3CFZA

Crystal structure of m. jannaschii periplasmic binding protein moda/wtpa with bound tungstate
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
289
structure length
289
Chain Sequence
KIVLKIFHAGSLSVPFEEYEKMFEKEHPNVDVEREPAGSVACVRKIIDLGKKADILASADYSLIPQMMMPKYADWYVMFARNEIVLAYTDKSKYKDEINSTNWYKILQRPDVKIGFSNPNDDPCGYRTQMVLQLAELYYKDPTIYDNLVLKHSNIKVEENNGTYLILVPKELDVDTNKLFVRSKETDLLAPLEAGAFDYLFIYKSVANQHHLKYIELPKEINLGYYEYADTYKKVALKIIAKNKTINAKPIVYGMTVPTNAPHKKEAIEFVKFVLGHPEVLENNGQPAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distorted octahedral coordination of tungstate in a subfamily of specific binding proteins.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transport protein
molecule keywords UPF0100 protein MJ1186
total genus 97
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 2008-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3cfzA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3cfzA02
2F35A 4OHNA 3FVNA 2RCAA 2XHDA 4FEBA 3KN3A 3SEUA 2AL4A 4WEPA 4DCYA 4GFRA 1B05A 1TFAA 3TQLA 1EH3A 1DTGA 1TT1A 3CVGA 3E3KA 2F34A 3G3IA 3OELA 3R26A 4RK9A 1VFDA 4RPOA 1BLFA 1MQGA 1P1NA 4EQ9A 5I57B 5KZTA 1T0KA 1OQGA 2QL3A 4FAJA 1SDXA 2I0BA 1IXHA 1US4A 1MY0A 5B7DA 3THIA 3KEIA 1B7HA 4UACA 4KYEA 4C1UA 1B1XA 3FIRA 3FJGA 4E0XA 3H6UA 2VGQA 5I2NB 3JZJA 1QW0A 3IR1A 5KDTB 1B32A 3TEPA 3Q29A 4NF5B 1ZBMA 3QSLA 4U21A 1A8FA 3LSLA 4YZZA 1B6HA 3SERA 3Q28A 2RINA 4POXA 3K6VA 2V25A 2XXQA 3KSJA 3MZ1A 5H8HA 1LBCA 3OXNA 1XC1A 3M8UA 4QFKA 1H3DA 3IJOB 2QS3A 2O7UA 3OSQA 3G3GA 4OVJA 3IOWA 2QMWA 4PETA 3E9XA 3U1OA 1NNKA 3MP8A 2Q88A 1PDAA 2P2AA 2OZZA 1ZJLA 3TAJA 5EHSA 4O3BA 1S7YA 1B0HA 3E4RA 3G3KA 2NXOA 4IO3A 2NWJA 1A54A 3PPNA 3Q25A 4GVOA 4ZEDA 1TXFA 5CMCA 1MQDA 1AH5A 3KSXA 4Q30B 1N7WA 4G8MA 2PVUA 4Q0CA 1VFEA 5L9MA 1FQBA 1BP5A 1N04A 4RA1A 1SI1A 4NF5A 1DPEA 1WVJA 3A3UA 4LQ2A 2ANJA 5H8NB 3GBBA 2Y7IA 4P0GA 1OVBA 3H6WA 3QK6A 5H8NA 3FVGA 5I58A 4H67A 1QUJA 2G29A 2Z8EA 3K1PA 4G68C 4NF6B 4NMYA 4G8NA 5AA4A 1ZU0A 1GGGA 2HXWA 2F6PA 1WDNA 3IO6A 4IY5A 3D4CA 4XTCQ 4C0RA 3RTFB 3UP9A 4R2BA 3KFMA 3BFTA 3O2AA 3B6TA 3C31A 1B1HA 2DE3A 2Q2AA 4JDFA 1RYOA 1SW2A 3E13X 4I9DA 4THIA 1SW5A 4YB6A 3MJNA 3T9XB 4ELRA 4EUOA 1BTJA 4ZEIA 3IJXB 4P11A 2IEEA 2XX7A 2Y7WA 2ZXTA 5I2KB 5HPQA 5I2KA 5KCJA 2O6AA 4KYSA 4OQOA 4F1VA 1EZPA 2DS9A 5H8SA 3SEWA 5A5XB 4G2ZA 3V5AA 2F7BA 1LFIA 4IY6A 1MS7A 3RNNA 4F22A 3O9PA 1QJMA 4ZZAA 1O7TA 3RTWB 3GLBA 2GH9A 3RUMA 2QS1A 4XXUA 1B58A 4BDRA 3UK4A 3OO7A 1NNTA 4G4PA 4PFWA 4F2OA 4F3BA 4NF6A 3U93A 3M3KA 2Z23A 5TPAB 4F2QA 2V84A 4U4XA 1LAHE 1NKXA 2R6GE 2QJEA 2I3VA 4R9GA 4HW8A 2E1SA 3PV0E 3T9UA 3PD9A 5L9OA 2XD2A 2Y7RA 5CMKA 2XXHA 5ELVA 5ICTA 4XKNA 1CB6A 1N0TA 5H8FB 4G8HA 3TELA 4JB7A 2UYEA 4BDOA 1MQJA 3KN8A 3CR9A 5KCJB 2Y7PA 4KQPA 4R6YA 4ISUA 3TDJA 3HO7A 1HSJA 4GQOA 3U72A 4Z7EA 2UYFA 2RF1A 1B5JA 2VD2A 2ZYOA 4MBPA 4X9TA 1MQIA 2XX8A 1ZMGA 3LSWA 4KPTA 1LCTA 2VHAA 3FV1A 4ELQA 3IB0A 3OEKA 3W9WA 3N6UA 2XXUA 1NFTA 3H03A 5I56B 2XXIA 4KHZE 4LZ8A 3GBAA 3RPWA 1M5EA 1HSEA 2QMXA 2UVIA 3MZBA 3MC2A 3CSBA 2YJPA 3K00A 3DP8A 3GZGA 4NF8A 4YICA 3IB2A 1XT8A 4PE5B 4QRZA 5K2XA 1M5CA 4H5GA 4F3SA 2VP1A 2PX1A 4GRKA 4OFLA 1MM6A 4RNSA 1H45A 1SYIA 1Y3PA 2F5XA 1B9JA 2DWHA 2OK2A 3O66A 4OERA 4RYAA 3W15C 1I6BA 4GOTA 2X26A 3C36A 4FATA 4ZECA 2UVGA 3UORA 4UA8A 3PD8A 3C33A 4R6HA 1F9BA 3C9HA 2I48A 1QKBA 4U1OA 3UIFA 4OFJA 2QSXA 3VE1B 1PB8A 1A55A 4YB7A 5IAIA 1RKMA 1LAFE 1MXYA 2HEUA 2RC7A 4QFPA 2X7QA 4G68A 5AA3A 4F1UA 2F7CA 4IGTA 4ZZEA 3I5OA 1YCJA 4IO4A 1A8EA 1N3XA 1LLSA 3EPEA 1JW5A 2F8DA 4WKMA 1B3LA 3ILUB 3MBPA 3SKPA 4NF8B 3O28A 3B7DA 1N7XA 3GXAA 1SW1A 3KOTA 2OJTA 2A5TA 2ESNA 2D21A 2UVJA 1ATGA 4KCCA 4RK2A 1HSLA 1OVTA 4MF3A 4R72A 4XKQA 5CMBA 1H76A 2F36A 3PMWA 1O64A 4O3AA 4OXVA 1ZKBA 1UTHA 1UIVA 3DM0A 3OD7A 2VOZA 4BDNA 3O97A 4AB6A 2UXAA 2DVZA 1AIVA 1LFHA 3TPAA 2REJA 2IA4A 2Y7KA 4OZ9A 1Z7ME 2H5YA 3TCGA 3EHSA 4R73A 4AB5A 4DXUA 1M5BA 1PC3A 2F97A 3ODBA 3VVDA 3FD3A 1B4HA 1MY1A 4R74A 3ZKKA 3T93B 1OLCA 4EQBA 3PPPA 2RC9A 3MPKA 3T96B 4R9FA 3TTMA 5AA1A 3K6XA 3PUYE 3HPIA 5AA4B 3KZGA 1H44A 1XOCA 1XVXA 2XXXA 1B40A 3O6GA 4K3FA 3ZSFA 3PMXA 4QSCA 1DSNA 2FA7A 2O84X 4ECFA 3RT6B 3JV9A 4JWYA 4LP2B 4NEDA 4POWA 1GV8A 2NUVA 5DT6A 3MQ9A 1Q1KA 2UVHA 2XX9A 3M3LA 1P1WA 4QF9A 4MLQA 3TZAA 1I69A 3K01A 3BBRA 1NH8A 4DE8A 1MY4A 2O68A 4KD5A 3DP6A 3K1NA 3M3FA 5ISUA 3TUSA 4YMBA 1NH7A 3IO4A 2O7IA 4C1TA 3K6UA 1LAXA 3R7XA 4F3PA 3HHGA 1B3EA 3DLNA 1Y3NA 4NE4A 4OMBA 1BIYA 1MXVA 1JW1A 1NNFA 2F6GA 1S9TA 3L6HA 4HS7A 4DLDA 1USYH 3MZ9A 4QHQA 5DVIA 2YPNA 1MXZA 3FGSA 2ZYKA 5H8HB 4OTEA 3TTRA 2GRVA 4F1YA 2G93A 2DXRA 1FQDA 2R71A 3VLUA 4JSOA 3CSGA 1O63A 5HM4B 3PMVA 3IX1A 1LB9A 5H8FA 3A09A 2Z22A 2WKYA 1PBPA 3FXRA 3SEXA 4U2RA 2OLBA 3W9VA 2V93A 5EHMA 4U22A 4QFLA 4YKKA 3H06B 4N07A 1MY3A 3C32A 1ELJA 3FATA 3FXQA 3OENA 4OYVA 4JXIA 3T22A 4R6KA 1IXIA 3VXBA 4ZE8A 2DP8A 3Q26A 3RLFE 3TMGA 2O1MA 4F31B 1B2HA 1R1NA 2P0SA 1OMPA 3PUWE 2QRYA 1PBQA 4ZEBA 2Q9TA 1LCFA 1FTJA 1NNPA 1S50A 2RKMA 3MP6A 1MRPA 4TOZA 4AQ4A 4PFYA 2ABHA 4NTLA 2ZNUA 2QS4A 3K1MA 2I6EA 3HN0A 2DWIA 4JBZA 1B51A 4KCDA 1D9VA 3FXUA 1BKAA 3H6VA 3S2VA 1YAEA 5I59B 5I59A 2DQVA 3IL1B 2FNCA 1QKAA 1WODA 2Q89A 4H5FA 3VVEA 3ILTB 1IUDA 4DZ1A 4JWXA 4I1DA 5CBSA 3KGCA 3IOUA 3PPQA 3HV1A 4FJPA 2D3IA 3RGYA 3WAEA 2ONKE 1IQ7A 1EZOA 5L9SA 5DVFA 5DVJA 3HHFA 2BJJX 3S9MC 2P1SA 1MM7A 1XHYA 3VFJA 5IKBA 3L6GA 1MDP1 2H99A 3ECRA 3HSTA 3F11A 3CI8A 1IXGA 3MAMA 4GL8A 4I8CA 4LONB 4EQ7A 3LBSA 1Q35A 4E0WA 1JEUA 1I6AA 4X48A 3IAZA 1YPNA 2HAVA 4GXSB 4P0IA 4WEDA 3MUQA 1DOTA 1JVYA 3MW0A 4NF4A 4ND9A 3H6TA 3B6WA 3BFUA 4GWOA 1B46A 4MH5A 4YU0A 4HCWA 3VVFA 3RQTA 3VV5A 4LVQA 3S9EA 1JNFA 3MVZA 4M1VA 1DPPA 3SETA 1JQFA 4JSDA 5FTHA 4EXLA 5H8QA 3B6QA 4BLAA 1IITA 1GTKA 1XS5A 1Y9UA 2GFEA 3OMBA 1B52A 3FUZA 1QUKA 3G7WA 5CM6A 4OWDA 2O69A 4RJZA 1CE2A 2FYIA 4PFTA 3S9LC 3K6WA 4DXBA 3UA8A 1JEVA 1JW4A 2A5SA 4DDDA 5I56A 1B5HA 2AYSA 5J1DA 1GR2A 2HQ0A 2Y84A 3N94A 1JVXA 2H9BA 4EXKA 4RPNA 3FV2A 5K2YA 2R9JA 4IO2A 1SQYA 5AA2D 4H1XA 2I3WA 3QYTA 4LZ5A 5FHOA 4G77A 3TYHA 4WXJA 3D4GA 1OLAA 4ZS9A 4N13A 2XXVA 4NF4B 5FHNA 1TFDA 4JWOA 3V8XB 5I57A 4MLVA 4HTGA 3EHTA 3EQ1A 4U4SA 4DCXA 2QPQA 3SESA 3EHUA 3PU5A 1D3KA 2XXPA 5I2NA 3MP1A 1Z7NE 3CIJA 1B3HA 4IB2A 4OENA 2ONRA 2PMSA 3FVKA 2PYYA 1QUIA 4ESXA 2XXYA 5KDTA 1AOVA 1B7ZA 1ZLQA 2DE2A 3UGWA 1JETA 2OBGA 4H65A 4R75A 2PT1A 1MXXA 4KYDA 4F29A 4G68B 1R9QA 4LATA 3V89B 3FJ7A 3VDFA 1FTOA 2F78A 2I58A 5DEXB 2DYXA 1FQEA 3KBRA 1VE4A 5JTYA 4ELOA 1B3GA 1ZTYA 4ONYA 3CFZA 3CRBA 2THIA 3QUFA 1N76A 3EN3A 3CG3A 3SEYA 4PQJA 3UN6A 3TFLA 1UQWA 5M2VA 1Y3QA 1QVSA 2I49A 4LA9A 3TODA 3I3VA 2O51A 4U1ZA 1UIUA 3H3GA 4QFNA 2RC8A 1L5TA 1OIBA 1MPDA 5ITPA 3S9NC 3S4UA 2HFBA 1QULA 2AIXA 2Z8DA 1IEJA 1ZIUA 3MVYA 4NWDA 4Q8RA 1US5A 2XXRA 2A5TB 1NMUA 4KI0E 2XD3A 1I6QA 5H8QB 1MQHA 3K02A 5JEIA 4M4GA 3QIMA 3MVXA 3IK6B 4FORA 2PBWA 4KR5A 3SEVA 4TLMB 2B3FA 2V3UA 1AL3A 2DWJA 2LAOA 1P1UA 1RYXA 1P99A 4XKRA 5DEXA 3KJ7A 2W7YA 5F1QA 4XKPA 2XXTA 3LR1A 1MXUA 1OQHA 2HZKA 1MPBA 3H7MA 3MVWA 3U8QA 2I4CA 4KFQA 4FEDA 3G3FA 4IO6A 4YB5A 2RCBA 1POY1 3LSXA 2ZMBA 3LUYA 3OO9A 4QFOA 3C35A 3HCQA 4Q5TA 4ZEKA 4RXLA 2DSFA 5L8DA 2Z8FA 4DXCA 1B5IA 3TTKA 1D9YA 2DVCA 4BDQA 4LZ7A 2O1LA 1B3FA 4XIGQ 1MY2A 3PPRA 2NVUB 5EYFA 4YMAA 1FQAA 1YTVA 4IGRA 3FZVA 3N6TA 4H6DA 2AL5A 4MFIA 3ONMA 1IIWA 1II5A 1KWHA 1N3WA 3A3CA 1XVYA 2DXYA 2V3TA 3P7IA 5DYHA 2D5WA 3T9HB 4QSEA 4DIGA 4EF1A 1N84A 3AXFA 3VXCA 1UTBB 3LSFB 2ZNTA 3KN7A 3N5LA 1R9LA 2XXWA 3PUVE 4FE8A 2I4BA 4U23A 5TU0A 3U92A 2H25A 3PUXE 1VR5A 2HZLA 3BKIB 2I0CA 3TQWA 1B4ZA 1Y20A 5CMMA 1FQFA 5TP9B 3ZS6A 5F7VA 5TP9A 3OO6A 1MDQA 3OO8A 1IXCA 2REGA 3IOVA 3PGFA 4X1BA 4F3GA 1LFGA 1MH4A 4LQ5A 4YKPA 3TCFA 3QXMA 1LBBA 2HCAA 3CFLA 4QSDA 3VLVA 5B70A 3WAFA 3MPLA 1MG1A 3IORA 5AA2B 5AA2A 1EU8A 2HAUA 2V3QA 1SBPA 4H0WA 2ALUA 3TCHA 1B7UA 2VD3A 4OEUA 4BDLA 4N6PA 4ZE9A 1MPCA 3K4UA 3MWBA 3PUZE 5CRYA 1MXWA 1SVXB 2DE4A 1VSOA 4TQUQ 3USDA 1Y4CA 3K0VA 1FW0A 3I6VA 3TKDA 3VLWA 1Y1MA 2X7PA 4PFUA 1LSTA 1Y4TA 4HCYA 2PT2A 1FTLA 1SD3A 5DTBA 3T66A 4EDPA 4F39A 3PPOA 1TWYA 4F18A 2DOJA 2E0SA 5CC2A 4I62A 1LB8A 3G3JA 3SDFA 1FCKA 2QS2A 2H4IA 3IOTA 5CBRA 1D4NA 3TTNA 4ESWA 1AMFA 3H4ZA 1FQCA 3OOAA 4PP0A 4ZEFA 1SW4A 3CG1A 1LGBC 1UTHB 2ZYNA 3N26A 1MH3A 4IO7A 5FTIA 2KLFA 1P1QA 4GD5A 2F7AA 4YAHX 2Q8JA 1P1OA 1SYHA 5A5XA 2OWSA 3FVOA 1NL5A 3O29A 4H8JA 4OFOA 3ZKLA 1PB7A 3U94A 3C4MA 3O6IA 3QUJA 1PEBA 3G3HA 5JTYB 5I58B 4F19A 1FTKA 5FHMA 3EF7A 1H43A 1EZ9A 1USYE 5HBCA 5BWJA 4NWCA 1B0LA 1ANFA 5BUUA 5AE4A 1A7LA 2GHBA 1IZ1A 2H98A 4L17A 5TPAA 3CFXA 3RN8A 5LOMA 3LC8A 3V83A 4LUBA 3DELB 2B3BA 4OEVA 5I84A 2OWTA 2Q2CA 3KG2A 3Q27A 4OETA 1POTA 4OESA 3K2DA 1M5DA 3R6UA 4BDMA 2GHAA 2YLNA 3TTLA 5ITOA 1A40A 5CI5A 2ZNSA 2OCUA 1LAGE 4TLLB 1GVCA 3C34A 4GF8A 4RY1A 4YKIA 3JYRA 4Z0IA 1M5FA 1URDA 4ZDMA 4O3CA 3O6HA 4YKJA 3KJTA 2ONSA 2NOOA 2ZYMA 1FTMA 3KOSA 4GL0A 2CMOA 5ICQA 3FJMA 3T9VA 1UTBA 4R2FA 3RT8A 3IB1A 4X1DA 1DMBA 4GLIA 1J1NA 1URSA 2CZLA 2M8CA 4GXAA 4GIZA 4IO5A 3RY3A 4EF2A 1A99A 3OEMA 1R6ZA 3OSRA 4H8IA 2B65A 1DTZA 1PB9A 4FECA 1SI0A 3FASA 5JK4A 4FIMA 3QAXA 2DWAA 3DP4A 4ELPA 1URGA 1Y1ZA
chains in the Genus database with same CATH superfamily
5I3SA 2XHDA 3SEUA 1TFAA 3TQLA 1DTGA 3CVGA 4RK9A 3E3KA 3T9UA 1VFDA 2B4LA 1SDXA 5B7DA 3KEIA 1B7HA 1G0HA 4C1UA 1B1XA 3JZJA 3Q29A 4POXA 3MZ1A 1LBCA 3M8UA 2F3BA 4OVJA 3U1OA 3G3GA 1PDAA 1ZJLA 3KC0A 3Q25A 4PF8A 1N7WA 4LQ2A 3A3UA 2WEFA 5I58A 1FPFA 1NV1A 4G8NA 2HXWA 1GGGA 2F6PA 3UP9A 3KFMA 4GWXA 4THIA 1B1HA 2F3DA 2IEEA 5I2KB 4GX3A 4KYSA 4F1VA 2DS9A 5H8SA 3SEWA 4IY6A 3RNNA 1IMFA 5IZ3B 4XXUA 4F3BA 5TPAB 4R9GA 2I3VA 2E1SA 3PV0E 2XD2A 5ELVA 1CB6A 4G8HA 2UYEA 1NUYA 1MQJA 3KN8A 5KCJB 4R6YA 2FVZA 1ZMGA 3IB0A 1FBFA 2XXIA 1M5EA 5EYHA 2CEYA 3MC2A 4QRZA 5K2XA 2VP1A 2PX1A 4GRKA 4OFLA 4RNSA 2OK2A 4RYAA 3W15C 4GOTA 3C36A 2XA5A 4G61A 4U1OA 2I48A 4OFJA 4YB7A 5IAIA 2RC7A 4QFPA 4F1UA 4IGTA 1YCJA 4IO4A 1B3LA 3SKPA 3KOTA 4DI4B 1IMCA 4RK2A 4R72A 1ZKBA 4MNIA 1UTHA 2QVUA 3OD7A 4BDNA 1LFHA 3O97A 4N81A 4OZ9A 3TCGA 3EHSA 3RPLA 3ZKKA 3FD3A 1OLCA 3T96B 3TTMA 4R9FA 3HPIA 5AA4B 5I5PA 1H44A 1XOCA 2JJKA 4H45A 3PMXA 4QSCA 1DSNA 2O84X 4ECFA 3RT6B 3JV9A 2XX9A 4MLQA 2O68A 5ISUA 3M3FA 3TUSA 4PDHA 1FJ9A 5IGAA 3HHGA 1BIYA 1JW1A 4DLDA 1S9TA 4HS7A 3FGSA 2R71A 4JSOA 3CSGA 1O63A 5HM4B 3D1RA 3IX1A 1LB9A 5EQ7A 5H8FA 3A09A 1PBPA 4U2RA 3W9VA 2V93A 4NG7A 3H06B 3T22A 1ELJA 3FATA 4OYVA 2XWVA 1IXIA 3VXBA 4ZE8A 4F31B 3RLFE 2O1MA 1KA0A 2QS4A 3RYDA 3S2VA 2DQVA 2FNCA 1WODA 2Q89A 2CZKA 3ILTB 3IOUA 3A29A 5EYGA 3RGYA 5L9SA 5DVFA 1XHYA 3RPLB 2ZZXA 4P1LA 2H99A 4GL8A 1IXGA 1NV5A 4LONB 3LBSA 1Q35A 3FXBA 2HPGA 4WEDA 3MW0A 4MH5A 4YU0A 4HCWA 4LVQA 3S9EA 3SETA 3MVZA 3B6QA 1IITA 1XS5A 2GFEA 3ROJA 1DK4A 5CM6A 4RJZA 4PFTA 1NV7A 4DXBA 3UA8A 1JEVA 5I56A 2AYSA 1GR2A 2HQ0A 2Y84A 2R9JA 4IO2A 3QYTA 3TYHA 4NF4B 5FHNA 3V8XB 5IZZA 1TFDA 4U4SA 4DCXA 3PU5A 3MP1A 2PMSA 1AOVA 1B7ZA 1ZLQA 4R75A 4H65A 1MXXA 4KYDA 3VDFA 1FTOA 5DEXB 2DYXA 3KBRA 5JTYA 2PFYA 4ONYA 3CRBA 3QUFA 1N76A 3CG3A 3SEYA 4PQJA 4LA9A 4U1ZA 4QFNA 2RC8A 1MPDA 1US5A 1AWBA 5H8QB 3QIMA 3MVXA 4FORA 1VDWA 4KR5A 1P99A 2XXTA 2HZKA 3H7MA 4FEDA 4IO6A 1YYZA 4P56A 4XEQA 2ZMBA 1D9YA 2DVCA 1MY2A 3PPRA 3MSTA 4YMAA 4EF1A 3N6TA 3ONMA 1II5A 1N3WA 2V3TA 1FBHA 3AXFA 3VXCA 3LSFB 4FE8A 3N5LA 2XXWA 2I4BA 1VR5A 3BKIB 3TQWA 5TP9B 5TP9A 4PTKA 3OO6A 3IOVA 2REGA 3PGFA 4MJOA 4YKPA 3MPLA 3IORA 5AA2A 4O8MA 4BDLA 3TCHA 4N6PA 3MWBA 1MXWA 1SVXB 2DE4A 1FPEA 3USDA 1FW0A 3TKDA 4PFUA 5DTBA 4GWSA 4F39A 3T66A 4N6KA 2ZZWA 1TWYA 4I62A 4GX6A 1D4NA 4ESWA 3OOAA 3RPWA 1SW4A 3CG1A 4IO7A 5FTIA 2OWSA 4JVCA 4H8JA 4OFOA 2QFLA 1PB7A 3O6IA 1PEBA 3G3HA 1H43A 5HBCA 1USYE 1D9QA 5AE4A 5TPAA 3RN8A 3LC8A 5I84A 2Q2CA 4OETA 1M5DA 3R6UA 4N91A 5ITOA 2ZNSA 4TLLB 2WYKA 4ZDMA 1URDA 4YKJA 2ONSA 2NOOA 3KOSA 1FTMA 4MIJA 3FJMA 4X1DA 4GLIA 4IO5A 2CZLA 4GXAA 2CZHA 3FBPA 5L9OA 3OEMA 1PB9A 1JP4A 5JK4A 2DWAA 1B51A 3DP4A 1Y1ZA 4OHNA 2RCAA 4FEBA 4WEPA 1EH3A 3OELA 3R26A 1T0KA 1OQGA 2QL3A 2I0BA 4UACA 3H6UA 3GYYA 1B32A 2FHYA 3SERA 3Q28A 2RINA 3OXNA 3U65A 4QFKA 1H3DA 2QS3A 2O7UA 3IOWA 2QMWA 3B50A 1NNKA 3MP8A 4GX4A 2Q88A 2P2AA 3TAJA 3E4RA 1A54A 3PPNA 4GVOA 1AH5A 3KSXA 4Q0CA 1VFEA 1BP5A 2Y7IA 4GWZA 4H67A 4NF6B 1WDNA 4C0RA 4R2BA 5ET7A 2DE3A 1SW2A 1YZ0A 4I9DA 3T9XB 4ELRA 4YB6A 1NV2A 2Y7WA 5KCJA 1EZPA 4G2ZA 4F22A 3RTWB 4ZZAA 1O7TA 3MYUA 1NNTA 4FBPA 4G4PA 4PFWA 2QJEA 3PD9A 1IMDA 5H8FB 3CR9A 4Z7EA 3HO7A 1HSJA 3U72A 3CHGA 1DBZA 2VD2A 4MBPA 4KPTA 3FV1A 4ELQA 3OEKA 2KR0A 2XXUA 1NFTA 3N6UA 5I56B 4LZ8A 2UVIA 3DP8A 3GZGA 4JVDA 4YICA 1XT8A 4H5GA 2F5XA 1B9JA 1Q9DA 4OERA 3O66A 4PBQA 1NV0A 1I6BA 4X8RA 4FATA 2Q8MA 3C33A 4R6HA 3C9HA 2PFZA 3VE1B 1PB8A 1RKMA 2HEUA 1MXYA 2F7CA 3T0JA 3I5OA 4WKMA 4GBVA 4NF8B 1SW1A 2OJTA 2UVJA 1HSLA 1OVTA 1H76A 4PCDA 3PMWA 4O3AA 2UXAA 4AB5A 4R73A 3T1BA 1M5BA 1PC3A 3ODBA 4R74A 5AA1A 3K6XA 2XXXA 2XWOA 3MQ9A 2UVHA 4HE1A 3K01A 1MY4A 1NUWA 4YMBA 1NH7A 3K6UA 4N6DA 4MHFA 4OMBA 3L6HA 1FBGA 3MZ9A 5DVIA 4OTEA 2GRVA 4F1YA 2G93A 1KA1A 2R8TA 4JVIA 1YXIA 2OLBA 5EHMA 4YKKA 1MY3A 4R6KA 1B2HA 4ZEBA 1FTJA 1S50A 3MP6A 4TOZA 1MRPA 2ZNUA 2DWIA 1D9VA 3FXUA 1BKAA 5I59B 5I59A 4NN3A 3VVEA 1IUDA 3PPQA 2D3IA 2CEXA 3WAEA 2QVVA 4PFRA 3HHFA 4PAKA 4MX6A 3MAMA 4PDDA 1FJ6A 1JEUA 1I6AA 1LBXA 3IAZA 1YPNA 4P0IA 3MUQA 1JVYA 4ND9A 2FIEA 3B6WA 3RQTA 1JNFA 1DPPA 5FTHA 1G0IA 4BLAA 1IMEA 3FUZA 1QUKA 2O69A 2WX9A 3S9LC 4UABA 5J1DA 4O7IA 5FHOA 4P47A 4QBAA 1FRPA 4I3YA 4MLVA 3EQ1A 2KQZA 3KC1A 2XXPA 1Z7NE 4IB2A 2Q74A 2ONRA 4P8BA 4PFIA 3FVKA 1QUIA 4XF5A 1NUZA 1R9QA 4LATA 3V89B 3FJ7A 2I58A 1FQEA 1B3GA 3CFZA 3EN3A 4OVQA 1QVSA 2O51A 1UIUA 5ITPA 3S9NC 3S4UA 2HFBA 4NWDA 1NMUA 5JEIA 1LBWA 4M4GA 1NV4A 3IK6B 4HE2A 2B3FA 1P1UA 5DEXA 2W7YA 3LR1A 1MPBA 4KFQA 4YB5A 1POY1 3OO9A 3LUYA 4Q5TA 4RXLA 2Z8FA 1B5IA 3TTKA 4BDQA 4O94A 4MFIA 5H8QA 2AL5A 1KWHA 4O7MA 2DXYA 3T9HB 2L5VA 4DIGA 1N84A 3KN7A 1R9LA 4U23A 3U92A 2H25A 2I0CA 1B4ZA 3ZS6A 1RDYA 1MDQA 1IXCA 4F3GA 4LQ5A 3TCFA 2HCAA 1EU8A 2HAUA 2V3QA 4H0WA 4ZE9A 3PUZE 5CRYA 4TQUQ 1DCUA 1Y4CA 3K0VA 4HE0A 4HCYA 5CC2A 3G3JA 3SDFA 1FCKA 5CBRA 2NVUB 4ZEFA 1LGBC 2ZYNA 3N26A 4GD5A 2F7AA 1SYHA 5A5XA 5EQ9A 3FVOA 5DW8A 3QUJA 5JTYB 5I58B 5FHMA 3EF7A 4NWCA 5BUUA 3HFUA 1BK4A 1A7LA 2GHBA 1IZ1A 2H98A 5LOMA 3CFXA 3V83A 4NX1A 2B3BA 3Q27A 3K2DA 3E78A 4BDMA 2GHAA 3TTLA 1A40A 1LAGE 3C34A 2VPNA 3KJTA 4GL0A 1UTBA 4R2FA 1A99A 4H8IA 4XFEA 4EQ7A 4ELPA 2F35A 3KN3A 1IMBA 4DCYA 1B05A 1TT1A 2F34A 3G3IA 5I57B 3KBZA 1US4A 4E0XA 4KYEA 3FJGA 5KDTB 2DDKA 3TEPA 4NF5B 4IR8A 1ZBMA 3QSLA 4YZZA 1A8FA 1B6HA 3BIHA 2V25A 2XXQA 3KSJA 4GWWA 1XC1A 4OVSA 5FBPA 3IJOB 4PETA 3OSQA 3E9XA 2OZZA 5EHSA 4O3BA 4GWYA 1B0HA 3G3KA 2NWJA 1TXFA 5CMCA 4PBHA 1FQBA 1N04A 4RA1A 1WVJA 4X04A 4P0GA 3QK6A 3FVGA 1FBCA 4OANA 3K1PA 5IZ1A 4NMYA 1ZU0A 3D4CA 1IMAA 3RTFB 3C31A 2Q2AA 1RYOA 1BTJA 3IJXB 2XX7A 5I2KA 2O6AA 4OQOA 1RDXA 1LFIA 5IZ3A 4KXPA 3RUMA 2QS1A 3OO7A 4NF6A 3U93A 2Z23A 2V84A 4U4XA 1LAHE 1NKXA 4HW8A 3E79A 5CMKA 5ICTA 4XKNA 3TELA 4BDOA 5T3JA 3B8BA 2Y7PA 3TDJA 2UYFA 2ZYOA 2XX8A 3LSWA 1LCTA 2VHAA 1XI6A 3W9WA 3H03A 4P1EA 4KHZE 2OX3A 2QMXA 4NF8A 2YJPA 3K00A 3IB2A 4PE5B 1MM6A 2XWIA 2X26A 3UORA 3BIGA 1A55A 4G68A 1NV3A 4ZZEA 1N3XA 2F8DA 3ILUB 3B7DA 4OVTA 2A5TA 2D21A 1ATGA 3PTYA 4OXVA 4AB6A 2DVZA 3TPAA 2REJA 2IA4A 2Y7KA 4DXUA 1Z7ME 3VVDA 2F97A 1SPIA 3PUYE 4MNPA 3KZGA 3O6GA 3ZSFA 2FA7A 1FBPA 4POWA 4NEDA 1GV8A 2NUVA 5F24A 3TZAA 3BBRA 1NH8A 3DP6A 2HXRA 3K1NA 3IO4A 1EYJA 3R7XA 4F3PA 3DLNA 4PGNA 3IFAA 2F6GA 3SZPA 1INPA 2YPNA 1MXZA 5H8HB 2DXRA 1FQDA 2WKYA 4U22A 4QFLA 4N07A 3OENA 3Q26A 1OMPA 1NNPA 2RKMA 4AQ4A 4PFYA 3HN0A 4JBZA 4AS5A 4KCDA 2WBBA 4H5FA 4I1DA 4N8YA 1IQ7A 3S9MC 2P1SA 1MM7A 5IKBA 3L6GA 1MDP1 3F11A 5EQAA 2HAVA 1DOTA 3H6TA 4I3EA 1B46A 3VVFA 3VV5A 1JQFA 4EXLA 3OMBA 1B52A 1CE2A 2FYIA 3K6WA 2A5SA 4PFBA 4EXKA 3N94A 4OA4A 2H9BA 4H1XA 2I3WA 4LZ5A 2XXVA 5I57A 4HTGA 2QPQA 3SESA 3EHUA 2PYYA 5KDTA 2XXYA 2DE2A 2OBGA 1EYIA 5ET8A 4F29A 1CNQA 4MAGA 4P9KA 2THIA 3UN6A 1UQWA 2I49A 3TODA 1KZ8A 4LN5A 3H3GA 4GWUA 4PAFA 1QULA 2Z8DA 1ZIUA 2XXRA 4KI0E 3K02A 2PBWA 1FPIA 4P3LA 2LAOA 1RYXA 5F1QA 4XKPA 2I4CA 2RCBA 3LSXA 3C35A 1FBDA 5L8DA 4DXCA 2FIXA 2O1LA 1B3FA 4IGRA 4TLMB 1LBZA 3A3CA 1IIWA 1LBYA 3P7IA 5AA3A 2ZNTA 5TU0A 3PUXE 2HZLA 1Y20A 1FQFA 5F7VA 4X1BA 1LFGA 1MH4A 4GBWA 1FPLA 1LBBA 4QSDA 5B70A 5AA2B 4HXVA 1SBPA 2ALUA 1B7UA 4OEUA 4PF6A 1MPCA 3K4UA 2X7PA 1LSTA 1Y4TA 2PT2A 1FTLA 3PPOA 2DOJA 2PCRA 1LB8A 3LV0A 4DI3D 2QS2A 2H4IA 3IOTA 3H4ZA 4PP0A 1MH3A 2BJIA 3O29A 4MCOA 3C4MA 4PE3A 1FTKA 1ANFA 1EYKA 5EQ8A 4OEVA 2B4MA 3KG2A 4OESA 4N15A 4AS4A 4RY1A 3JYRA 1M5FA 3EKIA 4O3CA 2CMOA 4OVPA 3RT8A 1DMBA 3RY3A 1URSA 2V4CA 4GIZA 3OSRA 1R6ZA 2B65A 1DTZA 1SI0A 4FIMA 3QAXA 2OWZA 5ET5A 4N8GA 3FVNA 2AL4A 4GFRA 4RPOA 1BLFA 1MQGA 1P1NA 4EQ9A 5KZTA 4PC9A 4FAJA 1NI9A 1IXHA 1MY0A 3THIA 5I2NB 3FIRA 2VGQA 1QW0A 3IR1A 4U21A 3LSLA 3K6VA 5H8HA 2P3VA 1S7YA 2NXOA 4IO3A 4ZEDA 1MQDA 4Q30B 4G8MA 2PVUA 5L9MA 1SI1A 4NF5A 1DPEA 2ANJA 5H8NB 3GBBA 3IFCA 2FBPA 1OVBA 3H6WA 5H8NA 4N17A 1QUJA 2G29A 2Z8EA 4G68C 5AA4A 3IO6A 4IY5A 4XTCQ 3BFTA 3O2AA 3B6TA 1FPKA 4JDFA 3E13X 1SW5A 3MJNA 4ZEIA 4P11A 2ZXTA 5HPQA 1NV6A 2WBDA 4PAIA 5A5XB 3V5AA 2F7BA 1LBVA 1MS7A 2CZIA 1QJMA 3O9PA 1FPGA 3GLBA 2GH9A 1B58A 4BDRA 3UK4A 4F2OA 3M3KA 1RDZA 4F2QA 2R6GE 1LEVA 2Y7RA 2XXHA 1N0TA 4JB7A 4KQPA 4ISUA 4GQOA 2VPOA 2RF1A 1B5JA 4NF0A 4X9TA 1MQIA 2HHMA 4NHBA 5IM2A 3GBAA 1HSEA 3MZBA 3CSBA 1M5CA 1H45A 1SYIA 1Y3PA 2DWHA 2UVGA 4UA8A 3PD8A 1F9BA 1QKBA 3UIFA 1FPJA 4N4UA 2QSXA 1LAFE 2X7QA 2Y5LA 2ZZVA 1A8EA 1LLSA 3EPEA 1JW5A 3MBPA 1QGXA 3O28A 1N7XA 3GXAA 2ESNA 4KCCA 4XKQA 4MF3A 5CMBA 2F36A 1O64A 3DM0A 1UIVA 2VOZA 1AIVA 4F3SA 2H5YA 1FPDA 1B4HA 1MY1A 4EQBA 3T93B 3PPPA 2RC9A 3MPKA 1XVXA 1B40A 4K3FA 4NQ8A 4LP2B 4JWYA 1K9ZA 4QXDA 5DT6A 1Q1KA 3M3LA 1P1WA 4QF9A 2P3NA 1I69A 4DE8A 4KD5A 2O7IA 4C1TA 1LAXA 3LUZA 1NUXA 1B3EA 1Y3NA 4NE4A 1MXVA 1NNFA 1USYH 4QHQA 2ZYKA 3TTRA 3QMFA 3VLUA 1FPBA 3PMVA 2Z22A 3FXRA 3SEXA 3C32A 3FXQA 4JXIA 2DP8A 3TMGA 1R1NA 2P0SA 3PUWE 2QRYA 1PBQA 2Q9TA 1LCFA 2ABHA 4NTLA 3K1MA 2I6EA 3H6VA 1YAEA 3NOHA 3IL1B 1QKAA 4DZ1A 4JWXA 5CBSA 3KGCA 3HV1A 4FJPA 2ONKE 1EZOA 5DVJA 2BJJX 4H46A 3VFJA 3ECRA 3HSTA 3CI8A 4I8CA 4E0WA 4X48A 4GXSB 2GQ1A 4NF4A 5LTCA 3BFUA 4GWOA 1K9YA 2VT5A 4M1VA 4JSDA 1GTKA 1Y9UA 2Y5KA 1FBEA 3G7WA 4OWDA 1JW4A 4DDDA 1B5HA 1JVXA 4RPNA 5I7IA 3FV2A 5K2YA 5AA2D 1SQYA 4G77A 4WXJA 3D4GA 1OLAA 4ZS9A 4N13A 5J16A 4JWOA 3EHTA 4MEVA 4MNCA 1D3KA 5I2NA 3CIJA 1B3HA 4OENA 4ESXA 3UGWA 1JETA 2PT1A 4G68B 2F78A 1VE4A 4ELOA 1ZTYA 4OVRA 2XWKA 3TFLA 5M2VA 5ESYA 1Y3QA 3I3VA 1L5TA 1OIBA 2AIXA 4Q8RA 1IEJA 3MVYA 2A5TB 5A5LA 2XD3A 1I6QA 4NAPA 1MQHA 4I40A 3SEVA 2V3UA 1AL3A 2DWJA 4XKRA 3KJ7A 4PGPA 1MXUA 1OQHA 3MVWA 3U8QA 1FSAA 3G3FA 4EUOA 4QFOA 3HCQA 4ZEKA 2DSFA 4LZ7A 4XIGQ 5EYFA 1FQAA 1YTVA 3FZVA 4H6DA 4ZECA 1XVYA 5DYHA 2D5WA 4QSEA 1UTBB 3PUVE 5CMMA 3OO8A 1FTAA 3QXMA 3CFLA 3VLVA 3WAFA 1MG1A 2VD3A 1VSOA 3ISPA 5ET6A 3I6VA 3VLWA 1Y1MA 2MKZA 4EDPA 1SD3A 2WYPA 4F18A 2E0SA 3TTNA 1AMFA 1FQCA 1UTHB 2KLFA 1P1QA 4YAHX 2Q8JA 1P1OA 4MMPA 1NL5A 3ZKLA 2QVRA 3U94A 4NGUA 4F19A 1EZ9A 5BWJA 1B0LA 4L17A 4LUBA 3DELB 2OWTA 1POTA 2YLNA 5LDZA 5CI5A 2OCUA 1GVCA 4GF8A 4YKIA 4Z0IA 3O6HA 5ICQA 2ZYMA 3T9VA 3IB1A 1J1NA 2M8CA 4EF2A 2XXKA 4FECA 3FASA 1URGA
chains in the Genus database with same CATH topology
2F35A 4OHNA 3FVNA 2RCAA 2XHDA 4FEBA 3KN3A 3SEUA 2AL4A 4WEPA 4DCYA 4GFRA 1B05A 1TFAA 3TQLA 1EH3A 1DTGA 1TT1A 3CVGA 3E3KA 2F34A 3G3IA 3OELA 3R26A 4RK9A 1VFDA 4RPOA 1BLFA 1MQGA 1P1NA 4EQ9A 5I57B 5KZTA 1T0KA 1OQGA 2QL3A 4FAJA 1SDXA 2I0BA 1IXHA 1US4A 1MY0A 5B7DA 3THIA 3KEIA 1B7HA 4UACA 4KYEA 4C1UA 1B1XA 3FIRA 3FJGA 4E0XA 3H6UA 2VGQA 5I2NB 3JZJA 1QW0A 3IR1A 5KDTB 1B32A 3TEPA 3Q29A 4NF5B 1ZBMA 3QSLA 4U21A 1A8FA 3LSLA 4YZZA 1B6HA 3SERA 3Q28A 2RINA 4POXA 3K6VA 2V25A 2XXQA 3KSJA 3MZ1A 5H8HA 1LBCA 3OXNA 1XC1A 3M8UA 4QFKA 1H3DA 3IJOB 2QS3A 2O7UA 3OSQA 3G3GA 4OVJA 3IOWA 2QMWA 4PETA 3E9XA 3U1OA 1NNKA 3MP8A 2Q88A 1PDAA 2P2AA 2OZZA 1ZJLA 3TAJA 5EHSA 4O3BA 1S7YA 1B0HA 3E4RA 3G3KA 2NXOA 4IO3A 2NWJA 1A54A 3PPNA 3Q25A 4GVOA 4ZEDA 1TXFA 5CMCA 1MQDA 1AH5A 3KSXA 4Q30B 1N7WA 4G8MA 2PVUA 4Q0CA 1VFEA 5L9MA 1FQBA 1BP5A 1N04A 4RA1A 1SI1A 4NF5A 1DPEA 1WVJA 3A3UA 4LQ2A 2ANJA 5H8NB 3GBBA 2Y7IA 4P0GA 1OVBA 3H6WA 3QK6A 5H8NA 3FVGA 5I58A 4H67A 1QUJA 2G29A 2Z8EA 3K1PA 4G68C 4NF6B 4NMYA 4G8NA 5AA4A 1ZU0A 1GGGA 2HXWA 2F6PA 1WDNA 3IO6A 4IY5A 3D4CA 4XTCQ 4C0RA 3RTFB 3UP9A 4R2BA 3KFMA 3BFTA 3O2AA 3B6TA 3C31A 1B1HA 2DE3A 2Q2AA 4JDFA 1RYOA 1SW2A 3E13X 4I9DA 4THIA 1SW5A 4YB6A 3MJNA 3T9XB 4ELRA 4EUOA 1BTJA 4ZEIA 3IJXB 4P11A 2IEEA 2XX7A 2Y7WA 2ZXTA 5I2KB 5HPQA 5I2KA 5KCJA 2O6AA 4KYSA 4OQOA 4F1VA 1EZPA 2DS9A 5H8SA 3SEWA 5A5XB 4G2ZA 3V5AA 2F7BA 1LFIA 4IY6A 1MS7A 3RNNA 4F22A 3O9PA 1QJMA 4ZZAA 1O7TA 3RTWB 3GLBA 2GH9A 3RUMA 2QS1A 4XXUA 1B58A 4BDRA 3UK4A 3OO7A 1NNTA 4G4PA 4PFWA 4F2OA 4F3BA 4NF6A 3U93A 3M3KA 2Z23A 5TPAB 4F2QA 2V84A 4U4XA 1LAHE 1NKXA 2R6GE 2QJEA 2I3VA 4R9GA 4HW8A 2E1SA 3PV0E 3T9UA 3PD9A 5L9OA 2XD2A 2Y7RA 5CMKA 2XXHA 5ELVA 5ICTA 4XKNA 1CB6A 1N0TA 5H8FB 4G8HA 3TELA 4JB7A 2UYEA 4BDOA 1MQJA 3KN8A 3CR9A 5KCJB 2Y7PA 4KQPA 4R6YA 4ISUA 3TDJA 3HO7A 1HSJA 4GQOA 3U72A 4Z7EA 2UYFA 2RF1A 1B5JA 2VD2A 2ZYOA 4MBPA 4X9TA 1MQIA 2XX8A 1ZMGA 3LSWA 4KPTA 1LCTA 2VHAA 3FV1A 4ELQA 3IB0A 3OEKA 3W9WA 3N6UA 2XXUA 1NFTA 3H03A 5I56B 2XXIA 4KHZE 4LZ8A 3GBAA 3RPWA 1M5EA 1HSEA 2QMXA 2UVIA 3MZBA 3MC2A 3CSBA 2YJPA 3K00A 3DP8A 3GZGA 4NF8A 4YICA 3IB2A 1XT8A 4PE5B 4QRZA 5K2XA 1M5CA 4H5GA 4F3SA 2VP1A 2PX1A 4GRKA 4OFLA 1MM6A 4RNSA 1H45A 1SYIA 1Y3PA 2F5XA 1B9JA 2DWHA 2OK2A 3O66A 4OERA 4RYAA 3W15C 1I6BA 4GOTA 2X26A 3C36A 4FATA 4ZECA 2UVGA 3UORA 4UA8A 3PD8A 3C33A 4R6HA 1F9BA 3C9HA 2I48A 1QKBA 4U1OA 3UIFA 4OFJA 2QSXA 3VE1B 1PB8A 1A55A 4YB7A 5IAIA 1RKMA 1LAFE 1MXYA 2HEUA 2RC7A 4QFPA 2X7QA 4G68A 5AA3A 4F1UA 2F7CA 4IGTA 4ZZEA 3I5OA 1YCJA 4IO4A 1A8EA 1N3XA 1LLSA 3EPEA 1JW5A 2F8DA 4WKMA 1B3LA 3ILUB 3MBPA 3SKPA 4NF8B 3O28A 3B7DA 1N7XA 3GXAA 1SW1A 3KOTA 2OJTA 2A5TA 2ESNA 2D21A 2UVJA 1ATGA 4KCCA 4RK2A 1HSLA 1OVTA 4MF3A 4R72A 4XKQA 5CMBA 1H76A 2F36A 3PMWA 1O64A 4O3AA 4OXVA 1ZKBA 1UTHA 1UIVA 3DM0A 3OD7A 2VOZA 4BDNA 3O97A 4AB6A 2UXAA 2DVZA 1AIVA 1LFHA 3TPAA 2REJA 2IA4A 2Y7KA 4OZ9A 1Z7ME 2H5YA 3TCGA 3EHSA 4R73A 4AB5A 4DXUA 1M5BA 1PC3A 2F97A 3ODBA 3VVDA 3FD3A 1B4HA 1MY1A 4R74A 3ZKKA 3T93B 1OLCA 4EQBA 3PPPA 2RC9A 3MPKA 3T96B 4R9FA 3TTMA 5AA1A 3K6XA 3PUYE 3HPIA 5AA4B 3KZGA 1H44A 1XOCA 1XVXA 2XXXA 1B40A 3O6GA 4K3FA 3ZSFA 3PMXA 4QSCA 1DSNA 2FA7A 2O84X 4ECFA 3RT6B 3JV9A 4JWYA 4LP2B 4NEDA 4POWA 1GV8A 2NUVA 5DT6A 3MQ9A 1Q1KA 2UVHA 2XX9A 3M3LA 1P1WA 4QF9A 4MLQA 3TZAA 1I69A 3K01A 3BBRA 1NH8A 4DE8A 1MY4A 2O68A 4KD5A 3DP6A 3K1NA 3M3FA 5ISUA 3TUSA 4YMBA 1NH7A 3IO4A 2O7IA 4C1TA 3K6UA 1LAXA 3R7XA 4F3PA 3HHGA 1B3EA 3DLNA 1Y3NA 4NE4A 4OMBA 1BIYA 1MXVA 1JW1A 1NNFA 2F6GA 1S9TA 3L6HA 4HS7A 4DLDA 1USYH 3MZ9A 4QHQA 5DVIA 2YPNA 1MXZA 3FGSA 2ZYKA 5H8HB 4OTEA 3TTRA 2GRVA 4F1YA 2G93A 2DXRA 1FQDA 2R71A 3VLUA 4JSOA 3CSGA 1O63A 5HM4B 3PMVA 3IX1A 1LB9A 5H8FA 3A09A 2Z22A 2WKYA 1PBPA 3FXRA 3SEXA 4U2RA 2OLBA 3W9VA 2V93A 5EHMA 4U22A 4QFLA 4YKKA 3H06B 4N07A 1MY3A 3C32A 1ELJA 3FATA 3FXQA 3OENA 4OYVA 4JXIA 3T22A 4R6KA 1IXIA 3VXBA 4ZE8A 2DP8A 3Q26A 3RLFE 3TMGA 2O1MA 4F31B 1B2HA 1R1NA 2P0SA 1OMPA 3PUWE 2QRYA 1PBQA 4ZEBA 2Q9TA 1LCFA 1FTJA 1NNPA 1S50A 2RKMA 3MP6A 1MRPA 4TOZA 4AQ4A 4PFYA 2ABHA 4NTLA 2ZNUA 2QS4A 3K1MA 2I6EA 3HN0A 2DWIA 4JBZA 1B51A 4KCDA 1D9VA 3FXUA 1BKAA 3H6VA 3S2VA 1YAEA 5I59B 5I59A 2DQVA 3IL1B 2FNCA 1QKAA 1WODA 2Q89A 4H5FA 3VVEA 3ILTB 1IUDA 4DZ1A 4JWXA 4I1DA 5CBSA 3KGCA 3IOUA 3PPQA 3HV1A 4FJPA 2D3IA 3RGYA 3WAEA 2ONKE 1IQ7A 1EZOA 5L9SA 5DVFA 5DVJA 3HHFA 2BJJX 3S9MC 2P1SA 1MM7A 1XHYA 3VFJA 5IKBA 3L6GA 1MDP1 2H99A 3ECRA 3HSTA 3F11A 3CI8A 1IXGA 3MAMA 4GL8A 4I8CA 4LONB 4EQ7A 3LBSA 1Q35A 4E0WA 1JEUA 1I6AA 4X48A 3IAZA 1YPNA 2HAVA 4GXSB 4P0IA 4WEDA 3MUQA 1DOTA 1JVYA 3MW0A 4NF4A 4ND9A 3H6TA 3B6WA 3BFUA 4GWOA 1B46A 4MH5A 4YU0A 4HCWA 3VVFA 3RQTA 3VV5A 4LVQA 3S9EA 1JNFA 3MVZA 4M1VA 1DPPA 3SETA 1JQFA 4JSDA 5FTHA 4EXLA 5H8QA 3B6QA 4BLAA 1IITA 1GTKA 1XS5A 1Y9UA 2GFEA 3OMBA 1B52A 3FUZA 1QUKA 3G7WA 5CM6A 4OWDA 2O69A 4RJZA 1CE2A 2FYIA 4PFTA 3S9LC 3K6WA 4DXBA 3UA8A 1JEVA 1JW4A 2A5SA 4DDDA 5I56A 1B5HA 2AYSA 5J1DA 1GR2A 2HQ0A 2Y84A 3N94A 1JVXA 2H9BA 4EXKA 4RPNA 3FV2A 5K2YA 2R9JA 4IO2A 1SQYA 5AA2D 4H1XA 2I3WA 3QYTA 4LZ5A 5FHOA 4G77A 3TYHA 4WXJA 3D4GA 1OLAA 4ZS9A 4N13A 2XXVA 4NF4B 5FHNA 1TFDA 4JWOA 3V8XB 5I57A 4MLVA 4HTGA 3EHTA 3EQ1A 4U4SA 4DCXA 2QPQA 3SESA 3EHUA 3PU5A 1D3KA 2XXPA 5I2NA 3MP1A 1Z7NE 3CIJA 1B3HA 4IB2A 4OENA 2ONRA 2PMSA 3FVKA 2PYYA 1QUIA 4ESXA 2XXYA 5KDTA 1AOVA 1B7ZA 1ZLQA 2DE2A 3UGWA 1JETA 2OBGA 4H65A 4R75A 2PT1A 1MXXA 4KYDA 4F29A 4G68B 1R9QA 4LATA 3V89B 3FJ7A 3VDFA 1FTOA 2F78A 2I58A 5DEXB 2DYXA 1FQEA 3KBRA 1VE4A 5JTYA 4ELOA 1B3GA 1ZTYA 4ONYA 3CFZA 3CRBA 2THIA 3QUFA 1N76A 3EN3A 3CG3A 3SEYA 4PQJA 3UN6A 3TFLA 1UQWA 5M2VA 1Y3QA 1QVSA 2I49A 4LA9A 3TODA 3I3VA 2O51A 4U1ZA 1UIUA 3H3GA 4QFNA 2RC8A 1L5TA 1OIBA 1MPDA 5ITPA 3S9NC 3S4UA 2HFBA 1QULA 2AIXA 2Z8DA 1IEJA 1ZIUA 3MVYA 4NWDA 4Q8RA 1US5A 2XXRA 2A5TB 1NMUA 4KI0E 2XD3A 1I6QA 5H8QB 1MQHA 3K02A 5JEIA 4M4GA 3QIMA 3MVXA 3IK6B 4FORA 2PBWA 4KR5A 3SEVA 4TLMB 2B3FA 2V3UA 1AL3A 2DWJA 2LAOA 1P1UA 1RYXA 1P99A 4XKRA 5DEXA 3KJ7A 2W7YA 5F1QA 4XKPA 2XXTA 3LR1A 1MXUA 1OQHA 2HZKA 1MPBA 3H7MA 3MVWA 3U8QA 2I4CA 4KFQA 4FEDA 3G3FA 4IO6A 4YB5A 2RCBA 1POY1 3LSXA 2ZMBA 3LUYA 3OO9A 4QFOA 3C35A 3HCQA 4Q5TA 4ZEKA 4RXLA 2DSFA 5L8DA 2Z8FA 4DXCA 1B5IA 3TTKA 1D9YA 2DVCA 4BDQA 4LZ7A 2O1LA 1B3FA 4XIGQ 1MY2A 3PPRA 2NVUB 5EYFA 4YMAA 1FQAA 1YTVA 4IGRA 3FZVA 3N6TA 4H6DA 2AL5A 4MFIA 3ONMA 1IIWA 1II5A 1KWHA 1N3WA 3A3CA 1XVYA 2DXYA 2V3TA 3P7IA 5DYHA 2D5WA 3T9HB 4QSEA 4DIGA 4EF1A 1N84A 3AXFA 3VXCA 1UTBB 3LSFB 2ZNTA 3KN7A 3N5LA 1R9LA 2XXWA 3PUVE 4FE8A 2I4BA 4U23A 5TU0A 3U92A 2H25A 3PUXE 1VR5A 2HZLA 3BKIB 2I0CA 3TQWA 1B4ZA 1Y20A 5CMMA 1FQFA 5TP9B 3ZS6A 5F7VA 5TP9A 3OO6A 1MDQA 3OO8A 1IXCA 2REGA 3IOVA 3PGFA 4X1BA 4F3GA 1LFGA 1MH4A 4LQ5A 4YKPA 3TCFA 3QXMA 1LBBA 2HCAA 3CFLA 4QSDA 3VLVA 5B70A 3WAFA 3MPLA 1MG1A 3IORA 5AA2B 5AA2A 1EU8A 2HAUA 2V3QA 1SBPA 4H0WA 2ALUA 3TCHA 1B7UA 2VD3A 4OEUA 4BDLA 4N6PA 4ZE9A 1MPCA 3K4UA 3MWBA 3PUZE 5CRYA 1MXWA 1SVXB 2DE4A 1VSOA 4TQUQ 3USDA 1Y4CA 3K0VA 1FW0A 3I6VA 3TKDA 3VLWA 1Y1MA 2X7PA 4PFUA 1LSTA 1Y4TA 4HCYA 2PT2A 1FTLA 1SD3A 5DTBA 3T66A 4EDPA 4F39A 3PPOA 1TWYA 4F18A 2DOJA 2E0SA 5CC2A 4I62A 1LB8A 3G3JA 3SDFA 1FCKA 2QS2A 2H4IA 3IOTA 5CBRA 1D4NA 3TTNA 4ESWA 1AMFA 3H4ZA 1FQCA 3OOAA 4PP0A 4ZEFA 1SW4A 3CG1A 1LGBC 1UTHB 2ZYNA 3N26A 1MH3A 4IO7A 5FTIA 2KLFA 1P1QA 4GD5A 2F7AA 4YAHX 2Q8JA 1P1OA 1SYHA 5A5XA 2OWSA 3FVOA 1NL5A 3O29A 4H8JA 4OFOA 3ZKLA 1PB7A 3U94A 3C4MA 3O6IA 3QUJA 1PEBA 3G3HA 5JTYB 5I58B 4F19A 1FTKA 5FHMA 3EF7A 1H43A 1EZ9A 1USYE 5HBCA 5BWJA 4NWCA 1B0LA 1ANFA 5BUUA 5AE4A 1A7LA 2GHBA 1IZ1A 2H98A 4L17A 5TPAA 3CFXA 3RN8A 5LOMA 3LC8A 3V83A 4LUBA 3DELB 2B3BA 4OEVA 5I84A 2OWTA 2Q2CA 3KG2A 3Q27A 4OETA 1POTA 4OESA 3K2DA 1M5DA 3R6UA 4BDMA 2GHAA 2YLNA 3TTLA 5ITOA 1A40A 5CI5A 2ZNSA 2OCUA 1LAGE 4TLLB 1GVCA 3C34A 4GF8A 4RY1A 4YKIA 3JYRA 4Z0IA 1M5FA 1URDA 4ZDMA 4O3CA 3O6HA 4YKJA 3KJTA 2ONSA 2NOOA 2ZYMA 1FTMA 3KOSA 4GL0A 2CMOA 5ICQA 3FJMA 3T9VA 1UTBA 4R2FA 3RT8A 3IB1A 4X1DA 1DMBA 4GLIA 1J1NA 1URSA 2CZLA 2M8CA 4GXAA 4GIZA 4IO5A 3RY3A 4EF2A 1A99A 3OEMA 1R6ZA 3OSRA 4H8IA 2B65A 1DTZA 1PB9A 4FECA 1SI0A 3FASA 5JK4A 4FIMA 3QAXA 2DWAA 3DP4A 4ELPA 1URGA 1Y1ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F35 A;  4OHN A;  3FVN A;  2RCA A;  2XHD A;  4FEB A;  3KN3 A;  3SEU A;  2AL4 A;  4WEP A;  4DCY A;  4GFR A;  1B05 A;  1TFA A;  3TQL A;  1EH3 A;  1DTG A;  1TT1 A;  3CVG A;  3E3K A;  2F34 A;  3G3I A;  3OEL A;  3R26 A;  4RK9 A;  1VFD A;  4RPO A;  1BLF A;  1MQG A;  1P1N A;  4EQ9 A;  5I57 B;  5KZT A;  1T0K A;  1OQG A;  2QL3 A;  4FAJ A;  1SDX A;  2I0B A;  1IXH A;  1US4 A;  1MY0 A;  5B7D A;  3THI A;  3KEI A;  1B7H A;  4UAC A;  4KYE A;  4C1U A;  1B1X A;  3FIR A;  3FJG A;  4E0X A;  3H6U A;  2VGQ A;  5I2N B;  3JZJ A;  1QW0 A;  3IR1 A;  5KDT B;  1B32 A;  3TEP A;  3Q29 A;  4NF5 B;  1ZBM A;  3QSL A;  4U21 A;  1A8F A;  3LSL A;  4YZZ A;  1B6H A;  3SER A;  3Q28 A;  2RIN A;  4POX A;  3K6V A;  2V25 A;  2XXQ A;  3KSJ A;  3MZ1 A;  5H8H A;  1LBC A;  3OXN A;  1XC1 A;  3M8U A;  4QFK A;  1H3D A;  3IJO B;  2QS3 A;  2O7U A;  3OSQ A;  3G3G A;  4OVJ A;  3IOW A;  2QMW A;  4PET A;  3E9X A;  3U1O A;  1NNK A;  3MP8 A;  2Q88 A;  1PDA A;  2P2A A;  2OZZ A;  1ZJL A;  3TAJ A;  5EHS A;  4O3B A;  1S7Y A;  1B0H A;  3E4R A;  3G3K A;  2NXO A;  4IO3 A;  2NWJ A;  1A54 A;  3PPN A;  3Q25 A;  4GVO A;  4ZED A;  1TXF A;  5CMC A;  1MQD A;  1AH5 A;  3KSX A;  4Q30 B;  1N7W A;  4G8M A;  2PVU A;  4Q0C A;  1VFE A;  5L9M A;  1FQB A;  1BP5 A;  1N04 A;  4RA1 A;  1SI1 A;  4NF5 A;  1DPE A;  1WVJ A;  3A3U A;  4LQ2 A;  2ANJ A;  5H8N B;  3GBB A;  2Y7I A;  4P0G A;  1OVB A;  3H6W A;  3QK6 A;  5H8N A;  3FVG A;  5I58 A;  4H67 A;  1QUJ A;  2G29 A;  2Z8E A;  3K1P A;  4G68 C;  4NF6 B;  4NMY A;  4G8N A;  5AA4 A;  1ZU0 A;  1GGG A;  2HXW A;  2F6P A;  1WDN A;  3IO6 A;  4IY5 A;  3D4C A;  4XTC Q;  4C0R A;  3RTF B;  3UP9 A;  4R2B A;  3KFM A;  3BFT A;  3O2A A;  3B6T A;  3C31 A;  1B1H A;  2DE3 A;  2Q2A A;  4JDF A;  1RYO A;  1SW2 A;  3E13 X;  4I9D A;  4THI A;  1SW5 A;  4YB6 A;  3MJN A;  3T9X B;  4ELR A;  4EUO A;  1BTJ A;  4ZEI A;  3IJX B;  4P11 A;  2IEE A;  2XX7 A;  2Y7W A;  2ZXT A;  5I2K B;  5HPQ A;  5I2K A;  5KCJ A;  2O6A A;  4KYS A;  4OQO A;  4F1V A;  1EZP A;  2DS9 A;  5H8S A;  3SEW A;  5A5X B;  4G2Z A;  3V5A A;  2F7B A;  1LFI A;  4IY6 A;  1MS7 A;  3RNN A;  4F22 A;  3O9P A;  1QJM A;  4ZZA A;  1O7T A;  3RTW B;  3GLB A;  2GH9 A;  3RUM A;  2QS1 A;  4XXU A;  1B58 A;  4BDR A;  3UK4 A;  3OO7 A;  1NNT A;  4G4P A;  4PFW A;  4F2O A;  4F3B A;  4NF6 A;  3U93 A;  3M3K A;  2Z23 A;  5TPA B;  4F2Q A;  2V84 A;  4U4X A;  1LAH E;  1NKX A;  2R6G E;  2QJE A;  2I3V A;  4R9G A;  4HW8 A;  2E1S A;  3PV0 E;  3T9U A;  3PD9 A;  5L9O A;  2XD2 A;  2Y7R A;  5CMK A;  2XXH A;  5ELV A;  5ICT A;  4XKN A;  1CB6 A;  1N0T A;  5H8F B;  4G8H A;  3TEL A;  4JB7 A;  2UYE A;  4BDO A;  1MQJ A;  3KN8 A;  3CR9 A;  5KCJ B;  2Y7P A;  4KQP A;  4R6Y A;  4ISU A;  3TDJ A;  3HO7 A;  1HSJ A;  4GQO A;  3U72 A;  4Z7E A;  2UYF A;  2RF1 A;  1B5J A;  2VD2 A;  2ZYO A;  4MBP A;  4X9T A;  1MQI A;  2XX8 A;  1ZMG A;  3LSW A;  4KPT A;  1LCT A;  2VHA A;  3FV1 A;  4ELQ A;  3IB0 A;  3OEK A;  3W9W A;  3N6U A;  2XXU A;  1NFT A;  3H03 A;  5I56 B;  2XXI A;  4KHZ E;  4LZ8 A;  3GBA A;  3RPW A;  1M5E A;  1HSE A;  2QMX A;  2UVI A;  3MZB A;  3MC2 A;  3CSB A;  2YJP A;  3K00 A;  3DP8 A;  3GZG A;  4NF8 A;  4YIC A;  3IB2 A;  1XT8 A;  4PE5 B;  4QRZ A;  5K2X A;  1M5C A;  4H5G A;  4F3S A;  2VP1 A;  2PX1 A;  4GRK A;  4OFL A;  1MM6 A;  4RNS A;  1H45 A;  1SYI A;  1Y3P A;  2F5X A;  1B9J A;  2DWH A;  2OK2 A;  3O66 A;  4OER A;  4RYA A;  3W15 C;  1I6B A;  4GOT A;  2X26 A;  3C36 A;  4FAT A;  4ZEC A;  2UVG A;  3UOR A;  4UA8 A;  3PD8 A;  3C33 A;  4R6H A;  1F9B A;  3C9H A;  2I48 A;  1QKB A;  4U1O A;  3UIF A;  4OFJ A;  2QSX A;  3VE1 B;  1PB8 A;  1A55 A;  4YB7 A;  5IAI A;  1RKM A;  1LAF E;  1MXY A;  2HEU A;  2RC7 A;  4QFP A;  2X7Q A;  4G68 A;  5AA3 A;  4F1U A;  2F7C A;  4IGT A;  4ZZE A;  3I5O A;  1YCJ A;  4IO4 A;  1A8E A;  1N3X A;  1LLS A;  3EPE A;  1JW5 A;  2F8D A;  4WKM A;  1B3L A;  3ILU B;  3MBP A;  3SKP A;  4NF8 B;  3O28 A;  3B7D A;  1N7X A;  3GXA A;  1SW1 A;  3KOT A;  2OJT A;  2A5T A;  2ESN A;  2D21 A;  2UVJ A;  1ATG A;  4KCC A;  4RK2 A;  1HSL A;  1OVT A;  4MF3 A;  4R72 A;  4XKQ A;  5CMB A;  1H76 A;  2F36 A;  3PMW A;  1O64 A;  4O3A A;  4OXV A;  1ZKB A;  1UTH A;  1UIV A;  3DM0 A;  3OD7 A;  2VOZ A;  4BDN A;  3O97 A;  4AB6 A;  2UXA A;  2DVZ A;  1AIV A;  1LFH A;  3TPA A;  2REJ A;  2IA4 A;  2Y7K A;  4OZ9 A;  1Z7M E;  2H5Y A;  3TCG A;  3EHS A;  4R73 A;  4AB5 A;  4DXU A;  1M5B A;  1PC3 A;  2F97 A;  3ODB A;  3VVD A;  3FD3 A;  1B4H A;  1MY1 A;  4R74 A;  3ZKK A;  3T93 B;  1OLC A;  4EQB A;  3PPP A;  2RC9 A;  3MPK A;  3T96 B;  4R9F A;  3TTM A;  5AA1 A;  3K6X A;  3PUY E;  3HPI A;  5AA4 B;  3KZG A;  1H44 A;  1XOC A;  1XVX A;  2XXX A;  1B40 A;  3O6G A;  4K3F A;  3ZSF A;  3PMX A;  4QSC A;  1DSN A;  2FA7 A;  2O84 X;  4ECF A;  3RT6 B;  3JV9 A;  4JWY A;  4LP2 B;  4NED A;  4POW A;  1GV8 A;  2NUV A;  5DT6 A;  3MQ9 A;  1Q1K A;  2UVH A;  2XX9 A;  3M3L A;  1P1W A;  4QF9 A;  4MLQ A;  3TZA A;  1I69 A;  3K01 A;  3BBR A;  1NH8 A;  4DE8 A;  1MY4 A;  2O68 A;  4KD5 A;  3DP6 A;  3K1N A;  3M3F A;  5ISU A;  3TUS A;  4YMB A;  1NH7 A;  3IO4 A;  2O7I A;  4C1T A;  3K6U A;  1LAX A;  3R7X A;  4F3P A;  3HHG A;  1B3E A;  3DLN A;  1Y3N A;  4NE4 A;  4OMB A;  1BIY A;  1MXV A;  1JW1 A;  1NNF A;  2F6G A;  1S9T A;  3L6H A;  4HS7 A;  4DLD A;  1USY H;  3MZ9 A;  4QHQ A;  5DVI A;  2YPN A;  1MXZ A;  3FGS A;  2ZYK A;  5H8H B;  4OTE A;  3TTR A;  2GRV A;  4F1Y A;  2G93 A;  2DXR A;  1FQD A;  2R71 A;  3VLU A;  4JSO A;  3CSG A;  1O63 A;  5HM4 B;  3PMV A;  3IX1 A;  1LB9 A;  5H8F A;  3A09 A;  2Z22 A;  2WKY A;  1PBP A;  3FXR A;  3SEX A;  4U2R A;  2OLB A;  3W9V A;  2V93 A;  5EHM A;  4U22 A;  4QFL A;  4YKK A;  3H06 B;  4N07 A;  1MY3 A;  3C32 A;  1ELJ A;  3FAT A;  3FXQ A;  3OEN A;  4OYV A;  4JXI A;  3T22 A;  4R6K A;  1IXI A;  3VXB A;  4ZE8 A;  2DP8 A;  3Q26 A;  3RLF E;  3TMG A;  2O1M A;  4F31 B;  1B2H A;  1R1N A;  2P0S A;  1OMP A;  3PUW E;  2QRY A;  1PBQ A;  4ZEB A;  2Q9T A;  1LCF A;  1FTJ A;  1NNP A;  1S50 A;  2RKM A;  3MP6 A;  1MRP A;  4TOZ A;  4AQ4 A;  4PFY A;  2ABH A;  4NTL A;  2ZNU A;  2QS4 A;  3K1M A;  2I6E A;  3HN0 A;  2DWI A;  4JBZ A;  1B51 A;  4KCD A;  1D9V A;  3FXU A;  1BKA A;  3H6V A;  3S2V A;  1YAE A;  5I59 B;  5I59 A;  2DQV A;  3IL1 B;  2FNC A;  1QKA A;  1WOD A;  2Q89 A;  4H5F A;  3VVE A;  3ILT B;  1IUD A;  4DZ1 A;  4JWX A;  4I1D A;  5CBS A;  3KGC A;  3IOU A;  3PPQ A;  3HV1 A;  4FJP A;  2D3I A;  3RGY A;  3WAE A;  2ONK E;  1IQ7 A;  1EZO A;  5L9S A;  5DVF A;  5DVJ A;  3HHF A;  2BJJ X;  3S9M C;  2P1S A;  1MM7 A;  1XHY A;  3VFJ A;  5IKB A;  3L6G A;  1MDP 1;  2H99 A;  3ECR A;  3HST A;  3F11 A;  3CI8 A;  1IXG A;  3MAM A;  4GL8 A;  4I8C A;  4LON B;  4EQ7 A;  3LBS A;  1Q35 A;  4E0W A;  1JEU A;  1I6A A;  4X48 A;  3IAZ A;  1YPN A;  2HAV A;  4GXS B;  4P0I A;  4WED A;  3MUQ A;  1DOT A;  1JVY A;  3MW0 A;  4NF4 A;  4ND9 A;  3H6T A;  3B6W A;  3BFU A;  4GWO A;  1B46 A;  4MH5 A;  4YU0 A;  4HCW A;  3VVF A;  3RQT A;  3VV5 A;  4LVQ A;  3S9E A;  1JNF A;  3MVZ A;  4M1V A;  1DPP A;  3SET A;  1JQF A;  4JSD A;  5FTH A;  4EXL A;  5H8Q A;  3B6Q A;  4BLA A;  1IIT A;  1GTK A;  1XS5 A;  1Y9U A;  2GFE A;  3OMB A;  1B52 A;  3FUZ A;  1QUK A;  3G7W A;  5CM6 A;  4OWD A;  2O69 A;  4RJZ A;  1CE2 A;  2FYI A;  4PFT A;  3S9L C;  3K6W A;  4DXB A;  3UA8 A;  1JEV A;  1JW4 A;  2A5S A;  4DDD A;  5I56 A;  1B5H A;  2AYS A;  5J1D A;  1GR2 A;  2HQ0 A;  2Y84 A;  3N94 A;  1JVX A;  2H9B A;  4EXK A;  4RPN A;  3FV2 A;  5K2Y A;  2R9J A;  4IO2 A;  1SQY A;  5AA2 D;  4H1X A;  2I3W A;  3QYT A;  4LZ5 A;  5FHO A;  4G77 A;  3TYH A;  4WXJ A;  3D4G A;  1OLA A;  4ZS9 A;  4N13 A;  2XXV A;  4NF4 B;  5FHN A;  1TFD A;  4JWO A;  3V8X B;  5I57 A;  4MLV A;  4HTG A;  3EHT A;  3EQ1 A;  4U4S A;  4DCX A;  2QPQ A;  3SES A;  3EHU A;  3PU5 A;  1D3K A;  2XXP A;  5I2N A;  3MP1 A;  1Z7N E;  3CIJ A;  1B3H A;  4IB2 A;  4OEN A;  2ONR A;  2PMS A;  3FVK A;  2PYY A;  1QUI A;  4ESX A;  2XXY A;  5KDT A;  1AOV A;  1B7Z A;  1ZLQ A;  2DE2 A;  3UGW A;  1JET A;  2OBG A;  4H65 A;  4R75 A;  2PT1 A;  1MXX A;  4KYD A;  4F29 A;  4G68 B;  1R9Q A;  4LAT A;  3V89 B;  3FJ7 A;  3VDF A;  1FTO A;  2F78 A;  2I58 A;  5DEX B;  2DYX A;  1FQE A;  3KBR A;  1VE4 A;  5JTY A;  4ELO A;  1B3G A;  1ZTY A;  4ONY A;  3CFZ A;  3CRB A;  2THI A;  3QUF A;  1N76 A;  3EN3 A;  3CG3 A;  3SEY A;  4PQJ A;  3UN6 A;  3TFL A;  1UQW A;  5M2V A;  1Y3Q A;  1QVS A;  2I49 A;  4LA9 A;  3TOD A;  3I3V A;  2O51 A;  4U1Z A;  1UIU A;  3H3G A;  4QFN A;  2RC8 A;  1L5T A;  1OIB A;  1MPD A;  5ITP A;  3S9N C;  3S4U A;  2HFB A;  1QUL A;  2AIX A;  2Z8D A;  1IEJ A;  1ZIU A;  3MVY A;  4NWD A;  4Q8R A;  1US5 A;  2XXR A;  2A5T B;  1NMU A;  4KI0 E;  2XD3 A;  1I6Q A;  5H8Q B;  1MQH A;  3K02 A;  5JEI A;  4M4G A;  3QIM A;  3MVX A;  3IK6 B;  4FOR A;  2PBW A;  4KR5 A;  3SEV A;  4TLM B;  2B3F A;  2V3U A;  1AL3 A;  2DWJ A;  2LAO A;  1P1U A;  1RYX A;  1P99 A;  4XKR A;  5DEX A;  3KJ7 A;  2W7Y A;  5F1Q A;  4XKP A;  2XXT A;  3LR1 A;  1MXU A;  1OQH A;  2HZK A;  1MPB A;  3H7M A;  3MVW A;  3U8Q A;  2I4C A;  4KFQ A;  4FED A;  3G3F A;  4IO6 A;  4YB5 A;  2RCB A;  1POY 1;  3LSX A;  2ZMB A;  3LUY A;  3OO9 A;  4QFO A;  3C35 A;  3HCQ A;  4Q5T A;  4ZEK A;  4RXL A;  2DSF A;  5L8D A;  2Z8F A;  4DXC A;  1B5I A;  3TTK A;  1D9Y A;  2DVC A;  4BDQ A;  4LZ7 A;  2O1L A;  1B3F A;  4XIG Q;  1MY2 A;  3PPR A;  2NVU B;  5EYF A;  4YMA A;  1FQA A;  1YTV A;  4IGR A;  3FZV A;  3N6T A;  4H6D A;  2AL5 A;  4MFI A;  3ONM A;  1IIW A;  1II5 A;  1KWH A;  1N3W A;  3A3C A;  1XVY A;  2DXY A;  2V3T A;  3P7I A;  5DYH A;  2D5W A;  3T9H B;  4QSE A;  4DIG A;  4EF1 A;  1N84 A;  3AXF A;  3VXC A;  1UTB B;  3LSF B;  2ZNT A;  3KN7 A;  3N5L A;  1R9L A;  2XXW A;  3PUV E;  4FE8 A;  2I4B A;  4U23 A;  5TU0 A;  3U92 A;  2H25 A;  3PUX E;  1VR5 A;  2HZL A;  3BKI B;  2I0C A;  3TQW A;  1B4Z A;  1Y20 A;  5CMM A;  1FQF A;  5TP9 B;  3ZS6 A;  5F7V A;  5TP9 A;  3OO6 A;  1MDQ A;  3OO8 A;  1IXC A;  2REG A;  3IOV A;  3PGF A;  4X1B A;  4F3G A;  1LFG A;  1MH4 A;  4LQ5 A;  4YKP A;  3TCF A;  3QXM A;  1LBB A;  2HCA A;  3CFL A;  4QSD A;  3VLV A;  5B70 A;  3WAF A;  3MPL A;  1MG1 A;  3IOR A;  5AA2 B;  5AA2 A;  1EU8 A;  2HAU A;  2V3Q A;  1SBP A;  4H0W A;  2ALU A;  3TCH A;  1B7U A;  2VD3 A;  4OEU A;  4BDL A;  4N6P A;  4ZE9 A;  1MPC A;  3K4U A;  3MWB A;  3PUZ E;  5CRY A;  1MXW A;  1SVX B;  2DE4 A;  1VSO A;  4TQU Q;  3USD A;  1Y4C A;  3K0V A;  1FW0 A;  3I6V A;  3TKD A;  3VLW A;  1Y1M A;  2X7P A;  4PFU A;  1LST A;  1Y4T A;  4HCY A;  2PT2 A;  1FTL A;  1SD3 A;  5DTB A;  3T66 A;  4EDP A;  4F39 A;  3PPO A;  1TWY A;  4F18 A;  2DOJ A;  2E0S A;  5CC2 A;  4I62 A;  1LB8 A;  3G3J A;  3SDF A;  1FCK A;  2QS2 A;  2H4I A;  3IOT A;  5CBR A;  1D4N A;  3TTN A;  4ESW A;  1AMF A;  3H4Z A;  1FQC A;  3OOA A;  4PP0 A;  4ZEF A;  1SW4 A;  3CG1 A;  1LGB C;  1UTH B;  2ZYN A;  3N26 A;  1MH3 A;  4IO7 A;  5FTI A;  2KLF A;  1P1Q A;  4GD5 A;  2F7A A;  4YAH X;  2Q8J A;  1P1O A;  1SYH A;  5A5X A;  2OWS A;  3FVO A;  1NL5 A;  3O29 A;  4H8J A;  4OFO A;  3ZKL A;  1PB7 A;  3U94 A;  3C4M A;  3O6I A;  3QUJ A;  1PEB A;  3G3H A;  5JTY B;  5I58 B;  4F19 A;  1FTK A;  5FHM A;  3EF7 A;  1H43 A;  1EZ9 A;  1USY E;  5HBC A;  5BWJ A;  4NWC A;  1B0L A;  1ANF A;  5BUU A;  5AE4 A;  1A7L A;  2GHB A;  1IZ1 A;  2H98 A;  4L17 A;  5TPA A;  3CFX A;  3RN8 A;  5LOM A;  3LC8 A;  3V83 A;  4LUB A;  3DEL B;  2B3B A;  4OEV A;  5I84 A;  2OWT A;  2Q2C A;  3KG2 A;  3Q27 A;  4OET A;  1POT A;  4OES A;  3K2D A;  1M5D A;  3R6U A;  4BDM A;  2GHA A;  2YLN A;  3TTL A;  5ITO A;  1A40 A;  5CI5 A;  2ZNS A;  2OCU A;  1LAG E;  4TLL B;  1GVC A;  3C34 A;  4GF8 A;  4RY1 A;  4YKI A;  3JYR A;  4Z0I A;  1M5F A;  1URD A;  4ZDM A;  4O3C A;  3O6H A;  4YKJ A;  3KJT A;  2ONS A;  2NOO A;  2ZYM A;  1FTM A;  3KOS A;  4GL0 A;  2CMO A;  5ICQ A;  3FJM A;  3T9V A;  1UTB A;  4R2F A;  3RT8 A;  3IB1 A;  4X1D A;  1DMB A;  4GLI A;  1J1N A;  1URS A;  2CZL A;  2M8C A;  4GXA A;  4GIZ A;  4IO5 A;  3RY3 A;  4EF2 A;  1A99 A;  3OEM A;  1R6Z A;  3OSR A;  4H8I A;  2B65 A;  1DTZ A;  1PB9 A;  4FEC A;  1SI0 A;  3FAS A;  5JK4 A;  4FIM A;  3QAX A;  2DWA A;  3DP4 A;  4ELP A;  1URG A;  1Y1Z A; 
#chains in the Genus database with same CATH topology
 5I3S A;  2XHD A;  3SEU A;  1TFA A;  3TQL A;  1DTG A;  3CVG A;  4RK9 A;  3E3K A;  3T9U A;  1VFD A;  2B4L A;  1SDX A;  5B7D A;  3KEI A;  1B7H A;  1G0H A;  4C1U A;  1B1X A;  3JZJ A;  3Q29 A;  4POX A;  3MZ1 A;  1LBC A;  3M8U A;  2F3B A;  4OVJ A;  3U1O A;  3G3G A;  1PDA A;  1ZJL A;  3KC0 A;  3Q25 A;  4PF8 A;  1N7W A;  4LQ2 A;  3A3U A;  2WEF A;  5I58 A;  1FPF A;  1NV1 A;  4G8N A;  2HXW A;  1GGG A;  2F6P A;  3UP9 A;  3KFM A;  4GWX A;  4THI A;  1B1H A;  2F3D A;  2IEE A;  5I2K B;  4GX3 A;  4KYS A;  4F1V A;  2DS9 A;  5H8S A;  3SEW A;  4IY6 A;  3RNN A;  1IMF A;  5IZ3 B;  4XXU A;  4F3B A;  5TPA B;  4R9G A;  2I3V A;  2E1S A;  3PV0 E;  2XD2 A;  5ELV A;  1CB6 A;  4G8H A;  2UYE A;  1NUY A;  1MQJ A;  3KN8 A;  5KCJ B;  4R6Y A;  2FVZ A;  1ZMG A;  3IB0 A;  1FBF A;  2XXI A;  1M5E A;  5EYH A;  2CEY A;  3MC2 A;  4QRZ A;  5K2X A;  2VP1 A;  2PX1 A;  4GRK A;  4OFL A;  4RNS A;  2OK2 A;  4RYA A;  3W15 C;  4GOT A;  3C36 A;  2XA5 A;  4G61 A;  4U1O A;  2I48 A;  4OFJ A;  4YB7 A;  5IAI A;  2RC7 A;  4QFP A;  4F1U A;  4IGT A;  1YCJ A;  4IO4 A;  1B3L A;  3SKP A;  3KOT A;  4DI4 B;  1IMC A;  4RK2 A;  4R72 A;  1ZKB A;  4MNI A;  1UTH A;  2QVU A;  3OD7 A;  4BDN A;  1LFH A;  3O97 A;  4N81 A;  4OZ9 A;  3TCG A;  3EHS A;  3RPL A;  3ZKK A;  3FD3 A;  1OLC A;  3T96 B;  3TTM A;  4R9F A;  3HPI A;  5AA4 B;  5I5P A;  1H44 A;  1XOC A;  2JJK A;  4H45 A;  3PMX A;  4QSC A;  1DSN A;  2O84 X;  4ECF A;  3RT6 B;  3JV9 A;  2XX9 A;  4MLQ A;  2O68 A;  5ISU A;  3M3F A;  3TUS A;  4PDH A;  1FJ9 A;  5IGA A;  3HHG A;  1BIY A;  1JW1 A;  4DLD A;  1S9T A;  4HS7 A;  3FGS A;  2R71 A;  4JSO A;  3CSG A;  1O63 A;  5HM4 B;  3D1R A;  3IX1 A;  1LB9 A;  5EQ7 A;  5H8F A;  3A09 A;  1PBP A;  4U2R A;  3W9V A;  2V93 A;  4NG7 A;  3H06 B;  3T22 A;  1ELJ A;  3FAT A;  4OYV A;  2XWV A;  1IXI A;  3VXB A;  4ZE8 A;  4F31 B;  3RLF E;  2O1M A;  1KA0 A;  2QS4 A;  3RYD A;  3S2V A;  2DQV A;  2FNC A;  1WOD A;  2Q89 A;  2CZK A;  3ILT B;  3IOU A;  3A29 A;  5EYG A;  3RGY A;  5L9S A;  5DVF A;  1XHY A;  3RPL B;  2ZZX A;  4P1L A;  2H99 A;  4GL8 A;  1IXG A;  1NV5 A;  4LON B;  3LBS A;  1Q35 A;  3FXB A;  2HPG A;  4WED A;  3MW0 A;  4MH5 A;  4YU0 A;  4HCW A;  4LVQ A;  3S9E A;  3SET A;  3MVZ A;  3B6Q A;  1IIT A;  1XS5 A;  2GFE A;  3ROJ A;  1DK4 A;  5CM6 A;  4RJZ A;  4PFT A;  1NV7 A;  4DXB A;  3UA8 A;  1JEV A;  5I56 A;  2AYS A;  1GR2 A;  2HQ0 A;  2Y84 A;  2R9J A;  4IO2 A;  3QYT A;  3TYH A;  4NF4 B;  5FHN A;  3V8X B;  5IZZ A;  1TFD A;  4U4S A;  4DCX A;  3PU5 A;  3MP1 A;  2PMS A;  1AOV A;  1B7Z A;  1ZLQ A;  4R75 A;  4H65 A;  1MXX A;  4KYD A;  3VDF A;  1FTO A;  5DEX B;  2DYX A;  3KBR A;  5JTY A;  2PFY A;  4ONY A;  3CRB A;  3QUF A;  1N76 A;  3CG3 A;  3SEY A;  4PQJ A;  4LA9 A;  4U1Z A;  4QFN A;  2RC8 A;  1MPD A;  1US5 A;  1AWB A;  5H8Q B;  3QIM A;  3MVX A;  4FOR A;  1VDW A;  4KR5 A;  1P99 A;  2XXT A;  2HZK A;  3H7M A;  4FED A;  4IO6 A;  1YYZ A;  4P56 A;  4XEQ A;  2ZMB A;  1D9Y A;  2DVC A;  1MY2 A;  3PPR A;  3MST A;  4YMA A;  4EF1 A;  3N6T A;  3ONM A;  1II5 A;  1N3W A;  2V3T A;  1FBH A;  3AXF A;  3VXC A;  3LSF B;  4FE8 A;  3N5L A;  2XXW A;  2I4B A;  1VR5 A;  3BKI B;  3TQW A;  5TP9 B;  5TP9 A;  4PTK A;  3OO6 A;  3IOV A;  2REG A;  3PGF A;  4MJO A;  4YKP A;  3MPL A;  3IOR A;  5AA2 A;  4O8M A;  4BDL A;  3TCH A;  4N6P A;  3MWB A;  1MXW A;  1SVX B;  2DE4 A;  1FPE A;  3USD A;  1FW0 A;  3TKD A;  4PFU A;  5DTB A;  4GWS A;  4F39 A;  3T66 A;  4N6K A;  2ZZW A;  1TWY A;  4I62 A;  4GX6 A;  1D4N A;  4ESW A;  3OOA A;  3RPW A;  1SW4 A;  3CG1 A;  4IO7 A;  5FTI A;  2OWS A;  4JVC A;  4H8J A;  4OFO A;  2QFL A;  1PB7 A;  3O6I A;  1PEB A;  3G3H A;  1H43 A;  5HBC A;  1USY E;  1D9Q A;  5AE4 A;  5TPA A;  3RN8 A;  3LC8 A;  5I84 A;  2Q2C A;  4OET A;  1M5D A;  3R6U A;  4N91 A;  5ITO A;  2ZNS A;  4TLL B;  2WYK A;  4ZDM A;  1URD A;  4YKJ A;  2ONS A;  2NOO A;  3KOS A;  1FTM A;  4MIJ A;  3FJM A;  4X1D A;  4GLI A;  4IO5 A;  2CZL A;  4GXA A;  2CZH A;  3FBP A;  5L9O A;  3OEM A;  1PB9 A;  1JP4 A;  5JK4 A;  2DWA A;  1B51 A;  3DP4 A;  1Y1Z A;  4OHN A;  2RCA A;  4FEB A;  4WEP A;  1EH3 A;  3OEL A;  3R26 A;  1T0K A;  1OQG A;  2QL3 A;  2I0B A;  4UAC A;  3H6U A;  3GYY A;  1B32 A;  2FHY A;  3SER A;  3Q28 A;  2RIN A;  3OXN A;  3U65 A;  4QFK A;  1H3D A;  2QS3 A;  2O7U A;  3IOW A;  2QMW A;  3B50 A;  1NNK A;  3MP8 A;  4GX4 A;  2Q88 A;  2P2A A;  3TAJ A;  3E4R A;  1A54 A;  3PPN A;  4GVO A;  1AH5 A;  3KSX A;  4Q0C A;  1VFE A;  1BP5 A;  2Y7I A;  4GWZ A;  4H67 A;  4NF6 B;  1WDN A;  4C0R A;  4R2B A;  5ET7 A;  2DE3 A;  1SW2 A;  1YZ0 A;  4I9D A;  3T9X B;  4ELR A;  4YB6 A;  1NV2 A;  2Y7W A;  5KCJ A;  1EZP A;  4G2Z A;  4F22 A;  3RTW B;  4ZZA A;  1O7T A;  3MYU A;  1NNT A;  4FBP A;  4G4P A;  4PFW A;  2QJE A;  3PD9 A;  1IMD A;  5H8F B;  3CR9 A;  4Z7E A;  3HO7 A;  1HSJ A;  3U72 A;  3CHG A;  1DBZ A;  2VD2 A;  4MBP A;  4KPT A;  3FV1 A;  4ELQ A;  3OEK A;  2KR0 A;  2XXU A;  1NFT A;  3N6U A;  5I56 B;  4LZ8 A;  2UVI A;  3DP8 A;  3GZG A;  4JVD A;  4YIC A;  1XT8 A;  4H5G A;  2F5X A;  1B9J A;  1Q9D A;  4OER A;  3O66 A;  4PBQ A;  1NV0 A;  1I6B A;  4X8R A;  4FAT A;  2Q8M A;  3C33 A;  4R6H A;  3C9H A;  2PFZ A;  3VE1 B;  1PB8 A;  1RKM A;  2HEU A;  1MXY A;  2F7C A;  3T0J A;  3I5O A;  4WKM A;  4GBV A;  4NF8 B;  1SW1 A;  2OJT A;  2UVJ A;  1HSL A;  1OVT A;  1H76 A;  4PCD A;  3PMW A;  4O3A A;  2UXA A;  4AB5 A;  4R73 A;  3T1B A;  1M5B A;  1PC3 A;  3ODB A;  4R74 A;  5AA1 A;  3K6X A;  2XXX A;  2XWO A;  3MQ9 A;  2UVH A;  4HE1 A;  3K01 A;  1MY4 A;  1NUW A;  4YMB A;  1NH7 A;  3K6U A;  4N6D A;  4MHF A;  4OMB A;  3L6H A;  1FBG A;  3MZ9 A;  5DVI A;  4OTE A;  2GRV A;  4F1Y A;  2G93 A;  1KA1 A;  2R8T A;  4JVI A;  1YXI A;  2OLB A;  5EHM A;  4YKK A;  1MY3 A;  4R6K A;  1B2H A;  4ZEB A;  1FTJ A;  1S50 A;  3MP6 A;  4TOZ A;  1MRP A;  2ZNU A;  2DWI A;  1D9V A;  3FXU A;  1BKA A;  5I59 B;  5I59 A;  4NN3 A;  3VVE A;  1IUD A;  3PPQ A;  2D3I A;  2CEX A;  3WAE A;  2QVV A;  4PFR A;  3HHF A;  4PAK A;  4MX6 A;  3MAM A;  4PDD A;  1FJ6 A;  1JEU A;  1I6A A;  1LBX A;  3IAZ A;  1YPN A;  4P0I A;  3MUQ A;  1JVY A;  4ND9 A;  2FIE A;  3B6W A;  3RQT A;  1JNF A;  1DPP A;  5FTH A;  1G0I A;  4BLA A;  1IME A;  3FUZ A;  1QUK A;  2O69 A;  2WX9 A;  3S9L C;  4UAB A;  5J1D A;  4O7I A;  5FHO A;  4P47 A;  4QBA A;  1FRP A;  4I3Y A;  4MLV A;  3EQ1 A;  2KQZ A;  3KC1 A;  2XXP A;  1Z7N E;  4IB2 A;  2Q74 A;  2ONR A;  4P8B A;  4PFI A;  3FVK A;  1QUI A;  4XF5 A;  1NUZ A;  1R9Q A;  4LAT A;  3V89 B;  3FJ7 A;  2I58 A;  1FQE A;  1B3G A;  3CFZ A;  3EN3 A;  4OVQ A;  1QVS A;  2O51 A;  1UIU A;  5ITP A;  3S9N C;  3S4U A;  2HFB A;  4NWD A;  1NMU A;  5JEI A;  1LBW A;  4M4G A;  1NV4 A;  3IK6 B;  4HE2 A;  2B3F A;  1P1U A;  5DEX A;  2W7Y A;  3LR1 A;  1MPB A;  4KFQ A;  4YB5 A;  1POY 1;  3OO9 A;  3LUY A;  4Q5T A;  4RXL A;  2Z8F A;  1B5I A;  3TTK A;  4BDQ A;  4O94 A;  4MFI A;  5H8Q A;  2AL5 A;  1KWH A;  4O7M A;  2DXY A;  3T9H B;  2L5V A;  4DIG A;  1N84 A;  3KN7 A;  1R9L A;  4U23 A;  3U92 A;  2H25 A;  2I0C A;  1B4Z A;  3ZS6 A;  1RDY A;  1MDQ A;  1IXC A;  4F3G A;  4LQ5 A;  3TCF A;  2HCA A;  1EU8 A;  2HAU A;  2V3Q A;  4H0W A;  4ZE9 A;  3PUZ E;  5CRY A;  4TQU Q;  1DCU A;  1Y4C A;  3K0V A;  4HE0 A;  4HCY A;  5CC2 A;  3G3J A;  3SDF A;  1FCK A;  5CBR A;  2NVU B;  4ZEF A;  1LGB C;  2ZYN A;  3N26 A;  4GD5 A;  2F7A A;  1SYH A;  5A5X A;  5EQ9 A;  3FVO A;  5DW8 A;  3QUJ A;  5JTY B;  5I58 B;  5FHM A;  3EF7 A;  4NWC A;  5BUU A;  3HFU A;  1BK4 A;  1A7L A;  2GHB A;  1IZ1 A;  2H98 A;  5LOM A;  3CFX A;  3V83 A;  4NX1 A;  2B3B A;  3Q27 A;  3K2D A;  3E78 A;  4BDM A;  2GHA A;  3TTL A;  1A40 A;  1LAG E;  3C34 A;  2VPN A;  3KJT A;  4GL0 A;  1UTB A;  4R2F A;  1A99 A;  4H8I A;  4XFE A;  4EQ7 A;  4ELP A;  2F35 A;  3KN3 A;  1IMB A;  4DCY A;  1B05 A;  1TT1 A;  2F34 A;  3G3I A;  5I57 B;  3KBZ A;  1US4 A;  4E0X A;  4KYE A;  3FJG A;  5KDT B;  2DDK A;  3TEP A;  4NF5 B;  4IR8 A;  1ZBM A;  3QSL A;  4YZZ A;  1A8F A;  1B6H A;  3BIH A;  2V25 A;  2XXQ A;  3KSJ A;  4GWW A;  1XC1 A;  4OVS A;  5FBP A;  3IJO B;  4PET A;  3OSQ A;  3E9X A;  2OZZ A;  5EHS A;  4O3B A;  4GWY A;  1B0H A;  3G3K A;  2NWJ A;  1TXF A;  5CMC A;  4PBH A;  1FQB A;  1N04 A;  4RA1 A;  1WVJ A;  4X04 A;  4P0G A;  3QK6 A;  3FVG A;  1FBC A;  4OAN A;  3K1P A;  5IZ1 A;  4NMY A;  1ZU0 A;  3D4C A;  1IMA A;  3RTF B;  3C31 A;  2Q2A A;  1RYO A;  1BTJ A;  3IJX B;  2XX7 A;  5I2K A;  2O6A A;  4OQO A;  1RDX A;  1LFI A;  5IZ3 A;  4KXP A;  3RUM A;  2QS1 A;  3OO7 A;  4NF6 A;  3U93 A;  2Z23 A;  2V84 A;  4U4X A;  1LAH E;  1NKX A;  4HW8 A;  3E79 A;  5CMK A;  5ICT A;  4XKN A;  3TEL A;  4BDO A;  5T3J A;  3B8B A;  2Y7P A;  3TDJ A;  2UYF A;  2ZYO A;  2XX8 A;  3LSW A;  1LCT A;  2VHA A;  1XI6 A;  3W9W A;  3H03 A;  4P1E A;  4KHZ E;  2OX3 A;  2QMX A;  4NF8 A;  2YJP A;  3K00 A;  3IB2 A;  4PE5 B;  1MM6 A;  2XWI A;  2X26 A;  3UOR A;  3BIG A;  1A55 A;  4G68 A;  1NV3 A;  4ZZE A;  1N3X A;  2F8D A;  3ILU B;  3B7D A;  4OVT A;  2A5T A;  2D21 A;  1ATG A;  3PTY A;  4OXV A;  4AB6 A;  2DVZ A;  3TPA A;  2REJ A;  2IA4 A;  2Y7K A;  4DXU A;  1Z7M E;  3VVD A;  2F97 A;  1SPI A;  3PUY E;  4MNP A;  3KZG A;  3O6G A;  3ZSF A;  2FA7 A;  1FBP A;  4POW A;  4NED A;  1GV8 A;  2NUV A;  5F24 A;  3TZA A;  3BBR A;  1NH8 A;  3DP6 A;  2HXR A;  3K1N A;  3IO4 A;  1EYJ A;  3R7X A;  4F3P A;  3DLN A;  4PGN A;  3IFA A;  2F6G A;  3SZP A;  1INP A;  2YPN A;  1MXZ A;  5H8H B;  2DXR A;  1FQD A;  2WKY A;  4U22 A;  4QFL A;  4N07 A;  3OEN A;  3Q26 A;  1OMP A;  1NNP A;  2RKM A;  4AQ4 A;  4PFY A;  3HN0 A;  4JBZ A;  4AS5 A;  4KCD A;  2WBB A;  4H5F A;  4I1D A;  4N8Y A;  1IQ7 A;  3S9M C;  2P1S A;  1MM7 A;  5IKB A;  3L6G A;  1MDP 1;  3F11 A;  5EQA A;  2HAV A;  1DOT A;  3H6T A;  4I3E A;  1B46 A;  3VVF A;  3VV5 A;  1JQF A;  4EXL A;  3OMB A;  1B52 A;  1CE2 A;  2FYI A;  3K6W A;  2A5S A;  4PFB A;  4EXK A;  3N94 A;  4OA4 A;  2H9B A;  4H1X A;  2I3W A;  4LZ5 A;  2XXV A;  5I57 A;  4HTG A;  2QPQ A;  3SES A;  3EHU A;  2PYY A;  5KDT A;  2XXY A;  2DE2 A;  2OBG A;  1EYI A;  5ET8 A;  4F29 A;  1CNQ A;  4MAG A;  4P9K A;  2THI A;  3UN6 A;  1UQW A;  2I49 A;  3TOD A;  1KZ8 A;  4LN5 A;  3H3G A;  4GWU A;  4PAF A;  1QUL A;  2Z8D A;  1ZIU A;  2XXR A;  4KI0 E;  3K02 A;  2PBW A;  1FPI A;  4P3L A;  2LAO A;  1RYX A;  5F1Q A;  4XKP A;  2I4C A;  2RCB A;  3LSX A;  3C35 A;  1FBD A;  5L8D A;  4DXC A;  2FIX A;  2O1L A;  1B3F A;  4IGR A;  4TLM B;  1LBZ A;  3A3C A;  1IIW A;  1LBY A;  3P7I A;  5AA3 A;  2ZNT A;  5TU0 A;  3PUX E;  2HZL A;  1Y20 A;  1FQF A;  5F7V A;  4X1B A;  1LFG A;  1MH4 A;  4GBW A;  1FPL A;  1LBB A;  4QSD A;  5B70 A;  5AA2 B;  4HXV A;  1SBP A;  2ALU A;  1B7U A;  4OEU A;  4PF6 A;  1MPC A;  3K4U A;  2X7P A;  1LST A;  1Y4T A;  2PT2 A;  1FTL A;  3PPO A;  2DOJ A;  2PCR A;  1LB8 A;  3LV0 A;  4DI3 D;  2QS2 A;  2H4I A;  3IOT A;  3H4Z A;  4PP0 A;  1MH3 A;  2BJI A;  3O29 A;  4MCO A;  3C4M A;  4PE3 A;  1FTK A;  1ANF A;  1EYK A;  5EQ8 A;  4OEV A;  2B4M A;  3KG2 A;  4OES A;  4N15 A;  4AS4 A;  4RY1 A;  3JYR A;  1M5F A;  3EKI A;  4O3C A;  2CMO A;  4OVP A;  3RT8 A;  1DMB A;  3RY3 A;  1URS A;  2V4C A;  4GIZ A;  3OSR A;  1R6Z A;  2B65 A;  1DTZ A;  1SI0 A;  4FIM A;  3QAX A;  2OWZ A;  5ET5 A;  4N8G A;  3FVN A;  2AL4 A;  4GFR A;  4RPO A;  1BLF A;  1MQG A;  1P1N A;  4EQ9 A;  5KZT A;  4PC9 A;  4FAJ A;  1NI9 A;  1IXH A;  1MY0 A;  3THI A;  5I2N B;  3FIR A;  2VGQ A;  1QW0 A;  3IR1 A;  4U21 A;  3LSL A;  3K6V A;  5H8H A;  2P3V A;  1S7Y A;  2NXO A;  4IO3 A;  4ZED A;  1MQD A;  4Q30 B;  4G8M A;  2PVU A;  5L9M A;  1SI1 A;  4NF5 A;  1DPE A;  2ANJ A;  5H8N B;  3GBB A;  3IFC A;  2FBP A;  1OVB A;  3H6W A;  5H8N A;  4N17 A;  1QUJ A;  2G29 A;  2Z8E A;  4G68 C;  5AA4 A;  3IO6 A;  4IY5 A;  4XTC Q;  3BFT A;  3O2A A;  3B6T A;  1FPK A;  4JDF A;  3E13 X;  1SW5 A;  3MJN A;  4ZEI A;  4P11 A;  2ZXT A;  5HPQ A;  1NV6 A;  2WBD A;  4PAI A;  5A5X B;  3V5A A;  2F7B A;  1LBV A;  1MS7 A;  2CZI A;  1QJM A;  3O9P A;  1FPG A;  3GLB A;  2GH9 A;  1B58 A;  4BDR A;  3UK4 A;  4F2O A;  3M3K A;  1RDZ A;  4F2Q A;  2R6G E;  1LEV A;  2Y7R A;  2XXH A;  1N0T A;  4JB7 A;  4KQP A;  4ISU A;  4GQO A;  2VPO A;  2RF1 A;  1B5J A;  4NF0 A;  4X9T A;  1MQI A;  2HHM A;  4NHB A;  5IM2 A;  3GBA A;  1HSE A;  3MZB A;  3CSB A;  1M5C A;  1H45 A;  1SYI A;  1Y3P A;  2DWH A;  2UVG A;  4UA8 A;  3PD8 A;  1F9B A;  1QKB A;  3UIF A;  1FPJ A;  4N4U A;  2QSX A;  1LAF E;  2X7Q A;  2Y5L A;  2ZZV A;  1A8E A;  1LLS A;  3EPE A;  1JW5 A;  3MBP A;  1QGX A;  3O28 A;  1N7X A;  3GXA A;  2ESN A;  4KCC A;  4XKQ A;  4MF3 A;  5CMB A;  2F36 A;  1O64 A;  3DM0 A;  1UIV A;  2VOZ A;  1AIV A;  4F3S A;  2H5Y A;  1FPD A;  1B4H A;  1MY1 A;  4EQB A;  3T93 B;  3PPP A;  2RC9 A;  3MPK A;  1XVX A;  1B40 A;  4K3F A;  4NQ8 A;  4LP2 B;  4JWY A;  1K9Z A;  4QXD A;  5DT6 A;  1Q1K A;  3M3L A;  1P1W A;  4QF9 A;  2P3N A;  1I69 A;  4DE8 A;  4KD5 A;  2O7I A;  4C1T A;  1LAX A;  3LUZ A;  1NUX A;  1B3E A;  1Y3N A;  4NE4 A;  1MXV A;  1NNF A;  1USY H;  4QHQ A;  2ZYK A;  3TTR A;  3QMF A;  3VLU A;  1FPB A;  3PMV A;  2Z22 A;  3FXR A;  3SEX A;  3C32 A;  3FXQ A;  4JXI A;  2DP8 A;  3TMG A;  1R1N A;  2P0S A;  3PUW E;  2QRY A;  1PBQ A;  2Q9T A;  1LCF A;  2ABH A;  4NTL A;  3K1M A;  2I6E A;  3H6V A;  1YAE A;  3NOH A;  3IL1 B;  1QKA A;  4DZ1 A;  4JWX A;  5CBS A;  3KGC A;  3HV1 A;  4FJP A;  2ONK E;  1EZO A;  5DVJ A;  2BJJ X;  4H46 A;  3VFJ A;  3ECR A;  3HST A;  3CI8 A;  4I8C A;  4E0W A;  4X48 A;  4GXS B;  2GQ1 A;  4NF4 A;  5LTC A;  3BFU A;  4GWO A;  1K9Y A;  2VT5 A;  4M1V A;  4JSD A;  1GTK A;  1Y9U A;  2Y5K A;  1FBE A;  3G7W A;  4OWD A;  1JW4 A;  4DDD A;  1B5H A;  1JVX A;  4RPN A;  5I7I A;  3FV2 A;  5K2Y A;  5AA2 D;  1SQY A;  4G77 A;  4WXJ A;  3D4G A;  1OLA A;  4ZS9 A;  4N13 A;  5J16 A;  4JWO A;  3EHT A;  4MEV A;  4MNC A;  1D3K A;  5I2N A;  3CIJ A;  1B3H A;  4OEN A;  4ESX A;  3UGW A;  1JET A;  2PT1 A;  4G68 B;  2F78 A;  1VE4 A;  4ELO A;  1ZTY A;  4OVR A;  2XWK A;  3TFL A;  5M2V A;  5ESY A;  1Y3Q A;  3I3V A;  1L5T A;  1OIB A;  2AIX A;  4Q8R A;  1IEJ A;  3MVY A;  2A5T B;  5A5L A;  2XD3 A;  1I6Q A;  4NAP A;  1MQH A;  4I40 A;  3SEV A;  2V3U A;  1AL3 A;  2DWJ A;  4XKR A;  3KJ7 A;  4PGP A;  1MXU A;  1OQH A;  3MVW A;  3U8Q A;  1FSA A;  3G3F A;  4EUO A;  4QFO A;  3HCQ A;  4ZEK A;  2DSF A;  4LZ7 A;  4XIG Q;  5EYF A;  1FQA A;  1YTV A;  3FZV A;  4H6D A;  4ZEC A;  1XVY A;  5DYH A;  2D5W A;  4QSE A;  1UTB B;  3PUV E;  5CMM A;  3OO8 A;  1FTA A;  3QXM A;  3CFL A;  3VLV A;  3WAF A;  1MG1 A;  2VD3 A;  1VSO A;  3ISP A;  5ET6 A;  3I6V A;  3VLW A;  1Y1M A;  2MKZ A;  4EDP A;  1SD3 A;  2WYP A;  4F18 A;  2E0S A;  3TTN A;  1AMF A;  1FQC A;  1UTH B;  2KLF A;  1P1Q A;  4YAH X;  2Q8J A;  1P1O A;  4MMP A;  1NL5 A;  3ZKL A;  2QVR A;  3U94 A;  4NGU A;  4F19 A;  1EZ9 A;  5BWJ A;  1B0L A;  4L17 A;  4LUB A;  3DEL B;  2OWT A;  1POT A;  2YLN A;  5LDZ A;  5CI5 A;  2OCU A;  1GVC A;  4GF8 A;  4YKI A;  4Z0I A;  3O6H A;  5ICQ A;  2ZYM A;  3T9V A;  3IB1 A;  1J1N A;  2M8C A;  4EF2 A;  2XXK A;  4FEC A;  3FAS A;  1URG A; 
#chains in the Genus database with same CATH homology
 2F35 A;  4OHN A;  3FVN A;  2RCA A;  2XHD A;  4FEB A;  3KN3 A;  3SEU A;  2AL4 A;  4WEP A;  4DCY A;  4GFR A;  1B05 A;  1TFA A;  3TQL A;  1EH3 A;  1DTG A;  1TT1 A;  3CVG A;  3E3K A;  2F34 A;  3G3I A;  3OEL A;  3R26 A;  4RK9 A;  1VFD A;  4RPO A;  1BLF A;  1MQG A;  1P1N A;  4EQ9 A;  5I57 B;  5KZT A;  1T0K A;  1OQG A;  2QL3 A;  4FAJ A;  1SDX A;  2I0B A;  1IXH A;  1US4 A;  1MY0 A;  5B7D A;  3THI A;  3KEI A;  1B7H A;  4UAC A;  4KYE A;  4C1U A;  1B1X A;  3FIR A;  3FJG A;  4E0X A;  3H6U A;  2VGQ A;  5I2N B;  3JZJ A;  1QW0 A;  3IR1 A;  5KDT B;  1B32 A;  3TEP A;  3Q29 A;  4NF5 B;  1ZBM A;  3QSL A;  4U21 A;  1A8F A;  3LSL A;  4YZZ A;  1B6H A;  3SER A;  3Q28 A;  2RIN A;  4POX A;  3K6V A;  2V25 A;  2XXQ A;  3KSJ A;  3MZ1 A;  5H8H A;  1LBC A;  3OXN A;  1XC1 A;  3M8U A;  4QFK A;  1H3D A;  3IJO B;  2QS3 A;  2O7U A;  3OSQ A;  3G3G A;  4OVJ A;  3IOW A;  2QMW A;  4PET A;  3E9X A;  3U1O A;  1NNK A;  3MP8 A;  2Q88 A;  1PDA A;  2P2A A;  2OZZ A;  1ZJL A;  3TAJ A;  5EHS A;  4O3B A;  1S7Y A;  1B0H A;  3E4R A;  3G3K A;  2NXO A;  4IO3 A;  2NWJ A;  1A54 A;  3PPN A;  3Q25 A;  4GVO A;  4ZED A;  1TXF A;  5CMC A;  1MQD A;  1AH5 A;  3KSX A;  4Q30 B;  1N7W A;  4G8M A;  2PVU A;  4Q0C A;  1VFE A;  5L9M A;  1FQB A;  1BP5 A;  1N04 A;  4RA1 A;  1SI1 A;  4NF5 A;  1DPE A;  1WVJ A;  3A3U A;  4LQ2 A;  2ANJ A;  5H8N B;  3GBB A;  2Y7I A;  4P0G A;  1OVB A;  3H6W A;  3QK6 A;  5H8N A;  3FVG A;  5I58 A;  4H67 A;  1QUJ A;  2G29 A;  2Z8E A;  3K1P A;  4G68 C;  4NF6 B;  4NMY A;  4G8N A;  5AA4 A;  1ZU0 A;  1GGG A;  2HXW A;  2F6P A;  1WDN A;  3IO6 A;  4IY5 A;  3D4C A;  4XTC Q;  4C0R A;  3RTF B;  3UP9 A;  4R2B A;  3KFM A;  3BFT A;  3O2A A;  3B6T A;  3C31 A;  1B1H A;  2DE3 A;  2Q2A A;  4JDF A;  1RYO A;  1SW2 A;  3E13 X;  4I9D A;  4THI A;  1SW5 A;  4YB6 A;  3MJN A;  3T9X B;  4ELR A;  4EUO A;  1BTJ A;  4ZEI A;  3IJX B;  4P11 A;  2IEE A;  2XX7 A;  2Y7W A;  2ZXT A;  5I2K B;  5HPQ A;  5I2K A;  5KCJ A;  2O6A A;  4KYS A;  4OQO A;  4F1V A;  1EZP A;  2DS9 A;  5H8S A;  3SEW A;  5A5X B;  4G2Z A;  3V5A A;  2F7B A;  1LFI A;  4IY6 A;  1MS7 A;  3RNN A;  4F22 A;  3O9P A;  1QJM A;  4ZZA A;  1O7T A;  3RTW B;  3GLB A;  2GH9 A;  3RUM A;  2QS1 A;  4XXU A;  1B58 A;  4BDR A;  3UK4 A;  3OO7 A;  1NNT A;  4G4P A;  4PFW A;  4F2O A;  4F3B A;  4NF6 A;  3U93 A;  3M3K A;  2Z23 A;  5TPA B;  4F2Q A;  2V84 A;  4U4X A;  1LAH E;  1NKX A;  2R6G E;  2QJE A;  2I3V A;  4R9G A;  4HW8 A;  2E1S A;  3PV0 E;  3T9U A;  3PD9 A;  5L9O A;  2XD2 A;  2Y7R A;  5CMK A;  2XXH A;  5ELV A;  5ICT A;  4XKN A;  1CB6 A;  1N0T A;  5H8F B;  4G8H A;  3TEL A;  4JB7 A;  2UYE A;  4BDO A;  1MQJ A;  3KN8 A;  3CR9 A;  5KCJ B;  2Y7P A;  4KQP A;  4R6Y A;  4ISU A;  3TDJ A;  3HO7 A;  1HSJ A;  4GQO A;  3U72 A;  4Z7E A;  2UYF A;  2RF1 A;  1B5J A;  2VD2 A;  2ZYO A;  4MBP A;  4X9T A;  1MQI A;  2XX8 A;  1ZMG A;  3LSW A;  4KPT A;  1LCT A;  2VHA A;  3FV1 A;  4ELQ A;  3IB0 A;  3OEK A;  3W9W A;  3N6U A;  2XXU A;  1NFT A;  3H03 A;  5I56 B;  2XXI A;  4KHZ E;  4LZ8 A;  3GBA A;  3RPW A;  1M5E A;  1HSE A;  2QMX A;  2UVI A;  3MZB A;  3MC2 A;  3CSB A;  2YJP A;  3K00 A;  3DP8 A;  3GZG A;  4NF8 A;  4YIC A;  3IB2 A;  1XT8 A;  4PE5 B;  4QRZ A;  5K2X A;  1M5C A;  4H5G A;  4F3S A;  2VP1 A;  2PX1 A;  4GRK A;  4OFL A;  1MM6 A;  4RNS A;  1H45 A;  1SYI A;  1Y3P A;  2F5X A;  1B9J A;  2DWH A;  2OK2 A;  3O66 A;  4OER A;  4RYA A;  3W15 C;  1I6B A;  4GOT A;  2X26 A;  3C36 A;  4FAT A;  4ZEC A;  2UVG A;  3UOR A;  4UA8 A;  3PD8 A;  3C33 A;  4R6H A;  1F9B A;  3C9H A;  2I48 A;  1QKB A;  4U1O A;  3UIF A;  4OFJ A;  2QSX A;  3VE1 B;  1PB8 A;  1A55 A;  4YB7 A;  5IAI A;  1RKM A;  1LAF E;  1MXY A;  2HEU A;  2RC7 A;  4QFP A;  2X7Q A;  4G68 A;  5AA3 A;  4F1U A;  2F7C A;  4IGT A;  4ZZE A;  3I5O A;  1YCJ A;  4IO4 A;  1A8E A;  1N3X A;  1LLS A;  3EPE A;  1JW5 A;  2F8D A;  4WKM A;  1B3L A;  3ILU B;  3MBP A;  3SKP A;  4NF8 B;  3O28 A;  3B7D A;  1N7X A;  3GXA A;  1SW1 A;  3KOT A;  2OJT A;  2A5T A;  2ESN A;  2D21 A;  2UVJ A;  1ATG A;  4KCC A;  4RK2 A;  1HSL A;  1OVT A;  4MF3 A;  4R72 A;  4XKQ A;  5CMB A;  1H76 A;  2F36 A;  3PMW A;  1O64 A;  4O3A A;  4OXV A;  1ZKB A;  1UTH A;  1UIV A;  3DM0 A;  3OD7 A;  2VOZ A;  4BDN A;  3O97 A;  4AB6 A;  2UXA A;  2DVZ A;  1AIV A;  1LFH A;  3TPA A;  2REJ A;  2IA4 A;  2Y7K A;  4OZ9 A;  1Z7M E;  2H5Y A;  3TCG A;  3EHS A;  4R73 A;  4AB5 A;  4DXU A;  1M5B A;  1PC3 A;  2F97 A;  3ODB A;  3VVD A;  3FD3 A;  1B4H A;  1MY1 A;  4R74 A;  3ZKK A;  3T93 B;  1OLC A;  4EQB A;  3PPP A;  2RC9 A;  3MPK A;  3T96 B;  4R9F A;  3TTM A;  5AA1 A;  3K6X A;  3PUY E;  3HPI A;  5AA4 B;  3KZG A;  1H44 A;  1XOC A;  1XVX A;  2XXX A;  1B40 A;  3O6G A;  4K3F A;  3ZSF A;  3PMX A;  4QSC A;  1DSN A;  2FA7 A;  2O84 X;  4ECF A;  3RT6 B;  3JV9 A;  4JWY A;  4LP2 B;  4NED A;  4POW A;  1GV8 A;  2NUV A;  5DT6 A;  3MQ9 A;  1Q1K A;  2UVH A;  2XX9 A;  3M3L A;  1P1W A;  4QF9 A;  4MLQ A;  3TZA A;  1I69 A;  3K01 A;  3BBR A;  1NH8 A;  4DE8 A;  1MY4 A;  2O68 A;  4KD5 A;  3DP6 A;  3K1N A;  3M3F A;  5ISU A;  3TUS A;  4YMB A;  1NH7 A;  3IO4 A;  2O7I A;  4C1T A;  3K6U A;  1LAX A;  3R7X A;  4F3P A;  3HHG A;  1B3E A;  3DLN A;  1Y3N A;  4NE4 A;  4OMB A;  1BIY A;  1MXV A;  1JW1 A;  1NNF A;  2F6G A;  1S9T A;  3L6H A;  4HS7 A;  4DLD A;  1USY H;  3MZ9 A;  4QHQ A;  5DVI A;  2YPN A;  1MXZ A;  3FGS A;  2ZYK A;  5H8H B;  4OTE A;  3TTR A;  2GRV A;  4F1Y A;  2G93 A;  2DXR A;  1FQD A;  2R71 A;  3VLU A;  4JSO A;  3CSG A;  1O63 A;  5HM4 B;  3PMV A;  3IX1 A;  1LB9 A;  5H8F A;  3A09 A;  2Z22 A;  2WKY A;  1PBP A;  3FXR A;  3SEX A;  4U2R A;  2OLB A;  3W9V A;  2V93 A;  5EHM A;  4U22 A;  4QFL A;  4YKK A;  3H06 B;  4N07 A;  1MY3 A;  3C32 A;  1ELJ A;  3FAT A;  3FXQ A;  3OEN A;  4OYV A;  4JXI A;  3T22 A;  4R6K A;  1IXI A;  3VXB A;  4ZE8 A;  2DP8 A;  3Q26 A;  3RLF E;  3TMG A;  2O1M A;  4F31 B;  1B2H A;  1R1N A;  2P0S A;  1OMP A;  3PUW E;  2QRY A;  1PBQ A;  4ZEB A;  2Q9T A;  1LCF A;  1FTJ A;  1NNP A;  1S50 A;  2RKM A;  3MP6 A;  1MRP A;  4TOZ A;  4AQ4 A;  4PFY A;  2ABH A;  4NTL A;  2ZNU A;  2QS4 A;  3K1M A;  2I6E A;  3HN0 A;  2DWI A;  4JBZ A;  1B51 A;  4KCD A;  1D9V A;  3FXU A;  1BKA A;  3H6V A;  3S2V A;  1YAE A;  5I59 B;  5I59 A;  2DQV A;  3IL1 B;  2FNC A;  1QKA A;  1WOD A;  2Q89 A;  4H5F A;  3VVE A;  3ILT B;  1IUD A;  4DZ1 A;  4JWX A;  4I1D A;  5CBS A;  3KGC A;  3IOU A;  3PPQ A;  3HV1 A;  4FJP A;  2D3I A;  3RGY A;  3WAE A;  2ONK E;  1IQ7 A;  1EZO A;  5L9S A;  5DVF A;  5DVJ A;  3HHF A;  2BJJ X;  3S9M C;  2P1S A;  1MM7 A;  1XHY A;  3VFJ A;  5IKB A;  3L6G A;  1MDP 1;  2H99 A;  3ECR A;  3HST A;  3F11 A;  3CI8 A;  1IXG A;  3MAM A;  4GL8 A;  4I8C A;  4LON B;  4EQ7 A;  3LBS A;  1Q35 A;  4E0W A;  1JEU A;  1I6A A;  4X48 A;  3IAZ A;  1YPN A;  2HAV A;  4GXS B;  4P0I A;  4WED A;  3MUQ A;  1DOT A;  1JVY A;  3MW0 A;  4NF4 A;  4ND9 A;  3H6T A;  3B6W A;  3BFU A;  4GWO A;  1B46 A;  4MH5 A;  4YU0 A;  4HCW A;  3VVF A;  3RQT A;  3VV5 A;  4LVQ A;  3S9E A;  1JNF A;  3MVZ A;  4M1V A;  1DPP A;  3SET A;  1JQF A;  4JSD A;  5FTH A;  4EXL A;  5H8Q A;  3B6Q A;  4BLA A;  1IIT A;  1GTK A;  1XS5 A;  1Y9U A;  2GFE A;  3OMB A;  1B52 A;  3FUZ A;  1QUK A;  3G7W A;  5CM6 A;  4OWD A;  2O69 A;  4RJZ A;  1CE2 A;  2FYI A;  4PFT A;  3S9L C;  3K6W A;  4DXB A;  3UA8 A;  1JEV A;  1JW4 A;  2A5S A;  4DDD A;  5I56 A;  1B5H A;  2AYS A;  5J1D A;  1GR2 A;  2HQ0 A;  2Y84 A;  3N94 A;  1JVX A;  2H9B A;  4EXK A;  4RPN A;  3FV2 A;  5K2Y A;  2R9J A;  4IO2 A;  1SQY A;  5AA2 D;  4H1X A;  2I3W A;  3QYT A;  4LZ5 A;  5FHO A;  4G77 A;  3TYH A;  4WXJ A;  3D4G A;  1OLA A;  4ZS9 A;  4N13 A;  2XXV A;  4NF4 B;  5FHN A;  1TFD A;  4JWO A;  3V8X B;  5I57 A;  4MLV A;  4HTG A;  3EHT A;  3EQ1 A;  4U4S A;  4DCX A;  2QPQ A;  3SES A;  3EHU A;  3PU5 A;  1D3K A;  2XXP A;  5I2N A;  3MP1 A;  1Z7N E;  3CIJ A;  1B3H A;  4IB2 A;  4OEN A;  2ONR A;  2PMS A;  3FVK A;  2PYY A;  1QUI A;  4ESX A;  2XXY A;  5KDT A;  1AOV A;  1B7Z A;  1ZLQ A;  2DE2 A;  3UGW A;  1JET A;  2OBG A;  4H65 A;  4R75 A;  2PT1 A;  1MXX A;  4KYD A;  4F29 A;  4G68 B;  1R9Q A;  4LAT A;  3V89 B;  3FJ7 A;  3VDF A;  1FTO A;  2F78 A;  2I58 A;  5DEX B;  2DYX A;  1FQE A;  3KBR A;  1VE4 A;  5JTY A;  4ELO A;  1B3G A;  1ZTY A;  4ONY A;  3CFZ A;  3CRB A;  2THI A;  3QUF A;  1N76 A;  3EN3 A;  3CG3 A;  3SEY A;  4PQJ A;  3UN6 A;  3TFL A;  1UQW A;  5M2V A;  1Y3Q A;  1QVS A;  2I49 A;  4LA9 A;  3TOD A;  3I3V A;  2O51 A;  4U1Z A;  1UIU A;  3H3G A;  4QFN A;  2RC8 A;  1L5T A;  1OIB A;  1MPD A;  5ITP A;  3S9N C;  3S4U A;  2HFB A;  1QUL A;  2AIX A;  2Z8D A;  1IEJ A;  1ZIU A;  3MVY A;  4NWD A;  4Q8R A;  1US5 A;  2XXR A;  2A5T B;  1NMU A;  4KI0 E;  2XD3 A;  1I6Q A;  5H8Q B;  1MQH A;  3K02 A;  5JEI A;  4M4G A;  3QIM A;  3MVX A;  3IK6 B;  4FOR A;  2PBW A;  4KR5 A;  3SEV A;  4TLM B;  2B3F A;  2V3U A;  1AL3 A;  2DWJ A;  2LAO A;  1P1U A;  1RYX A;  1P99 A;  4XKR A;  5DEX A;  3KJ7 A;  2W7Y A;  5F1Q A;  4XKP A;  2XXT A;  3LR1 A;  1MXU A;  1OQH A;  2HZK A;  1MPB A;  3H7M A;  3MVW A;  3U8Q A;  2I4C A;  4KFQ A;  4FED A;  3G3F A;  4IO6 A;  4YB5 A;  2RCB A;  1POY 1;  3LSX A;  2ZMB A;  3LUY A;  3OO9 A;  4QFO A;  3C35 A;  3HCQ A;  4Q5T A;  4ZEK A;  4RXL A;  2DSF A;  5L8D A;  2Z8F A;  4DXC A;  1B5I A;  3TTK A;  1D9Y A;  2DVC A;  4BDQ A;  4LZ7 A;  2O1L A;  1B3F A;  4XIG Q;  1MY2 A;  3PPR A;  2NVU B;  5EYF A;  4YMA A;  1FQA A;  1YTV A;  4IGR A;  3FZV A;  3N6T A;  4H6D A;  2AL5 A;  4MFI A;  3ONM A;  1IIW A;  1II5 A;  1KWH A;  1N3W A;  3A3C A;  1XVY A;  2DXY A;  2V3T A;  3P7I A;  5DYH A;  2D5W A;  3T9H B;  4QSE A;  4DIG A;  4EF1 A;  1N84 A;  3AXF A;  3VXC A;  1UTB B;  3LSF B;  2ZNT A;  3KN7 A;  3N5L A;  1R9L A;  2XXW A;  3PUV E;  4FE8 A;  2I4B A;  4U23 A;  5TU0 A;  3U92 A;  2H25 A;  3PUX E;  1VR5 A;  2HZL A;  3BKI B;  2I0C A;  3TQW A;  1B4Z A;  1Y20 A;  5CMM A;  1FQF A;  5TP9 B;  3ZS6 A;  5F7V A;  5TP9 A;  3OO6 A;  1MDQ A;  3OO8 A;  1IXC A;  2REG A;  3IOV A;  3PGF A;  4X1B A;  4F3G A;  1LFG A;  1MH4 A;  4LQ5 A;  4YKP A;  3TCF A;  3QXM A;  1LBB A;  2HCA A;  3CFL A;  4QSD A;  3VLV A;  5B70 A;  3WAF A;  3MPL A;  1MG1 A;  3IOR A;  5AA2 B;  5AA2 A;  1EU8 A;  2HAU A;  2V3Q A;  1SBP A;  4H0W A;  2ALU A;  3TCH A;  1B7U A;  2VD3 A;  4OEU A;  4BDL A;  4N6P A;  4ZE9 A;  1MPC A;  3K4U A;  3MWB A;  3PUZ E;  5CRY A;  1MXW A;  1SVX B;  2DE4 A;  1VSO A;  4TQU Q;  3USD A;  1Y4C A;  3K0V A;  1FW0 A;  3I6V A;  3TKD A;  3VLW A;  1Y1M A;  2X7P A;  4PFU A;  1LST A;  1Y4T A;  4HCY A;  2PT2 A;  1FTL A;  1SD3 A;  5DTB A;  3T66 A;  4EDP A;  4F39 A;  3PPO A;  1TWY A;  4F18 A;  2DOJ A;  2E0S A;  5CC2 A;  4I62 A;  1LB8 A;  3G3J A;  3SDF A;  1FCK A;  2QS2 A;  2H4I A;  3IOT A;  5CBR A;  1D4N A;  3TTN A;  4ESW A;  1AMF A;  3H4Z A;  1FQC A;  3OOA A;  4PP0 A;  4ZEF A;  1SW4 A;  3CG1 A;  1LGB C;  1UTH B;  2ZYN A;  3N26 A;  1MH3 A;  4IO7 A;  5FTI A;  2KLF A;  1P1Q A;  4GD5 A;  2F7A A;  4YAH X;  2Q8J A;  1P1O A;  1SYH A;  5A5X A;  2OWS A;  3FVO A;  1NL5 A;  3O29 A;  4H8J A;  4OFO A;  3ZKL A;  1PB7 A;  3U94 A;  3C4M A;  3O6I A;  3QUJ A;  1PEB A;  3G3H A;  5JTY B;  5I58 B;  4F19 A;  1FTK A;  5FHM A;  3EF7 A;  1H43 A;  1EZ9 A;  1USY E;  5HBC A;  5BWJ A;  4NWC A;  1B0L A;  1ANF A;  5BUU A;  5AE4 A;  1A7L A;  2GHB A;  1IZ1 A;  2H98 A;  4L17 A;  5TPA A;  3CFX A;  3RN8 A;  5LOM A;  3LC8 A;  3V83 A;  4LUB A;  3DEL B;  2B3B A;  4OEV A;  5I84 A;  2OWT A;  2Q2C A;  3KG2 A;  3Q27 A;  4OET A;  1POT A;  4OES A;  3K2D A;  1M5D A;  3R6U A;  4BDM A;  2GHA A;  2YLN A;  3TTL A;  5ITO A;  1A40 A;  5CI5 A;  2ZNS A;  2OCU A;  1LAG E;  4TLL B;  1GVC A;  3C34 A;  4GF8 A;  4RY1 A;  4YKI A;  3JYR A;  4Z0I A;  1M5F A;  1URD A;  4ZDM A;  4O3C A;  3O6H A;  4YKJ A;  3KJT A;  2ONS A;  2NOO A;  2ZYM A;  1FTM A;  3KOS A;  4GL0 A;  2CMO A;  5ICQ A;  3FJM A;  3T9V A;  1UTB A;  4R2F A;  3RT8 A;  3IB1 A;  4X1D A;  1DMB A;  4GLI A;  1J1N A;  1URS A;  2CZL A;  2M8C A;  4GXA A;  4GIZ A;  4IO5 A;  3RY3 A;  4EF2 A;  1A99 A;  3OEM A;  1R6Z A;  3OSR A;  4H8I A;  2B65 A;  1DTZ A;  1PB9 A;  4FEC A;  1SI0 A;  3FAS A;  5JK4 A;  4FIM A;  3QAX A;  2DWA A;  3DP4 A;  4ELP A;  1URG A;  1Y1Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...