK A;  2FA7 A;  2AL5 A;  3PU5 A;  2NVU B;  1QUI A;  3HFU A;  2UXA A;  4PCD A;  5LDZ A;  3PPP A;  2GH9 A;  1D9Q A;  3QAX A;  3E9X A;  2I0C A;  1XT8 A;  5DVF A;  1FSA A;  2B3F A;  1BLF A;  5ET8 A;  3O9P A;  3MVZ A;  3SEV A;  2QSX A;  5F24 A;  4KI0 E;  3UIF A;  4PTK A;  4JVD A;  1BTJ A;  3ILU B;  3K00 A;  5LOM A;  2WBD A;  4OVS A;  3TTL A;  4F3B A;  3O6I A;  4JWO A;  1FJ9 A;  2DVZ A;  1K9Y A;  1AMF A;  2DWA A;  4OEV A;  1SDX A;  2PX1 A;  1MXZ A;  4DLD A;  4P9K A;  1VFE A;  5I84 A;  4IGT A;  3LBS A;  5JEI A;  3UOR A;  4PP0 A;  1MXW A;  3PUY E;  3QUJ A;  1LFG A;  4JDF A;  4KD5 A;  4N6P A;  1XVX A;  3T9V A;  2I4C A;  1DTZ A;  3KSJ A;  1MXY A;  3R6U A;  2AYS A;  2I48 A;  4IO2 A;  3KC0 A;  5I58 A;  3D4C A;  3G3I A;  5DT6 A;  2VP1 A;  4PF8 A;  4L17 A;  1YPN A;  4NF4 A;  3PUV E;  1JEU A;  5K2Y A;  1EZ9 A;  2OWS A;  3OOA A;  1Q35 A;  2V3Q A;  1QJM A;  2CZL A;  2AIX A;  3CG3 A;  3VE1 B;  3LV0 A;  2CEY A;  3Q27 A;  1P1Q A;  3CFZ A;  3LR1 A;  3KBR A;  3BIH A;  1NFT A;  4HE1 A;  4UAB A;  1YAE A;  2FIX A;  3S9M C;  1FQD A;  4BDO A;  4FAT A;  1FPF A;  5M2V A;  3MUQ A;  5IZ3 A;  1M5B A;  1FBE A;  3WAF A;  2V4C A;  5I7I A;  1YZ0 A;  3B6Q A;  3FVK A;  4G2Z A;  2REJ A;  3S9L C;  4HTG A;  4KCC A;  2X7Q A;  5TPA B;  1B0L A;  5KDT A;  5FHN A;  3ROJ A;  4OTE A;  3TTR A;  2I4B A;  3C4M A;  1MPC A;  1MY2 A;  4NMY A;  4YKK A;  3LC8 A;  4JSO A;  2DXY A;  2XD3 A;  4Q30 B;  4YKJ A;  5AA2 B;  4LN5 A;  3B6T A;  2Z8E A;  5IGA A;  1NH8 A;  4POW A;  1A8F A;  3KN8 A;  2UVI A;  4PBH A;  4RPO A;  2FIE A;  2QS1 A;  2ZZW A;  1LFI A;  3CI8 A;  1FBG A;  4AB5 A;  4RA1 A;  4N17 A;  3A3C A;  1YXI A;  1B3H A;  3ECR A;  1TWY A;  1VFD A;  4EDP A;  1L5T A;  4H0W A;  3KBZ A;  5KCJ A;  3PPN A;  5KZT A;  4LA9 A;  4QFN A;  1FPE A;  3MPK A;  1TFA A;  4OFO A;  4IR8 A;  2ZYK A;  3FJ7 A;  2F7A A;  3O28 A;  3E78 A;  1MXV A;  1IEJ A;  3PTY A;  1XI6 A;  2IA4 A;  4MH5 A;  4U2R A;  5ITO A;  1DOT A;  3GBA A;  1JET A;  2Q89 A;  4EF2 A;  3H06 B;  3PD9 A;  4RXL A;  1GR2 A;  1LB8 A;  2PBW A;  3S2V A;  3NOH A;  4ECF A;  3N5L A;  4MNI A;  4OHN A;  1Y9U A;  3CR9 A;  4KYD A;  4MLV A;  2HZK A;  2QRY A;  3C33 A;  4EF1 A;  3EHT A;  2OWT A;  4JBZ A;  4NF5 B;  3RT6 B;  3CRB A;  1DPE A;  2Q8J A;  1VR5 A;  4GWZ A;  4JWX A;  1P99 A;  3ONM A;  5CM6 A;  1A7L A;  2H98 A;  3IR1 A;  3U92 A;  1R9Q A;  4C1U A;  2XX7 A;  3TEP A;  3TZA A;  1VDW A;  3EKI A;  1O63 A;  3VFJ A;  5I56 A;  2AL4 A;  1Y20 A;  4I9D A;  1RDY A;  1NMU A;  5EQ8 A;  4KPT A;  4ND9 A;  2H25 A;  1NV4 A;  1EH3 A;  2NWJ A;  1UTB B;  1WVJ A;  4OVJ A;  4O3B A;  4MJO A;  1B7H A;  4FBP A;  1PB8 A;  1SI1 A;  2O1M A;  2HCA A;  3PV0 E;  4U23 A;  3T1B A;  4H5F A;  3MBP A;  1B7U A;  5TP9 A;  1N3X A;  2VT5 A;  2VD3 A;  1IXG A;  1ZBM A;  4F3S A;  2PFY A;  3OEN A;  4F39 A;  3OO7 A;  3TMG A;  3IO4 A;  3IOW A;  2OJT A;  5EQA A;  1MDP 1;  4OAN A;  1RDX A;  1LBC A;  4U21 A;  5JK4 A;  2ESN A;  2F36 A;  3PPO A;  1FW0 A;  3N6U A;  2WYK A;  5HBC A;  1I6B A;  1DCU A;  3FGS A;  1A40 A;  3PMV A;  3ZKK A;  3RPW A;  1WDN A;  3I3V A;  1M5F A;  3O66 A;  4F29 A;  1OLC A;  4XFE A;  2PMS A;  1ZU0 A;  3DM0 A;  4DDD A;  2O1L A;  1N3W A;  1K9Z A;  4IO5 A;  1B5J A;  3V5A A;  3M3K A;  4YZZ A;  4OES A;  2REG A;  2DP8 A;  4NF8 A;  1RYX A;  2Z22 A;  4MFI A;  2R8T A;  1II5 A;  1M5C A;  2XXW A;  4R2B A;  1ZMG A;  1FPB A;  4RJZ A;  1DBZ A;  4FIM A;  3ZS6 A;  4X9T A;  3FD3 A;  4ZEF A;  3N94 A;  3UN6 A;  3K0V A;  4MMP A;  3CIJ A;  4IO3 A;  4JVC A;  3RN8 A;  2G29 A;  3WAE A;  3M3F A;  1TT1 A;  4H67 A;  3VXB A;  2ZNU A;  5F1Q A;  1URS A;  4QFO A;  3H3G A;  3TEL A;  1OLA A;  3H6T A;  4P3L A;  4YB5 A;  2ONS A;  2XWK A;  1BK4 A;  2Y5K A;  3RYD A;  3KGC A;  2RC8 A;  3DLN A;  4IGR A;  1VSO A;  3MZB A;  1NNP A;  4QXD A;  5EYF A;  3S4U A;  5CMC A;  1UTH A;  4NAP A;  3QYT A;  4HE0 A;  5ET5 A;  4DI3 D;  3O6H A;  4OEN A;  3DP4 A;  1QUL A;  1MG1 A;  3TOD A;  2RCB A;  5I5P A;  1KWH A;  2DWH A;  1FBP A;  3JV9 A;  4GWO A;  5J16 A;  3MAM A;  3ISP A;  1EYI A;  2XXV A;  3H6U A;  1IQ7 A;  3E4R A;  3IK6 B;  4BLA A;  1FPJ A;  4X48 A;  2R71 A;  4GFR A;  3OO9 A;  1TXF A;  1XVY A;  2KLF A;  1PB7 A;  1ZLQ A;  3KEI A;  4BDM A;  1QW0 A;  3OO6 A;  5TPA A;  1LBV A;  4N6K A;  3TTN A;  3B7D A;  4LZ7 A;  1B05 A;  5JTY B;  3T96 B;  2P2A A;  4XKP A;  4TLL B;  5ITP A;  3H6V A;  4N07 A;  1US4 A;  4MHF A;  4Z7E A;  3MPL A;  2E0S A;  3K01 A;  5HM4 B;  2OCU A;  4G4P A;  1NUZ A;  2HEU A;  3F11 A;  1URG A;  3SEY A;  1MQI A;  4JVI A;  3VV5 A;  1IIW A;  5AA2 A;  3O6G A;  1IXH A;  2A5T B;  1MH4 A;  1AIV A;  4H65 A;  4PFU A;  1ELJ A;  3EQ1 A;  1B5H A;  4LUB A;  5DTB A;  2P1S A;  4PFI A;  1B4H A;  3QSL A;  1POY 1;  5FTH A;  4Z0I A;  2V84 A;  5H8F B;  1DSN A;  4RYA A;  4GD5 A;  2XD2 A;  1USY H;  3QMF A;  4GL0 A;  4H8I A;  1B6H A;  1DK4 A;  4O3A A;  1LAG E;  2R6G E;  4GWX A;  1S50 A;  2Y7K A;  1BIY A;  4LQ5 A;  4OVP A;  3S9E A;  1FCK A;  4OA4 A;  3VVF A;  1SYI A;  1FTM A;  1MY1 A;  1B2H A;  4YIC A;  4RK2 A;  5CRY A;  4NF0 A;  2OX3 A;  5T3J A;  3MYU A;  5ELV A;  2XXX A;  3IO6 A;  5IM2 A;  4H1X A;  3CHG A;  1AOV A;  4KYE A;  1H43 A;  4K3F A;  2PT1 A;  5AA1 A;  1MQD A;  1LBY A;  4F3P A;  4QFL A;  4F1U A;  1FBD A;  3U65 A;  2A5S A;  1MS7 A;  4I8C A;  1I6A A;  2CMO A;  2Q2C A;  2ZNS A;  4HS7 A;  3GYY A;  5IKB A;  5I2K B;  1AWB A;  5EHM A;  2PFZ A;  1IMD A;  3MVY A;  2PYY A;  2H4I A;  2ZZX A;  1PEB A;  2QS4 A;  3TCF A;  2OBG A;  2XA5 A;  3KSX A;  4Q0C A;  2DSF A;  1OQG A;  4KHZ E;  1UTB A;  2KR0 A;  1QKA A;  3K6W A;  2NUV A;  5L9M A;  5EQ9 A;  2YLN A;  3HST A;  4PFB A;  4E0W A;  1LCF A;  4IY6 A;  2GQ1 A;  2I3V A;  3H03 A;  1KA0 A;  1N84 A;  1QVS A;  4GIZ A;  3UP9 A;  4DXU A;  2GHB A;  4O7M A;  2HAV A;  1DPP A;  4NX1 A;  4OET A;  3T66 A;  2UVH A;  1Y3N A;  1P1O A;  2O69 A;  3KN3 A;  1FPD A;  1IMF A;  2ZZV A;  1N7X A;  5I3S A;  4ZE8 A;  3TDJ A;  3I6V A;  4XKQ A;  1LCT A;  2DE4 A;  4JSD A;  5L9S A;  2OZZ A;  3SER A;  3IX1 A;  3IB2 A;  4EQB A;  2HFB A;  2RC9 A;  1INP A;  2RIN A;  4QHQ A;  3Q29 A;  1ZKB A;  4OQO A;  4NQ8 A;  1JNF A;  2Y7I A;  4EUO A;  2F6P A;  1NV6 A;  4XKR A;  4F19 A;  2XXP A;  3MZ1 A;  1M5D A;  4H45 A;  4TQU Q;  4MLQ A;  4YB6 A;  2DE2 A;  1AL3 A;  2XWO A;  3O29 A;  3IFA A;  4AS5 A;  5CBS A;  4GX4 A;  4EQ9 A;  1D4N A;  2XXU A;  2HXW A;  3BFT A;  3KJ7 A;  1XS5 A;  2XHD A;  4I62 A;  1IMC A;  3U72 A;  3C31 A;  4GL8 A;  3W9W A;  2V93 A;  4GBV A;  1NKX A;  3HO7 A;  2FHY A;  3M8U A;  4YKI A;  4RNS A;  2D5W A;  1HSJ A;  2DWI A;  4U22 A;  4ELR A;  3E3K A;  4N81 A;  2Y5L A;  1SBP A;  3IAZ A;  3MP6 A;  1FQA A;  1R9L A;  3S9N C;  1RYO A;  1B3L A;  4R6K A;  2P3N A;  1WOD A;  1MXX A;  4ZE9 A;  3G7W A;  4BDN A;  1SQY A;  4LQ2 A;  2H9B A;  1UQW A;  2I49 A;  2VHA A;  4YMB A;  3MZ9 A;  1IUD A;  1PB9 A;  2XXH A;  3DP6 A;  1FJ6 A;  1B3F A;  4GWY A;  3TAJ A;  4M4G A;  4R73 A;  1I69 A;  4DE8 A;  2PT2 A;  2FBP A;  3BIG A;  4ZED A;  2DQV A;  4OFJ A;  3W15 C;  3N6T A;  1KA1 A;  2XWI A;  1CNQ A;  3PUX E;  4H6D A;  1MXU A;  3OXN A;  4LON B;  3HV1 A;  4NWC A;  4PET A;  5JTY A;  5EHS A;  3FBP A;  2I58 A;  4LZ8 A;  4NE4 A;  3Q25 A;  4RK9 A;  1T0K A;  3RTW B;  2ZNT A;  4YKP A;  3TPA A;  2QJE A;  4R75 A;  2RF1 A;  2A5T A;  1IMB A;  4MAG A;  4KCD A;  4I40 A;  1NL5 A;  2G93 A;  2XXI A;  2F6G A;  5H8F A;  3FVN A;  2L5V A;  4H5G A;  3Q28 A;  1IZ1 A;  1OVT A;  2ZMB A;  1MY4 A;  5ET6 A;  3KJT A;  3LSX A;  2NOO A;  3U93 A;  1Y3Q A;  2GHA A;  2RCA A;  1J1N A;  5K2X A;  4OVT A;  4PF6 A;  2QMW A;  3RQT A;  3N26 A;  3VLV A;  4P47 A;  4U4X A;  2VD2 A;  2VGQ A;  3IOR A;  2B3B A;  2DOJ A;  4BDQ A;  3BFU A;  1EYK A;  1JVX A;  5I2N B;  2XWV A;  3IFC A;  1NH7 A;  1S9T A;  5CMB A;  3FV1 A;  1LB9 A;  1IMA A;  1Y3P A;  2DYX A;  3GZG A;  4AS4 A;  4P1L A;  2CEX A;  2YPN A;  4ZEI A;  1HSE A;  3M3L A;  4OXV A;  4OWD A;  5EQ7 A;  4DIG A;  3OO8 A;  2H5Y A;  4NF4 B;  3TCH A;  1Q1K A;  1NUY A;  3G3J A;  3R26 A;  2ZYN A;  4IY5 A;  2VOZ A;  3FVO A;  1OIB A;  5I59 B;  3EPE A;  4ZEC A;  1D3K A;  2V3U A;  4P8B A;  1JW4 A;  4ELO A;  5B7D A;  5I2K A;  3FVG A;  2DWJ A; 
#chains in the Genus database with same CATH homology
 3JZJ A;  3HHF A;  4YMA A;  1POT A;  4HCW A;  2Q9T A;  4PE5 B;  5FHM A;  3QK6 A;  3FIR A;  1LST A;  3FAT A;  2X7P A;  5I57 B;  5CC2 A;  4KFQ A;  3USD A;  4GXA A;  3T9U A;  5KDT B;  4G8M A;  4G68 B;  1MM7 A;  4ELQ A;  2BJJ X;  2W7Y A;  1I6Q A;  1OMP A;  3OD7 A;  4XTC Q;  4F22 A;  4YB7 A;  3IOU A;  1B4Z A;  3VVD A;  5CI5 A;  1NNK A;  3IB1 A;  3C34 A;  2UVG A;  4FE8 A;  4ZEK A;  1A99 A;  1US5 A;  4AB6 A;  1FQC A;  5L8D A;  1QUK A;  2F5X A;  1FQF A;  3PMX A;  1MPB A;  4F1Y A;  1MH3 A;  4LVQ A;  2O84 X;  4IB2 A;  3VVE A;  1F9B A;  2F34 A;  3CG1 A;  3K6X A;  2UYF A;  1XHY A;  5B70 A;  2XXQ A;  1R6Z A;  1LBB A;  3ILT B;  1TFD A;  4FJP A;  1QUJ A;  4TLM B;  2FYI A;  3KG2 A;  4R9G A;  4F1V A;  3OEM A;  2I0B A;  2Y7W A;  1MY0 A;  1MQG A;  1H44 A;  4EXK A;  5AA4 B;  1FTK A;  2Y84 A;  4G8H A;  3OSR A;  3T9X B;  4XXU A;  2ONK E;  3QUF A;  4ZS9 A;  2HZL A;  4TOZ A;  5H8N B;  1B52 A;  1GV8 A;  2ANJ A;  1Y4C A;  4BDR A;  3GLB A;  3TYH A;  2F7B A;  4JXI A;  3THI A;  4ZZE A;  1B1H A;  4JWY A;  3AXF A;  4F31 B;  4P0I A;  4R6H A;  4GRK A;  1B1X A;  4X1B A;  3RGY A;  4OER A;  2HAU A;  3KFM A;  3C35 A;  3V89 B;  2QS2 A;  1NNF A;  4F2Q A;  3DP8 A;  2YJP A;  5HPQ A;  4FAJ A;  1B40 A;  1JQF A;  2RC7 A;  1A55 A;  1B0H A;  3K1M A;  3EF7 A;  4HCY A;  1PBP A;  4F2O A;  1FQE A;  2Y7R A;  5ICT A;  1MM6 A;  3ZSF A;  4ZDM A;  3PPR A;  3TQL A;  5DVI A;  3EHU A;  5TP9 B;  2NXO A;  1EZO A;  1SW4 A;  4P11 A;  3IOT A;  1UIU A;  1M5E A;  2QPQ A;  3FJM A;  3MVW A;  1LAX A;  1UIV A;  4C0R A;  3SDF A;  4R74 A;  3MJN A;  4NF5 A;  1LLS A;  1R1N A;  4LAT A;  3KOT A;  3C36 A;  1GTK A;  2O6A A;  3MW0 A;  3D4G A;  5FHO A;  3UGW A;  3DEL B;  1FTO A;  2GRV A;  1N0T A;  3I5O A;  3RT8 A;  2M8C A;  3FUZ A;  4R9F A;  1BKA A;  4NF8 B;  3K6V A;  4Q8R A;  3FV2 A;  4THI A;  4UAC A;  2QMX A;  2XXT A;  1B46 A;  1JEV A;  1B51 A;  4DZ1 A;  1P1N A;  1B58 A;  2UYE A;  3Q26 A;  5H8H B;  3G3F A;  1ZJL A;  5I2N A;  1PBQ A;  3G3H A;  4KR5 A;  3PUZ E;  4WXJ A;  1DMB A;  2ZXT A;  3BKI B;  4MF3 A;  3MP1 A;  1NNT A;  3VXC A;  4GQO A;  1DTG A;  3LSF B;  1LAF E;  4R72 A;  4KYS A;  3V8X B;  5CMM A;  3PGF A;  2P0S A;  1ANF A;  1N04 A;  4IO4 A;  3K2D A;  4IO6 A;  4XIG Q;  4WEP A;  3TUS A;  5I59 A;  1UTH B;  5ISU A;  3O97 A;  5TU0 A;  1SI0 A;  2Y7P A;  3TKD A;  2OLB A;  5AE4 A;  3RUM A;  1MDQ A;  1N76 A;  1VE4 A;  3OEK A;  2B65 A;  1RKM A;  5ICQ A;  3T9H B;  4E0X A;  3V83 A;  4RY1 A;  3VDF A;  4FEB A;  3HN0 A;  4FEC A;  4H8J A;  3OEL A;  3FXR A;  3PD8 A;  3HPI A;  2DXR A;  5I57 A;  2IEE A;  4X1D A;  1Z7N E;  1H3D A;  3TTK A;  2Z8F A;  1SW5 A;  2F7C A;  3TCG A;  3OMB A;  5DVJ A;  4G68 A;  1MPD A;  4DXB A;  1FQB A;  4OMB A;  4QFP A;  1ZTY A;  3HHG A;  2GFE A;  3MVX A;  4GOT A;  4HW8 A;  2XXY A;  1HSL A;  5H8Q B;  2PVU A;  2V25 A;  5L9O A;  3RY3 A;  4DCY A;  2F8D A;  1A54 A;  2THI A;  2F97 A;  3K1P A;  5DEX B;  3MQ9 A;  2ZYM A;  1FTJ A;  4EXL A;  4RPN A;  3L6H A;  4P0G A;  4UA8 A;  4F18 A;  5A5X B;  5CBR A;  3JYR A;  1IXI A;  2XX9 A;  3B6W A;  4LZ5 A;  4DXC A;  4U1O A;  4NF6 B;  3CFX A;  1EZP A;  1MQJ A;  4F3G A;  1CE2 A;  4Q5T A;  1H45 A;  2QS3 A;  1B3G A;  1P1U A;  1SYH A;  3RTF B;  1GGG A;  3CFL A;  4ESX A;  3OSQ A;  1B5I A;  2R9J A;  2HQ0 A;  3W9V A;  5AA4 A;  2X26 A;  4G68 C;  3GXA A;  1P1W A;  3IL1 B;  2F78 A;  3SEW A;  1OVB A;  1S7Y A;  3G3K A;  3FXQ A;  5H8N A;  2D21 A;  1SD3 A;  2Q88 A;  4OEU A;  1QKB A;  5BWJ A;  3ODB A;  3HCQ A;  4QF9 A;  1EU8 A;  1O64 A;  1B9J A;  5DYH A;  1N7W A;  4YU0 A;  1PDA A;  4OZ9 A;  4DCX A;  1IIT A;  2O7U A;  4G8N A;  3IJX B;  2DS9 A;  2O68 A;  2ABH A;  3U8Q A;  3LSL A;  4GVO A;  2ONR A;  4POX A;  4GLI A;  1PC3 A;  3EN3 A;  4N13 A;  1CB6 A;  3KN7 A;  4ZZA A;  4FOR A;  5J1D A;  3SEU A;  3MC2 A;  2DVC A;  1JW5 A;  1SW1 A;  1Y4T A;  3A09 A;  1B7Z A;  2I6E A;  4U4S A;  4QFK A;  4FED A;  4GXS B;  5I58 B;  3PMW A;  4PFY A;  1USY E;  4G77 A;  4XKN A;  1LFH A;  3QIM A;  1MRP A;  3C9H A;  3TQW A;  4LP2 B;  2F35 A;  3PUW E;  3E13 X;  4PFT A;  1B3E A;  3K1N A;  4JB7 A;  1XC1 A;  3IB0 A;  5CMK A;  2WKY A;  3BBR A;  1URD A;  4OFL A;  5BUU A;  1ZIU A;  3PPQ A;  2LAO A;  1Z7M E;  4NWD A;  1GVC A;  1MY3 A;  4QRZ A;  3KZG A;  3SKP A;  3T93 B;  4ISU A;  3T22 A;  2XXR A;  3CVG A;  4BDL A;  2E1S A;  1BP5 A;  4OYV A;  3A3U A;  5H8S A;  1Y1M A;  5H8H A;  3O2A A;  4QSC A;  3KOS A;  4GF8 A;  4WKM A;  3VLW A;  4I1D A;  1D9V A;  5IAI A;  4R6Y A;  1SW2 A;  3LSW A;  4ESW A;  1LGB C;  3K6U A;  3CSG A;  3P7I A;  3VLU A;  3CSB A;  3IJO B;  3SES A;  4NTL A;  1ATG A;  3R7X A;  3QXM A;  2Q2A A;  2DE3 A;  4ONY A;  3LUY A;  1Y1Z A;  3L6G A;  4YAH X;  5AA2 D;  4M1V A;  1SVX B;  2Z23 A;  2UVJ A;  1LAH E;  5KCJ B;  3C32 A;  1O7T A;  3FJG A;  5F7V A;  3GBB A;  3MWB A;  4MBP A;  4ZEB A;  2FNC A;  1XOC A;  1D9Y A;  3SET A;  3FZV A;  3K4U A;  2V3T A;  1JVY A;  4QSD A;  3SEX A;  1IXC A;  3K02 A;  2H99 A;  1FTL A;  2XX8 A;  2O51 A;  4ELP A;  3H6W A;  3IOV A;  2QL3 A;  3G3G A;  1JW1 A;  3RLF E;  2I3W A;  1MQH A;  5H8Q A;  5FTI A;  1A8E A;  2ZYO A;  4QSE A;  3U1O A;  1YCJ A;  5DEX A;  2Z8D A;  4IO7 A;  5AA3 A;  3TFL A;  4NED A;  5I56 B;  3H7M A;  2RKM A;  5A5X A;  3RNN A;  4WED A;  4PFW A;  3ZKL A;  4NF6 A;  4R2F A;  1B32 A;  1AH5 A;  4O3C A;  1OQH A;  4U1Z A;  4AQ4 A;  3TTM A;  2ALU A;  3EHS A;  2O7I A;  4KQP A;  3FXU A;  4C1T A;  2OK2 A;  4PQJ A;  3MP8 A;  4EQ7 A;  2D3I A;  1YTV A;  3H4Z A;  3FAS A;  3UK4 A;  3U94 A;  1H76 A;  3UA8 A;  2FA7 A;  2AL5 A;  3PU5 A;  2NVU B;  1QUI A;  2UXA A;  3PPP A;  2GH9 A;  3QAX A;  3E9X A;  2I0C A;  1XT8 A;  5DVF A;  2B3F A;  1BLF A;  3O9P A;  3MVZ A;  3SEV A;  2QSX A;  4KI0 E;  3UIF A;  1BTJ A;  3ILU B;  3K00 A;  5LOM A;  3TTL A;  4F3B A;  3O6I A;  4JWO A;  2DVZ A;  1AMF A;  2DWA A;  4OEV A;  1SDX A;  2PX1 A;  1MXZ A;  4DLD A;  1VFE A;  5I84 A;  4IGT A;  3LBS A;  5JEI A;  3UOR A;  4PP0 A;  1MXW A;  3PUY E;  3QUJ A;  1LFG A;  4JDF A;  4KD5 A;  4N6P A;  1XVX A;  3T9V A;  2I4C A;  1DTZ A;  3KSJ A;  1MXY A;  3R6U A;  2AYS A;  2I48 A;  4IO2 A;  5I58 A;  3D4C A;  3G3I A;  5DT6 A;  2VP1 A;  4L17 A;  1YPN A;  4NF4 A;  3PUV E;  1JEU A;  5K2Y A;  1EZ9 A;  2OWS A;  3OOA A;  1Q35 A;  2V3Q A;  1QJM A;  2CZL A;  2AIX A;  3CG3 A;  3VE1 B;  3Q27 A;  1P1Q A;  3CFZ A;  3LR1 A;  3KBR A;  1NFT A;  1YAE A;  3S9M C;  1FQD A;  4BDO A;  4FAT A;  5M2V A;  3MUQ A;  1M5B A;  3WAF A;  3B6Q A;  3FVK A;  4G2Z A;  2REJ A;  3S9L C;  4HTG A;  4KCC A;  2X7Q A;  5TPA B;  1B0L A;  5KDT A;  5FHN A;  4OTE A;  3TTR A;  2I4B A;  3C4M A;  1MPC A;  1MY2 A;  4NMY A;  4YKK A;  3LC8 A;  4JSO A;  2DXY A;  2XD3 A;  4Q30 B;  4YKJ A;  5AA2 B;  3B6T A;  2Z8E A;  1NH8 A;  4POW A;  1A8F A;  3KN8 A;  2UVI A;  4RPO A;  2QS1 A;  1LFI A;  3CI8 A;  4AB5 A;  4RA1 A;  3A3C A;  1B3H A;  3ECR A;  1TWY A;  1VFD A;  4EDP A;  1L5T A;  4H0W A;  5KCJ A;  3PPN A;  5KZT A;  4LA9 A;  4QFN A;  3MPK A;  1TFA A;  4OFO A;  2ZYK A;  3FJ7 A;  2F7A A;  3O28 A;  1MXV A;  1IEJ A;  2IA4 A;  4MH5 A;  4U2R A;  5ITO A;  1DOT A;  3GBA A;  1JET A;  2Q89 A;  4EF2 A;  3H06 B;  3PD9 A;  4RXL A;  1GR2 A;  1LB8 A;  2PBW A;  3S2V A;  4ECF A;  3N5L A;  4OHN A;  1Y9U A;  3CR9 A;  4KYD A;  4MLV A;  2HZK A;  2QRY A;  3C33 A;  4EF1 A;  3EHT A;  2OWT A;  4JBZ A;  4NF5 B;  3RT6 B;  3CRB A;  1DPE A;  2Q8J A;  1VR5 A;  4JWX A;  1P99 A;  3ONM A;  5CM6 A;  1A7L A;  2H98 A;  3IR1 A;  3U92 A;  1R9Q A;  4C1U A;  2XX7 A;  3TEP A;  3TZA A;  1O63 A;  3VFJ A;  5I56 A;  2AL4 A;  1Y20 A;  4I9D A;  1NMU A;  4KPT A;  4ND9 A;  2H25 A;  1EH3 A;  2NWJ A;  1UTB B;  1WVJ A;  4OVJ A;  4O3B A;  1B7H A;  1PB8 A;  1SI1 A;  2O1M A;  2HCA A;  3PV0 E;  4U23 A;  4H5F A;  3MBP A;  1B7U A;  5TP9 A;  1N3X A;  2VD3 A;  1IXG A;  1ZBM A;  4F3S A;  3OEN A;  4F39 A;  3OO7 A;  3TMG A;  3IO4 A;  3IOW A;  2OJT A;  1MDP 1;  1LBC A;  4U21 A;  5JK4 A;  2ESN A;  2F36 A;  3PPO A;  1FW0 A;  3N6U A;  5HBC A;  1I6B A;  3FGS A;  1A40 A;  3PMV A;  3ZKK A;  3RPW A;  1WDN A;  3I3V A;  1M5F A;  3O66 A;  4F29 A;  1OLC A;  2PMS A;  1ZU0 A;  3DM0 A;  4DDD A;  2O1L A;  1N3W A;  4IO5 A;  1B5J A;  3V5A A;  3M3K A;  4YZZ A;  4OES A;  2REG A;  2DP8 A;  4NF8 A;  1RYX A;  2Z22 A;  4MFI A;  1II5 A;  1M5C A;  2XXW A;  4R2B A;  1ZMG A;  4RJZ A;  4FIM A;  3ZS6 A;  4X9T A;  3FD3 A;  4ZEF A;  3N94 A;  3UN6 A;  3K0V A;  3CIJ A;  4IO3 A;  3RN8 A;  2G29 A;  3WAE A;  3M3F A;  1TT1 A;  4H67 A;  3VXB A;  2ZNU A;  5F1Q A;  1URS A;  4QFO A;  3H3G A;  3TEL A;  1OLA A;  3H6T A;  4YB5 A;  2ONS A;  3KGC A;  2RC8 A;  3DLN A;  4IGR A;  1VSO A;  3MZB A;  1NNP A;  5EYF A;  3S4U A;  5CMC A;  1UTH A;  3QYT A;  3O6H A;  4OEN A;  3DP4 A;  1QUL A;  1MG1 A;  3TOD A;  2RCB A;  1KWH A;  2DWH A;  3JV9 A;  4GWO A;  3MAM A;  2XXV A;  3H6U A;  1IQ7 A;  3E4R A;  3IK6 B;  4BLA A;  4X48 A;  2R71 A;  4GFR A;  3OO9 A;  1TXF A;  1XVY A;  2KLF A;  1PB7 A;  1ZLQ A;  3KEI A;  4BDM A;  1QW0 A;  3OO6 A;  5TPA A;  3TTN A;  3B7D A;  4LZ7 A;  1B05 A;  5JTY B;  3T96 B;  2P2A A;  4XKP A;  4TLL B;  5ITP A;  3H6V A;  1US4 A;  4N07 A;  4Z7E A;  3MPL A;  2E0S A;  3K01 A;  5HM4 B;  2OCU A;  4G4P A;  2HEU A;  3F11 A;  1URG A;  3SEY A;  1MQI A;  3VV5 A;  1IIW A;  5AA2 A;  3O6G A;  1IXH A;  2A5T B;  1MH4 A;  1AIV A;  4H65 A;  4PFU A;  1ELJ A;  3EQ1 A;  1B5H A;  4LUB A;  5DTB A;  2P1S A;  1B4H A;  3QSL A;  1POY 1;  5FTH A;  4Z0I A;  2V84 A;  5H8F B;  1DSN A;  4RYA A;  4GD5 A;  2XD2 A;  1USY H;  4GL0 A;  4H8I A;  1B6H A;  4O3A A;  1LAG E;  2R6G E;  1S50 A;  2Y7K A;  1BIY A;  4LQ5 A;  3S9E A;  1FCK A;  3VVF A;  1SYI A;  1FTM A;  1MY1 A;  1B2H A;  4YIC A;  4RK2 A;  5CRY A;  5ELV A;  2XXX A;  3IO6 A;  4H1X A;  1AOV A;  4KYE A;  1H43 A;  4K3F A;  2PT1 A;  5AA1 A;  1MQD A;  4F3P A;  4QFL A;  4F1U A;  2A5S A;  1MS7 A;  4I8C A;  1I6A A;  2CMO A;  2Q2C A;  2ZNS A;  4HS7 A;  5IKB A;  5I2K B;  5EHM A;  3MVY A;  2PYY A;  2H4I A;  1PEB A;  2QS4 A;  3TCF A;  2OBG A;  3KSX A;  4Q0C A;  2DSF A;  1OQG A;  4KHZ E;  1UTB A;  1QKA A;  3K6W A;  2NUV A;  5L9M A;  2YLN A;  3HST A;  4E0W A;  1LCF A;  4IY6 A;  2I3V A;  3H03 A;  1N84 A;  1QVS A;  4GIZ A;  3UP9 A;  4DXU A;  2GHB A;  2HAV A;  1DPP A;  4OET A;  3T66 A;  2UVH A;  1Y3N A;  1P1O A;  2O69 A;  3KN3 A;  1N7X A;  4ZE8 A;  3TDJ A;  3I6V A;  4XKQ A;  1LCT A;  2DE4 A;  4JSD A;  5L9S A;  2OZZ A;  3SER A;  3IX1 A;  3IB2 A;  4EQB A;  2HFB A;  2RC9 A;  2RIN A;  4QHQ A;  3Q29 A;  1ZKB A;  4OQO A;  1JNF A;  2Y7I A;  4EUO A;  2F6P A;  4XKR A;  4F19 A;  2XXP A;  3MZ1 A;  1M5D A;  4TQU Q;  4MLQ A;  4YB6 A;  2DE2 A;  1AL3 A;  3O29 A;  5CBS A;  4EQ9 A;  1D4N A;  2XXU A;  2HXW A;  3BFT A;  3KJ7 A;  1XS5 A;  2XHD A;  4I62 A;  3U72 A;  3C31 A;  4GL8 A;  3W9W A;  2V93 A;  1NKX A;  3HO7 A;  3M8U A;  4YKI A;  4RNS A;  2D5W A;  1HSJ A;  2DWI A;  4U22 A;  4ELR A;  3E3K A;  1SBP A;  3IAZ A;  3MP6 A;  1FQA A;  1R9L A;  3S9N C;  1RYO A;  1B3L A;  4R6K A;  1WOD A;  1MXX A;  4ZE9 A;  3G7W A;  4BDN A;  1SQY A;  4LQ2 A;  2H9B A;  1UQW A;  2I49 A;  2VHA A;  4YMB A;  3MZ9 A;  1IUD A;  1PB9 A;  2XXH A;  3DP6 A;  1B3F A;  3TAJ A;  4M4G A;  4R73 A;  1I69 A;  4DE8 A;  2PT2 A;  4ZED A;  2DQV A;  4OFJ A;  3W15 C;  3N6T A;  3PUX E;  4H6D A;  1MXU A;  3OXN A;  4LON B;  3HV1 A;  4NWC A;  4PET A;  5JTY A;  5EHS A;  2I58 A;  4LZ8 A;  4NE4 A;  3Q25 A;  4RK9 A;  1T0K A;  3RTW B;  2ZNT A;  4YKP A;  3TPA A;  2QJE A;  4R75 A;  2RF1 A;  2A5T A;  4KCD A;  1NL5 A;  2G93 A;  2XXI A;  2F6G A;  5H8F A;  3FVN A;  4H5G A;  3Q28 A;  1IZ1 A;  1OVT A;  2ZMB A;  1MY4 A;  3KJT A;  3LSX A;  2NOO A;  3U93 A;  1Y3Q A;  2GHA A;  2RCA A;  1J1N A;  5K2X A;  2QMW A;  3RQT A;  3N26 A;  3VLV A;  4U4X A;  2VD2 A;  2VGQ A;  3IOR A;  2B3B A;  2DOJ A;  4BDQ A;  3BFU A;  1JVX A;  5I2N B;  1NH7 A;  1S9T A;  5CMB A;  3FV1 A;  1LB9 A;  1Y3P A;  2DYX A;  3GZG A;  2YPN A;  4ZEI A;  1HSE A;  3M3L A;  4OXV A;  4OWD A;  4DIG A;  3OO8 A;  2H5Y A;  4NF4 B;  3TCH A;  1Q1K A;  3G3J A;  3R26 A;  2ZYN A;  4IY5 A;  2VOZ A;  3FVO A;  1OIB A;  5I59 B;  3EPE A;  4ZEC A;  1D3K A;  2V3U A;  1JW4 A;  4ELO A;  5B7D A;  5I2K A;  3FVG A;  2DWJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...