3CG8A

Laccase from streptomyces coelicolor
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
270
structure length
270
Chain Sequence
b'GGEVRHLKMYAEKLADGQMGYGFEKGKASVPGPLIEVNEGDTLHIEFTNTMDVRASLHVHGLDYEISSDGTAMNKSDVEPGGTRTYTWRTHKPGRRDDGTWRPGSAGYWHYHDHVVGTEHGTGGIRNGLYGPVIVRRKGDVLPDATHTIVFNDMTINNRKPHTGPDFEATVGDRVEIVMITHGEYYHTFHMHGHRWADNRTGILTGPDDPSRVIDNKITGPADSFGFQIIAGEGVGAGAWMYHCHVQSHSDMGMVGLFLVKKPDGTIPGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords laccase
molecule tags Oxidoreductase
source organism Streptomyces coelicolor
publication title The Structure of the Small Laccase from Streptomyces coelicolor Reveals a Link between Laccases and Nitrite Reductases.
pubmed doi rcsb
total genus 76
structure length 270
sequence length 270
chains with identical sequence B, C
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3cg8A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3cg8A02
2VMJA 1PNCA 1SHXA 3S8FB 3IE9A 1JXFA 3FPYA 2GIMA 2VW6A 4Q89A 2IDFA 1NPJA 1OE1A 3WI9A 2FQEA 2PP7A 1XB6A 1YLBB 2HRGA 1MG2C 2J55A 1ETJA 1KBWA 3FYEB 3X1BA 1NTDA 4YL4A 1A8ZA 1ASOA 2Q5BA 3QJSB 2GB2A 1E5ZA 4JHUA 1BQ5A 1PZCA 3CZUB 4HCIA 3WKPA 1W8EA 1NDTA 2W8CA 1FFTB 4GP5B 4E9XA 2FJSA 3FSWA 4MFHA 4NERA 3UAEA 1SFDA 2FQFA 2YAPA 2AFNA 3TASA 1NIBA 3UACA 4AKPA 5B1BB 1KDJA 2ZONA 5ANHA 2XYBA 4BWTA 1GYCA 3CG8A 4E9TA 5I6KA 2J56A 2DYSB 2LLNA 2PCYA 1KCBA 1ET7A 2OCCB 3CVCA 3NJJA 2VN3A 1TU2A 3CVDA 3DTUB 2CCWA 3UGEA 1SDDA 1OE3A 4AKQA 1ILSA 3H4FA 2HX9A 2R7EA 4WKXA 4HCFA 1WA2X 4DP1X 3FQ2A 2ZOOA 2GC4C 3BQVA 3NJLA 1UATA 4HCGA 4G7QB 3ERXA 2FTAA 3FPXA 1CYXA 3ASOB 1FWXA 3PPSA 2CJ3A 4N8UA 1WAEA 1E30A 2UX7A 4HHGA 1JZHA 4UF7C 3H4HA 2XV2A 4HIPA 1GR7A 1HAWA 2FNWA 1JOIA 2XWZA 3QJRB 4AI7A 2IDQA 4Q8BA 1J9QA 3NP4A 2IDTA 2BP0A 1IUZA 1EHKB 3D12B 3EH4B 4QKTA 1AZBA 4M3HA 2HLEB 3FU7A 2QDWA 2PPEA 1KGYE 4AKOA 1PY0A 3T6ZA 3IBOA 3HB3B 1AS7A 2WSDA 3N2JA 3S3DB 3NSCA 3CDZB 4KNTA 3QQXA 1T5KA 5B1AB 4A2FA 2B3IA 4JKNA 2FQGA 2BP0B 3G5WA 4KNSA 2JFCA 2J5WA 1RZPA 1W6LA 2RACA 4WTQA 4DP2X 2IWKA 1MG3C 1ZPUA 5F7AA 2IWFA 6PCYA 4DP9X 4YSEA 2PPAA 3FU8A 4G71B 1OE2A 2BP8A 2GBAA 1AOZA 2VSMB 2XV0A 5F7BA 5E9NA 4FA7B 2Q9OA 4N4YB 4KO6A 4BWUA 3NSDA 7PCYA 1L9PA 4DP8X 4DPCX 1GW0A 3S3CB 4YVNA 2BW5A 3BVDB 1IBYA 1XMEB 2R7EB 1TEGA 1JXGA 1GY2A 1TKWA 2YXWA 3AG3B 2IDUA 1ET8A 2XVBA 4G7RB 4KO5A 5B7FA 1ADWA 1MZZA 4YSAA 2OV0A 1AZCA 2BWDA 3L45A 2BO0A 3MBWB 2DWSA 2UXGA 2MTAA 2I85A 3ZDWA 4DP0X 2CUAA 1JZGA 1SJMA 2BWIA 5B7MA 1KDIA 3NSFA 3NJGA 3FQ1A 3EH5B 3NYKA 2TSAA 2FT8A 3TBBA 3V9EA 5A7EA 1B3IA 2J57A 1AACA 3WG7B 1WA1X 5FC9A 3FT0A 4YSDA 2QDVA 1NWPA 2UXFA 2BZ7A 3FSAA 2DY2A 3ZIYA 3X1FA 1JERA 2DYRB 2W88A 1W6WA 3FS9A 1OF0A 1E65A 2UXVA 2GC7C 4YSQA 1AAJA 2YQBA 1IKOP 3GYRA 1NIAA 3WNIA 3ZX1A 1JVLA 2FQDA 2PP8A 4HHWA 4DP6X 1HAUA 3GDCA 2HXAA 3NJMA 3EH3B 1XB3A 5AZUA 4F2EA 4E9VA 1SNRA 1A65A 1ZDSA 2ZXWB 1PMYA 4G72B 1OCRB 9PCYA 4A67A 4YSSA 3PXLA 1SHWA 4NB7A 4BWWA 7PAZA 2IH9A 4E9RA 3TU6A 1BYPA 4BK5C 4E9QA 3QJTB 1AZRA 1A4BA 3T71A 2XV3A 3ZBMA 4BXSV 5I5MA 2GHZA 3RYMA 3X2QB 3PAZA 2N0MA 2PPFA 4E9WA 3T9WA 4M4RB 1BXVA 2H3XC 1WS7A 2XLLA 4DP4X 4GP8B 1KV7A 5D4HA 3MX0B 3V9CA 3T6WA 1MDAA 2DWTA 5I26A 5PAZA 4PCYA 4HALA 1VLXA 2PPDA 1JXDA 5AKRA 1AG6A 2VSKB 2EIKB 1SF3A 2FWLB 3PAUA 3SBPA 3N55A 5B3SB 2UX6A 1AIZA 3GXUB 4TXVB 1RZQA 1J5DA 5I6LA 2I7OA 2XX0A 4FAAB 6PAZA 5TK2A 5IY5B 2YAEA 1A3ZA 4E9YA 2WO3B 4KO7A 4YSCA 1V54B 1M56B 3NT0A 2X87A 2IDSA 2QPEB 2XU9A 4UAHA 5B1JA 2EIMB 5I28A 3QJUB 1GS6X 4KOCA 3SBQA 4RH4A 2BHFA 1NPNA 1L9QA 1V10A 3AG4B 1BAWA 2YAFA 1NIDA 1SFHA 4CSZA 1A4CA 3U25A 1J9SA 4KNUA 2AZUA 4YSUA 5B7EA 4A2EA 1IBZA 1BEXA 2PP9A 1BYOA 4DP5X 2B08A 1N68A 5I5IA 2XXGA 1PZAA 2P80D 2EIJB 5I6PA 1E5YA 2CAKA 2HX7A 1KYAA 1WS8A 3OMNB 1GY1A 2XXFA 4BDVA 2YARA 4CSPA 4DP7X 1J5CA 3H56A 1IC0A 1N70A 2BZCA 5TK4A 3OMIB 4YSPA 2OJ1A 4A66A 2Y1AA 2E86A 3NJIA 1X9UA 2YXVA 4GY4A 4A2GA 2XUWA 3KW7A 5B1JC 2BP8B 3FSZA 4HZ1A 2CALA 1ID2A 1CUOA 3EF4A 2FT6A 2HX8A 3PCYA 4GYBA 4A68A 4DPBX 4ZK8A 3T6VA 1JZIA 1DZ0A 3HEIB 3OMAB 3X1EA 2A3TA 1ASQA 3UAAA 4A2HA 4PAZA 1SDDB 4ENZA 1WA0X 2H47C 1L9OA 4W1TA 1I53A 2MRYA 3AG1B 1CC3A 1PLCA 5PCYA 1ET5A 3CDZA 4P5SA 2X88A 3ASNB 3TA4D 3UABA 3FU7B 1PF3A 1CURA 3NJNA 1XB8A 3UADA 1BQRA 5LDUA 1BXAA 5I6MA 1OV8A 3S3BB 2JKWA 3PAVA 1ZDQA 1JZEA 2PLTA 1BXUA 2CBPA 4YSTA 1J9TA 2VM3A 2YAMA 3C75A 3QJQB 4EF3A 1L9RA 3X1GA 1ILUA 2XX1A 8PAZA 3S8GB 1TEFA 4YVUA 1OCZB 3X1NA 3KW8A 2PPCA 1JVOA 1OCCB 3AZUA 2JXMA 1GS7A 1RCYA 1L9SA 2YAHA 4F2FA 2NRDA 1AZUA 3ABKB 1AG0A 4BDVB 1AR1B 3SQRA 4A2DA 2VW7A 1A4AA 1HFUA 2GI0A 2ZWNA 3TBCA 3WNJA 4GXFA 3EHBB 4F7KA 3OM3B 1AANA 1QNIA 2BW4A 3NJFA 3CVBA 4AZUA 4NAJA 3T6XA 1CYWA 1NWOA 3ABMB 1PLBA 1ZIBA 5I6NA 3NJHA 3FU9A 3NJKA 3DKHA 1E67A 1URIA 2HZHA 1NICA 3ABGA 3AY2A 2IH8A 1PLAA 1M9WA 3OQRA 1ASPA 1V55B 2HRHA 1NIEA 1BQKA 3FQYA 4BXVA 2IWEA 4GP4B 4L0PB 3FSVA 3NSYA 1AS6A 2EINB 2PCFA 4K9JA 1QHQA 2WO2B 1DYZA 2AVFA 2FT7A 2QT6A 3QJVB 4KO9A 2AZAA 5B1KA 1QLEB 2EILB 4HAKA 2H5UA 2DV6A 2P80A 3DIVA 1AZNA 1NIFA 1AS8A 3JTBA 3JT2A 1X9RA 2I7SA 4YSOA 5I6OA 1PAZA 3IEAA 3QPKA 5D4IA 1R1CA 3AG2B 5EHFA 1ZIAA 5D4JA 1AQ8A 4UANA 2UXTA 3OD3A 2QPDB 2YAQA 2VM4A 3FYIB 5AFAA 3SBRA 1MZYA 1PZBA 4P5RA 2GSMB 1NINA 1GS8A 3AW5A 1F56A 4G7SB 5I5JA 4DPAX 4E9SA 2AANA 3PLYA 1PNDA 2IAAC 2VW4A 1GSKA 1KBVA 1M57B 4AX3A 3IN2A 1ZV2A 1L9TA 4YSRA 4QLWA 3IN0A 1JZFA 4X4KA 1RKRA 1JZJA 3WIAA 1OCOB 2Y69B 1OOWA 4JHVA 1PCSA 3WKQA 3ABLB 1J9RA 1KCWA 2TSBA 2YAOA 1EZLA 3NP3A 4KOBA 1FA4A 4G70B 1NZRA 4W9ZA 1SF5A
chains in the Genus database with same CATH superfamily
4UBDD 4MJIE 1U92A 1MW2A 2RMNA 5CU5A 4QOKB 4JY5L 4XB7A 5JDSA 2MFNA 4Q89A 3HC0B 4NSKA 1A6TB 5BRZA 1YYLL 3S96B 1HHIB 1GAFL 1BVKB 1G4MA 4XVJH 1YLBB 4U49A 5DK0A 4LLWA 5GGRY 5HI4C 2V9UA 3SKOA 3U4KA 4JRXD 3VXQB 4JUSA 1LK3H 2GB2A 1SLXA 3LIUA 3RX5A 1QUNA 5AB2A 2Q10A 1EGJL 3MNWA 4G3YH 5A2IH 3AREC 5DC2A 2AJVH 5F88B 4PWGA 3TP4A 2BX5A 2J2ZB 1KFGA 2XN9D 2EEDA 2WN2A 3TTYA 2D03H 3C8KB 2F6AA 2V3EA 2XCMC 1FDLL 4QRQB 1EV2E 1U42A 5AW0B 4QIRA 3ZKMC 4AQAA 5I6KA 5IHWA 1JN6A 3DA0A 4CC4C 5EORL 3E0GA 1QZNA 3ARDD 2ARWA 3NJJA 3LSOB 1X7QA 4NZRH 1CLZL 3QUMH 3Q6GL 4BYHA 5KZCB 3NCJH 2JWYA 5D96B 3FO2B 2R7EA 3BW9A 4Y4FB 3ISWA 1Z9SB 2OMTA 4Y1AB 4XMPL 1AQDB 2B0SH 2EACA 2MKLC 4ZOBA 4QYOB 1A9VA 2Z4QB 4LLMA 2HG5B 2WYZA 4P5TC 3BXNB 1WWWX 3MRQB 2DJUA 2O6DA 4GRLB 4HMEA 3GMPB 4LVHC 1GGCH 1MFDH 3WSQL 2OSLA 1ESOA 2NLJB 2J1KA 3LOWA 2Y5EA 3W57A 1IM9B 4N8VG 4X7TB 1U8CB 4IIZA 3CX5J 5H4YA 1JOIA 4QNPF 3U2SA 4D0BB 5I1KL 2R29A 3L3HB 2B4CL 4UQ2A 2EDHA 3I6SA 5JR1L 4JFFA 5E6SB 4M3KB 3G6AA 3K5SA 4ACPA 1HT6A 5GS1B 1ONQA 2A5UA 2WVUA 1B4TA 1A7BA 3C08L 3A6CH 1RIVL 1C16B 2OA9A 2FIKB 3VXOA 3Q44A 5HHNA 4CN6A 1W0VB 1HI6A 3SE8L 4XZUB 2GJPA 4ZO7A 2AS5M 1T5KA 1T89C 2IV8A 3H0TB 4Z78B 4GSRA 2PW1B 1YEFH 3G5WA 2JFCA 2A6KB 4BH8B 2E7MA 3OZ9L 4IBSA 3RJQB 4KJQD 2UVFA 4YUEH 3N42B 4OSUH 4C4KO 1T66D 1UA3A 2WIMA 1U8CA 4WTWA 5DVMA 43CAB 2AEQL 2ZWKA 1FSKB 3FU8A 3QRLA 5BV7H 2K9UA 4PJIA 5FGSA 2BCKA 3LV3B 2NLJA 4QRPD 5JPNA 5CP3A 1I1CA 4HMCA 1DEDA 2BSSA 3PQYD 4HF5L 3QDJA 1MRCL 1SN2A 2DWEB 2K0RA 4RAUA 4YN3A 1ED3A 3D39A 1WAAE 2A83B 2EUZA 1U8KA 4PWEA 2ZD0A 3UJTH 2EIZA 1DBAL 1TEGA 5I1GL 4WWPA 3ZSSA 3L4VA 1KLFB 3NFPB 1BM3L 3TGXA 4DUXA 1MZZA 1MIMH 5LKNA 3L45A 2DWSA 1BJ1J 4OIBA 1B88A 4EUPB 1GVIA 1QBML 2C34A 1CFTB 4ZFOB 2WXQA 3L3OA 1I9EA 1I9JH 1Y18A 1QR4A 1YYLH 2GITA 3SCMC 2YD6A 5FM5M 2VXTL 4F2MA 1WA1X 2ESVD 2OR7A 4D9QD 1CE1L 2O93L 2G60L 2Y7NA 4TSBH 2QZQA 3BGMB 4PGZA 3C09B 1OOAA 2ZSVA 1AZVA 3NCXA 2XWJB 4OGAC 3CMOH 4LGSB 4EOWL 1SMDA 2Y7SA 3ECQA 3O3BB 1D3CA 4BD4A 1RAMA 4DGYH 3OGCA 2VLKD 3SPVB 1MW3A 1P4BH 3UAJD 1KB9K 1PAMA 3BZFA 3AQXA 3B2VL 1BAFH 3KPNB 4MNQB 1YA5A 5FA4B 5INDB 3VD0A 3AUVA 4A67A 2QFPA 1BLIA 4GIAA 1M05B 3HS0C 2BOCB 5F7DA 5FUOH 3FCTB 3ABZA 3D0LA 4EDXA 2IH1B 1F6AB 2EADA 4UT9L 4HUNB 3ZE2F 4PBVC 4LSVH 2AQRA 1U3HA 3K0YA 5E9DA 4FCHA 3T71A 2GHZA 4UTAA 4FTVD 1HE8A 1CPUA 4FEMA 1FAIL 4UT6H 5HDQH 3Q5TA 1R5IB 4YK4B 2DMGA 5D2LA 4MZ2A 1OM3L 4NRZB 3TCTA 4U33A 1E4XH 4WLCA 5HPMA 2VDRB 3WEOA 4RQQB 1G7LA 1KC5L 3GM0A 1T6VN 3REVA 4EZKA 2XQYG 3L3IB 1HU8A 5TDNB 3R0NA 3HI5H 1E4KA 2IMNA 3I02A 3BESR 1E5CA 4WDIA 4WJG3 4HLZG 2R1YA 4PRPD 1D5XB 2OMNA 5CKAA 1HINL 3L1OL 2BNRD 4NZRL 4G5ZL 3UC0H 4WUUA 2DQCH 3I50H 1JV2B 4ELMA 2R2BA 1RPUA 3GXUB 3FQWA 4JFTA 1J5DA 2C7FA 4PRHA 4FQLH 1ZT4A 2CGYA 1T0OA 3PL6A 3KPPA 4X6BA 3T0EE 3TEWA 4HUXB 3OZLA 5T1KA 2WXOA 4LVEA 3LRLA 3EJYD 2B20A 4L0YA 5LVEA 1HHHB 3QHFH 2EVGA 1XWVA 5AUMA 2FB4H 2X3BA 1S7QB 2UYLB 3VA6A 1ITCA 2R1XA 1JWUA 5DU7A 2E6JA 4AXWA 4WFED 2DD8L 4QD2E 1L9QA 1OKEA 3IXAA 1LO5A 4JL2A 4NO3A 5L6YH 4UIKL 4IGBA 5IMOA 3IDIA 4XBPB 1NGWB 4Q0XL 3OKOA 2WCPA 3DV4A 4XCFL 1NOLA 2Y6SD 3IKKA 4IIQA 1UD2A 3IVKB 5IEHB 3GSWA 4Y8AA 4Z7NE 4B41A 4JAMB 4PG2A 3O6MH 5C0IA 8FABA 3RPBA 1XF2A 3H3BC 4KRLB 3WMQA 2LR4A 3QNYA 1HESA 3GSNA 2EIZB 2XXFA 3DO7B 4AQ1B 1SN0A 2WGXA 3EO9L 3P0YH 4JRYD 4YGVB 4MSWA 3KPRB 1N70A 1S9VB 3CQPA 4HIJA 2X6VA 4YSPA 3MSPA 2FX8H 4PUBL 5DK2A 3MO1A 2DM7A 3GLZA 5T8IA 5IESH 1O6VA 3EAKA 4NN7B 5IQMA 4GG6B 2WNWA 4IGBD 4P2RD 5CD3B 4ETYA 1ID2A 1NCDL 2VZUA 3KGRA 3MA9H 2A6JA 4A7SA 3ULUD 1WTGT 2O1AA 3GGWA 4P07A 3WIHL 3FL7A 3N9GL 2CLZB 4HCRL 4XBEH 2Z1KA 3IAPA 4X7DC 3WKML 2NY3D 3BZ4A 4G8EA 2WWMD 1MHCB 4NI6A 1ETZB 2HTLD 4J2QA 5DJAA 3X3GH 1WJ3A 3LXCA 4OZIB 2ZCZA 4TLUA 1MCOL 3SE4A 4TL4A 2ZZUT 3FCGA 1A4KA 5AG8A 3TNNA 2BIHA 3PP4L 5ENWA 3T4AC 3BUQA 5AAPA 3CSGA 1MF2H 3BFOA 4ZUWB 4OQTH 4JM4L 5EZJB 1URZA 1Z5YD 5BXFA 1WDAA 3PAVA 1O7SA 1FGVL 4AT6B 1JUFA 1BQHA 1TFHA 2EC8A 2EDOA 3GSNL 1MAML 3MOBL 1KXVC 1CL7H 3K8LA 3MKKA 1L7IL 2VAAA 5C07D 3T1FB 3ZE1E 5CCGE 2EJ1A 4RA0C 4UINH 2NXYC 2AXGB 1TJIH 3AWFA 4FJYA 5E1QA 1USZA 3RKDD 4J27A 4WK0B 5DFWH 4MGXA 3B2XA 3WE1A 4AT6A 1GGIL 4AQ8C 3ESMA 4D9RE 1NMAH 4PS7A 1AXSB 3SQRA 4RMWA 2A74C 3TN0B 1G7QA 1CFSB 3D69B 2OX5B 2VN7A 5C7ZA 5ELIA 4ZI8A 2OMXA 3TBCA 5ENWB 4EZMA 2KH2B 3GBML 4F7KA 1QNIA 4B27A 3WIHH 3P11H 3PP3H 3UTTE 1I1AA 2W9EH 1CDCA 4MYPA 3N44B 4W70A 3MA9L 2X05A 5B38A 3JWDL 4GPVA 4Z0XA 2J8OA 1E67A 1MHCA 4ONOA 5AWNL 3RIFF 5JW3H 3DUHA 3K8KA 4ZX5A 1MCSA 5J0BA 1ECZA 4XPGL 3LKPB 4GRMA 1MVUA 3HPJA 3E38A 1UD8A 1KN2L 4I13B 3LN9A 1IO4C 4JFDD 1IE5A 5TQ0H 2FECI 2P5WB 4B97A 4HAKA 4S1DC 1RUML 4X8GA 5DURB 4OZHB 1S7XA 1Z6JT 5EBWB 3V9FA 4XTRC 3NCBB 4QHNB 2Z34A 1UXSA 2KBGA 5F9WB 4UV4H 4G9DB 2WCGA 3MNVB 1IB5A 3DOSA 3ULUL 1HHGA 3GEWB 2Z65C 1WWAX 4LHUA 4XAKE 2ZCKL 1WD9A 2ZX6A 3IDGB 4DW2H 1IBBA 3QUYC 3ZDZF 1A3RL 3DVIA 2BRRL 3Q6FA 3VI3B 3RPIA 4Z7VA 1SMAA 2ZWSA 3LQAL 2DLHA 4G1MA 4N6RA 3WLBA 4PJ7B 5DUBA 3WBDA 1ZLDA 1NINA 1H3WM 1NCAL 5GZNC 3B43A 4LLDB 3C9NA 4AX3A 5EOTA 1QO3B 3VM5A 5FB8B 3X14B 1IAOB 1Z1WA 5F0JB 1RL1A 2FEEL 1OF2A 3KPSD 5EUOA 4OKDA 4RMTA 4DGIH 3NAAL 2GK0B 4D9RD 5GGSY 3WKQA 2PW2A 4NZUL 4NJ9H 5EZPA 1PS3A 1DDHB 3P4OA 2CMRL 3GMRA 3Q3GA 4E9LA 3T3PF 5HVGB 3BP4B 1OARL 2XFXB 3MLZH 4MJ6B 2EO7A 2XKUA 4G9DA 5D5MF 3OGOE 3LS4L 3A0OA 1PZ2A 4ECNA 1NCBH 2FQEA 5JOEA 1GA2A 5DQJA 3BEVB 1J87A 2FLRT 1ETJA 5D93B 4XOBA 4GXUM 1KCSL 4EXKA 1J18A 4PJ9B 2Y1VA 4BSWB 5ALCH 1KB5L 2FX9L 1AMXA 4TQIA 4ZSOE 3WKPA 2W9EL 1HQ4A 1A5FH 1R19A 4E9XA 4C57C 2FJSA 3FSWA 5BZWB 2YAPA 4S1QH 1IIIA 2UZXA 4FQJH 1M1SA 1T2XA 2FJHA 5IMLB 4IMKC 4ABWA 2E7LC 4G7VL 1ZTMA 4Y5YC 3LPOA 4NNXA 2VLJD 3I2CH 2ZG2A 2E6QA 3MLRH 3DETC 4I85A 4I18C 3CVCA 4PJ9C 1Z9MA 2EZ0D 3DARA 4YXKH 5CWSA 2VN3A 4GT0A 4HIHB 4WVRA 2CCWA 3O2WH 1TJIL 3O6FA 4HJJH 5EFIB 1XR8A 1ILSA 2ZWYA 4UYPA 2XA8H 4WKXA 5IROC 4ZS6D 5I66A 2JELL 3FQ2A 3WN5A 5LGJA 4MNQA 2ZXEB 3GBDA 3HUJB 4EOWH 1BX2B 1R3IL 1JL8A 4IDJL 3E6FA 5EBLA 2G3MA 3E3QE 5HGBB 4W9HC 1MNNA 2VDRH 1MOEA 4UF7C 4XE0A 2XETA 3CSPA 2VB5A 3ATDA 1MSPA 1Y1DA 2VLRE 2X4TA 4HV8B 4W6YB 2VL5B 3ZHFA 5C6WH 4ZODA 3WEMA 1HKLL 1U8NB 3HLAA 3GBNL 1R34A 3VX1A 5E2JA 5GZNA 3LZPA 4JNXA 5CBEA 3H9SE 5BVPH 3NP4A 3N0PB 1OAQH 1J1PH 2MPVA 4OZFG 2Z6FA 3NZHL 2APFA 4M3HA 2OCJA 4UV4L 2NX5D 5BNXD 3L5HA 3MRPB 3FU5A 1JGVH 4XN4A 3S3DB 3CFBB 3GSXA 1PFCA 2IH3B 1N8OE 1KBGL 1AXTH 1I8LC 1A7NL 1U33A 2H8PB 4JR9L 4GKNB 4M5ZL 5JOFA 2ENPA 3JXAA 4KHTL 5IT2L 2B9BA 2DDQL 1KN2H 1T66C 4I0KA 4PJ8A 4YE4H 1Q0EA 1QVOA 1UG9A 2YMOA 1RJYA 4I5BA 4JFFD 3T0ED 5D6CA 1T1ZA 2PO6B 2ZKHL 1XR9B 2QQQA 4JQXA 1B0IA 4Z0BH 5CD5C 3EYOB 1KEGL 4YSEA 4PB0H 2PPAA 4HBQA 1PKOA 3QORD 4UM9D 2CO4A 3EKCA 1UQSB 3DVGB 5FK9B 4LCYA 1FLTX 4LCYB 3BWSA 3JYBA 5F7WC 3LZFL 3ZKXB 3SCMB 4PRPE 5CEZH 4CNIA 3WHE0 1B6UA 1UD4A 4UUJB 3IDYB 1AGBA 5I30L 4J3BA 3RFRA 5IQOA 2Y06L 5H94A 1PEZA 3AY4A 4Y9GA 1WUZA 4PJFF 2LT9A 1T5WA 2PW1A 4G7RB 3B7UX 2FWOB 5DMGD 5DJ0B 4OCSL 4Y5VC 4NN6C 1UZ8B 5D71H 1GC1H 3QZLA 4TVPE 1A6WH 4DP0X 2XQBL 1A1OA 5J12C 1KBKA 1UYWH 2DIAA 5F7EL 2JJSC 4AQZA 2X2HA 3EG9B 2WXJA 1HQRA 2HTLC 4DEWA 3U36B 4OGZA 3K5RA 4R9HA 5A7EA 1UT9A 2HKFL 2ZX7A 4W9KC 4XGZB 5HHQB 5KANG 3G6AB 4MAZA 4U1NB 3GSVA 3ARRA 3OXSA 5E56A 3BYTA 2D4DA 5C0CA 1T1XA 3ZIYA 3LEXB 1TIUA 3L48A 2J72A 4HH9B 1JGDA 1T2JA 1JD7A 3BWUF 4BFJA 1CD1A 4XMKH 3UGUA 2M1KA 4HHWA 2XWBA 1HS6A 4K5LA 4TLSA 1LTXA 3GDCA 4FA6A 1JV2A 1NANI 3RAJL 3D8MA 4POYA 1KULA 1KZQA 1HXYA 3D0VA 1A65A 1T03H 3RGHA 5C0AA 5B39B 2IAMC 1NFIB 1FVEA 1NANH 4GAFB 2R2HA 4HCRA 4KI5D 4L4VA 3T0VA 5HYSG 4Q7DA 5E1GA 2NY0B 1UH3A 2WTPA 4LAJH 4M56A 3WE6A 3OJVC 3DPBA 1G7LB 3RTQC 4JN1L 3VFNB 3MFFA 3NCFB 4KVNH 4ONGH 5ALCL 1Q8MA 1Y0LA 3HFFA 4ISVB 5I5MA 4FABH 4HUCA 4AQAB 4G82A 4QRRE 3JTTA 5EF0A 2AJ3B 3L5WA 4YHKL 1TPXC 2B8OT 5EO0B 2UZXB 3D5OF 1HIML 5FHAL 4PWKA 3BKMH 4LZKA 2X9WA 3HKZA 3U9UB 1F97A 3RUGF 3CC1A 2MPAL 1JXDA 5AKRA 3G6DH 4E5XB 4KI5E 4ODWB 3O3EB 5GGVL 5DMYA 3LAFA 4NEHB 2VT0A 3LX9A 5CSGA 5E8OA 3ZL1A 2MQGA 5AVTB 5GSVA 1G6RL 2G5BB 2I26N 3RLSA 4W9LC 4HC1L 2DWDB 1T7XA 3F85A 3NZHH 3FB8A 5F3HB 5I6LA 3MLVL 2XJKA 1RY7B 2YMXL 2BY1A 4URTB 3GSOB 1IC5H 4QHPA 3RI5K 4CU6A 5I15L 1KN4H 2F7IA 3SIKA 1UB5A 3QUXD 5GRXG 5EDXA 5EWIL 3L9BA 2D4FA 1E7VA 3JWNE 5LWYL 1YECL 4JFED 1LP9B 3RDTA 4YR6A 4IOSA 4EN3A 1E5UI 2G0LA 3PNRB 1DVFA 5B1JA 1OAUL 2JJSA 1NMBH 1OSEA 2ZUXA 2Q87A 3VX0A 2FBRA 3KYOB 3J2PA 4L1TA 4FHKA 3OKMA 3CUPA 1RSFA 2PYEA 4BINA 1MELA 4M43H 4M5YH 4YBHA 4PMEA 2HTKC 1M71A 4L4TD 2AK1L 5GS0C 3VI3F 2JELH 3OC8A 4L29B 5T1KD 1TQSA 2B0SL 4O2FB 2VDML 3MV8E 2G3XA 2H1XA 1N4XH 3TESA 4YXKL 4HOXA 3HMXH 3P2BA 3I9AA 5FDYA 3QUML 4P2OC 4FLQA 3U9WA 1AXSA 3SDAD 3H9HB 3HE7D 5T5FA 4N68A 2RTTA 2AJUL 4N0YH 3AXLA 4LPXA 5I8EA 2PR4L 3H56A 3Q9QA 2LTQC 4FNSA 4JO5A 4QXWA 2VUYA 3LKRB 1VFBB 5DUML 3W37A 1V7NL 1JPTL 1CCZA 5SWZA 4C58B 2XPYA 3TO2A 3ET9F 4YQXH 5CGMA 3A5VA 2KPWA 1N59B 5JUEH 2VAAB 5FHBH 5HHOD 3RE0A 3NZ8A 4XOEA 3WEXB 5IFHH 4A6YA 4TUJB 3EF4A 3GZOA 4DPBX 3GTVA 4DTGL 1CZ8H 3NA4A 3IU4L 4L1LA 4NNYA 1JF5A 5LCVL 4F8OA 3LKPA 4XNDA 3J07A 2P24B 2Z93A 1J8KA 2QADB 1ZLSL 4XMKL 2BIPA 3AACA 3DHPA 3LPWA 2F68X 5A2JH 4W1TA 1BQLL 1UWEL 1ZHBB 2KLRA 1XAKA 1X7TA 4NM8L 5JW5B 3Q2WA 4JFVA 3CDZA 4N5UA 5CHNB 1JZ4A 2NY4D 5CLTA 1WGVA 4A2MA 3HMWH 4HPYL 3HR5B 5KS9B 3QPXL 5CEZL 4W9IC 3QE5A 3F12A 2DB8A 5D2NA 2P24A 4HVBA 2Z0BA 5I6MA 4HZLB 4F9PA 4TSBL 5AOKA 2O6PA 3UEZA 3NVQA 3GJFH 4LNVA 2QVIA 4HDIB 1VZGA 5EDSA 5MI0C 5EO1A 1GPOH 2CHZA 3Q01A 2LABA 4X9YA 1N5YH 1U3JA 4MMZB 1LILA 3VFVB 1ILUA 2ZJSH 3WUZA 1UOKA 2ZOLB 3HE7C 1YUKB 5C2UB 3FCBA 2ATPA 2H2PC 3KPMA 5MENA 5I0YA 2C8NA 1E40A 2HPTA 2ZX5A 5DD3L 4TLKA 3AXLB 5DD1H 1X44A 3EYOA 2OW6A 1D5MB 3EJZD 1S9VA 4JHWH 3DX3A 3KPRA 1OALA 5DO2C 1LO4H 5EN2A 1TXKA 4QLRA 1AZUA 2MSPA 4GQ9L 3CWGA 3IDNB 1AR1D 4Y9FA 4ZUWA 2N7BA 1MREL 1X7QB 2O26U 2VN6A 3EHBB 1AANA 4GQZA 4DGVL 2BW4A 5DFAA 3AY4C 1FNEA 4PV8A 4NUMA 5DVKA 3NJKA 3E6HA 1CDGA 1TMCB 4ZPVB 1ACXA 3MOAL 3SDCB 1EUTA 4QCIB 2IVFC 2NQCA 1K5WA 3ZOAA 3BQUB 2SEBA 2DMBA 3MRJB 3QNZA 2NSXA 3V4PA 3OPUA 4Z7NB 2QVKA 4OW6A 1XIWD 1YMHA 1IGFL 2WINB 3QB7C 1NMCB 4JFOA 3K74B 4MYWB 1F00I 1KJVA 4P99A 3Q1EA 3E1ZA 1GJWA 5JMOC 2EDQA 3F58H 2O6FA 3MGOB 5D7LB 2OK0H 1OWWA 3ZL4H 4GUPA 1DUYA 5DFVD 1VADA 5EBLB 2ZP8A 2IBZX 4G8GA 1Q94B 3BAWA 1JYVA 3V4VH 4H1LG 5DLML 2DH2A 3IDJB 1JE6A 4PD4J 2F7QA 1O6TA 1ROCA 4HQQH 3UEQA 3PABA 1MCKA 1HKLH 3PDDA 1FYTA 2EDNA 2O5ZH 4JG5A 3BHBB 3WOVA 4HX1B 5K1JA 2IC2A 5IW6A 3L54A 4Z7OF 3KDMA 2EDEA 1YUHA 5T1MB 3TLRA 5IEHA 3G9VA 3IETB 4APXA 2ATKA 3DV4B 2EKSA 3ROOB 5ES4B 3MV01 4PWIA 2N3JA 4K94C 1M57B 3IN2A 5I1DB 1MQ8A 5AW5B 5KJRL 4YSRA 4FKHA 4QF1A 3QS2A 2J6EH 4JHVA 4MXVF 3NSJA 1OY3B 1U2HA 1J9RA 4X6DA 1S78D 1MFBH 1AO7D 5ISZB 5DXWA 1FVEB 1UWYA 1EZLA 5HYFA 1KENL 1TTFA 4V1DA 3BRDA 4APQB 1KBGH 3KWWB 1X5MA 3CC5A 4OVVA 2P5EA 1KEMH 3PL6B 4H7VA 1AH1A 4MCMA 4HS8L 4K9EC 1JZ6A 1OE1A 4TPRL 3JQOB 3NDYE 2AJSL 4M9PA 2VSDA 5CCKL 3DHJA 3FYEB 1QRNB 2L8AA 4JZOB 2ED8A 3TCLA 3HHMA 4Y1SA 4PJBA 2R1YB 3JT0A 1NGZB 3GJFB 2VXVL 1RURL 2ARJQ 1TTGA 4G3YL 3MTRA 2WOBA 2HP4A 2OR8A 2PW2B 3CE1A 3MGAA 3V6FB 4FN0A 5LBVA 4B50A 32C2B 3KJ4C 2HH0L 4NRZA 4MMYA 2GCYA 1IAOA 3B3IA 3MV7D 5ANHA 3EOBA 4IBVA 3C9NB 3STBA 4JQIL 1CFTA 5C70A 2PTVA 1TQTA 5FYJE 2ADGA 3IAGC 1V27A 4HULB 2V2XA 1O75A 3LZOA 1BIIB 3VRIB 4N6QA 5F7DB 1YMMB 4HX1A 4NN5B 3RG1C 1PG7H 4X6CA 5E8NB 3KLQA 5D8JH 3DXAA 2EXWD 4QYAA 1FGVH 4XCFH 3GDBA 1N6UA 3CFMA 1X4XA 3W82A 2HB0A 1X5YA 4LLYB 4WSKA 2XIIA 2FTAA 2PR9A 5D1ZI 5FYJD 4UIKH 1UOLA 3QHTC 4P2OD 2LV4A 5I16A 4FG6C 1SQMA 1E30A 2X0WA 1UXSB 2DWEA 3LQMA 2BSRB 2J6EA 4RFNB 1D6EB 4GUPB 5BO1H 2KC0A 3DO3A 4OZHA 2Q86A 3F7VB 4AENA 2PWGA 3SZ6A 1AXTL 3RUGB 1C08A 4NGHL 4PJGE 1HAWA 3MV7A 3UJJL 2IPUK 2FNWA 2MOGA 5C09E 1BF8A 1FO0L 1EFXB 5BO0D 3IDUA 1U8HA 1H3PH 3W3BA 4AI7A 3ZYJA 2NUPA 1F6LL 2H9GB 2ZSWA 3T8VA 2D2CC 4F93B 5IJVB 4IBTA 4YFLI 1WZAA 3MZTA 3VDCA 3RIKA 4N85A 3WNPA 3H7BA 1FNEB 4M1CD 3TZVD 3PNWA 3RZCB 4K7FA 4F7PB 3FFCB 1H5BB 4P4KA 1X5ZA 2TRHA 2CUMA 3D18B 2CDEA 3HCVA 4NAQA 1N5YL 1M3JA 1JF6A 5I1JH 3WJMA 3TX4A 4YHYC 2LAGB 2XACC 1UD5A 1CL7L 5HDBB 3HLAB 4Y5VB 3D4YA 1IAKA 3HRZB 5DI8B 4BK8A 3ZE1F 2IGFH 2P9RA 5I8KH 5HHVH 2CRIA 3MLXL 4NQEA 4FXLA 1OE2A 1PW3A 1CU4L 5L2KA 3C6LD 3KPMB 2XV0A 3BUYB 5E9NA 4OGYH 1PZUB 5LBSA 5AAMC 3D50A 4YC2C 1L5GB 3QI9A 1G6RB 4AGPA 1IL1A 1CLYH 5MHSE 1IQDA 1YJDH 4ODSL 3TF7C 3H9SB 3LZNA 4GOSA 2P8LB 3G6JE 3GS4A 5ETUA 1XMEB 5LG1A 4Z76B 4P57A 4Q52A 3CH1A 1QSEB 4PJ8D 1NC4B 2AXWA 2DQJH 3D9AL 3O6FB 4R2GD 5FKPB 5KYUB 4YSAA 2OSWA 1E8ZA 2V0AA 4O2EA 4WQOA 2NOYA 2I85A 1FJ1A 2VISA 5I8CA 1EAPB 5M94B 1Q1JL 1BVZA 3MCKA 5DC9B 4P46C 5EEZA 3GUFA 3NJGA 3Q8EA 2TSAA 3TBBA 3C6LA 3HZMA 2Z93B 4MBRA 3TBYA 1AACA 1AYRA 4XXCA 4HUUB 1N3NA 4JFPA 1DBKH 2K6ZA 3RY4A 3FONA 4E41A 2JCCF 5HDRA 1IGIH 4TUJA 3RWJA 1K6QH 4J1UA 3EJPA 4H0LC 5IVZA 3W0WA 2BFVL 3DJTA 5CLXA 5F3FA 3ZXAC 4ZZKA 5JHMA 4GG6A 5D70H 4EDWL 2K3HA 3MNWB 3RY6C 2VDQB 2GC7C 2YQBA 4P2QA 1QG3A 2NY1C 2NZ1A 3ENEA 3QUZC 1BVKA 1RPKA 1N6VA 4IOFD 4ZPTB 1I85C 4MJ6A 5DR5H 1RXLA 3FZUD 4BCYA 1WIOA 2P44B 5MEPA 4ELMF 2F74B 4LL4A 1EEUA 1XF2B 4PJ5B 2R2EA 2E8ZA 4NP4H 1A7OH 4J6RL 4A7GF 3FUEA 5AZEH 2G2NA 3D4CA 2YEZB 2EP6A 2YGQA 5FUOL 5T3ZE 1KUMA 2IDCA 1U36A 1KTDB 3VFWB 3STZA 3HW7A 2HLAB 2CR0A 3W0WD 4PR5B 5FOBB 1KT2A 3IU3A 1I8MA 3LRKA 1EHLL 1OAZH 2LQRA 2Y7QB 2LU5A 1F11B 3MYJA 1I9RL 4HFUH 4Z77A 3LH2H 3DVNA 4XO9A 4LF3B 1ZSDB 1JHKL 1QFUH 1SLWA 3KYKL 4KJWD 1GZHA 2D0FA 5AUMB 3V5KA 3BLPX 1MW0A 2R69L 5T1JA 4FQQA 4ONHB 3WHXB 3NCEB 2KPNA 2QQKH 1FG2A 3HMXA 3QUKB 1YVLA 2WQUA 3MNVA 4MA3B 4XT1C 5D7SH 5HDWA 2E7BA 4UBDC 5LGHH 3V0WH 1PU0A 3QZMA 1C8PA 2NY3C 4NO0A 5TK2A 3ZE0F 1XMWA 3WFDL 2WZ0A 3VMPA 1LO3L 3OR7A 3RWCA 2FIRT 4E9YA 4WAFA 2ROYA 3O3EA 4FFVC 4FZ8L 3TBWB 1ZVNA 5J4MA 2XU9A 2VTFA 2GTQA 2D31A 4YJZL 2YGOA 5CIPH 3N85L 5HHOE 3O2DL 2Z7YA 3X11B 2E8YA 4UILL 2KDGA 1JMXA 2ESVE 2X4SA 3OJ2C 5FO8A 3LZRA 1A6UH 2DIBA 3JTTB 3KBEA 5GS0H 1F58L 1RZFH 2F8OA 4KDTA 1EZVY 2V7HB 4ZDHB 2VXQH 4FZEL 4KNUA 4YSUA 1IGJA 1BW8A 3ZJAA 5FKAB 3WU1A 1J0JA 3SQOL 2WLYA 3W1ZA 1FQ9C 1R9FA 4R7VA 1VDGA 4K9EL 2YQ3A 1LEKB 3AGWA 3VGDA 2A4ZA 4LSRL 1CLVA 3O6ML 5CCJA 4JO3L 4ES8A 2AEWA 5JPNC 4ANXA 3F6IA 1OM3H 3Q2VA 4YNYB 2X1XR 3CZSA 3RL2B 4QJ3B 4U1HA 3D07A 4WEMB 2BZCA 4KK5C 4LDEB 1YY8A 2AXFB 1WT5A 3VGEA 3T1FA 2XWDA 4O2CB 4K7PX 3QAZC 2Q3ZA 2WQ8A 2MCG1 4HZ1A 2FL5B 3ULAB 1R6VA 3CPLA 2W94A 2GK2A 1T1XB 3CFNA 2VDPH 3RHWF 2WN3A 2AV1B 3OPZL 4ZAKC 3X3GL 2IANA 1A14L 4NENB 1UEMA 5IQNA 3UMTA 3WDHA 2W59A 3IU4H 1GAFH 1PZSA 35C8H 1SDDB 1BF2A 4HCRH 1L9OA 3GKWL 1I53A 1ES0B 1SRDA 3O4OB 4FQLL 5E5MB 3O6LL 1PLCA 2ZNWA 3HHSA 1XGUB 4IK6A 3P0VH 3UTTB 3V52H 4N25A 4EI6A 5FFOA 4LCUA 3UADA 1LK2A 2CM6A 4JHAH 4Y4HC 4L1SA 1DVFC 1HJCA 3V4UH 2LU3A 3S3BB 2W95A 3MRFB 2JKWA 4Z0BL 3ZKNC 3FUIA 4AYFA 2EYRA 2NW2A 3KYNA 4UDTB 2GQHA 3P3TA 5AVWB 4EN2A 1ZRUA 1DQTA 5FLVA 1JV5A 3JWNG 2Q76A 2NY5L 3BMVA 3OJDA 2VR8A 2IFGA 3QPQC 5EOCL 4QRRD 2KLTA 4YPGA 2LE9A 1LJMA 1P7QA 2WZPA 4EAEA 1PZ5A 1SJHA 4L9LC 4R8WH 1RZIA 2A4EA 4FXKC 4KUZL 2XT1B 4QTHB 3DGDA 3A24A 4R96B 5E5LA 3S5YA 4XPHH 4HWUA 1OK8A 4JG0H 3CFJA 4P06A 1RCYA 1L9SA 3BIKA 2NXYB 3HA0A 3MBEC 5EBGA 4A38A 4YDIH 4HG4J 4BDVB 5JLZB 2QKIB 3U83A 2AGJL 1QQDA 1L7TH 3EO0B 4PY7B 4Q2ZA 5IMKB 3UDWA 2GBTA 5K9KB 2Y7OA 1X5IA 4GKZB 4OUOA 3WFDH 4AZ8B 4GI9A 4LHQB 1A14H 3LRHA 4YBQC 1PYWB 1Q9LB 2QV4A 2IBGA 2Y2WA 4QJ4B 2VABA 2YD7A 2NY2D 1LO5B 4WWOA 5CBAB 3DMMC 4W9JC 3GTTA 3INUH 5LG6A 3JWNC 1JK8B 2E74C 1YMME 3JWDC 5GGRA 1I7TA 3RJDA 4LKXB 1WWCA 3FT3A 1ZMYA 5GGVH 1KJMB 4Y4KA 3WUWG 1RFDL 1I9RH 4KROB 1CQYA 2GFBB 4HV8A 3MBXH 1HSBB 1F8TL 4ZAKD 5BCAA 2B9AA 1ZA3B 1YNTA 4N87A 4UOW0 3NESA 2P80A 4JPWH 3L6FA 4PRHD 4X6BB 1FGNH 4G43A 4RWYL 1X9RA 3CHSA 1IC7L 2DLIA 2WLMA 3E6FB 3L9RA 3SODB 4JN2B 1S9WB 2QPFA 4HKBB 2V5TA 1SXBA 1LQBC 3OKEA 1F4YL 5IVXB 1GSMA 1RU9H 3HLKA 5E1AB 1REIA 3UIYA 2WQAA 3OD3A 2BSTA 3W0WE 1I7ZB 3OB0K 1A1MA 4DKAA 2DLEA 4R90L 5B22A 5IBUB 2VM4A 3SPCA 5HXMA 3QYMA 3SBRA 4FRWA 3F3HA 5TDNA 2E9GA 1JGLL 5T3ZD 2C4XA 3G7TA 4R0LA 1H6EA 2C3GA 1YQVL 4PBDA 4PGCA 1UWXK 4PJ9D 1XGRA 3CFIC 4G6JL 3Q13A 4WFHD 5DZLA 1OCWH 2KUTA 2DQHL 2RGSA 5B21A 1NCGA 4PW9A 3C8KA 3UG5A 2OXHB 4NNPL 4JG1L 1UEYA 1D2PA 3ZTEA 5T3XD 5AVSB 3FT2B 2CBOA 4F1SA 5C0EA 3CHRA 5DHDA 2CIIB 3M17A 1EEQA 4OCNC 2COVD 3G6JA 4LBAA 2P45B 2OP4H 5C97A 2HT2C 2P46B 4NQVB 2RQEA 3VU2A 3PREA 2MIZA 3U4EB 2JIXB 3BEVA 3FPYA 3EYVB 5F9DC 2VQ4A 2EC9U 1OSPL 3LRGA 2XG4A 5E6UB 1NQBA 2JTDA 1XH2A 3U1SH 4MA3A 5GQBA 1WV7T 4A39A 4Z9KB 1UXWA 1T5XB 3X1BA 2B15A 4NQEE 2BSCA 2GUOA 2HJLB 3AADB 3HAEA 2FUQA 5DVPA 4HCIA 5TE7L 1U8LB 2VOTA 2G75B 4GP5B 5D93C 4JFUA 4IBUA 5G5DA 5A2LH 4LVNB 3C5ZB 3IFLL 4E36A 5DEFB 3QJZA 3UTSD 1WFMA 4IEFB 1KMGA 1RJLB 4IJ3B 4U6YB 5JORB 3ZKND 3GB7B 4FQXD 5A2AA 1FNFA 1EBAA 1KLGA 3C6EA 2P1YA 2Y0SA 3QIWC 1T22B 4Z3HA 5MI0B 2VE6A 2VR3A 4X42A 1KT2B 4OJFH 3VXMA 1QSFA 5FYKH 2VO5A 5FO9A 4YH6A 2OYLA 1MRFH 2Y72A 3VFRA 4BFRA 5L88L 2KT6A 2FECL 3R06A 4XI5D 2VQ1B 1WUNT 3FQNA 1GZQA 3L2LA 2C9QA 4MWFB 1P7HL 4HF5H 3U4BH 3DTUB 3AJ7A 4I77H 1OE3A 2PN5A 4PP2B 4HU8A 4X8JA 4U2YA 4PJ5D 3OJMB 2EYTA 1CLZH 3D39B 5T3XL 2HVKB 2FZ3A 4HCGA 4DVBA 3F7YA 2Z92B 3FQRB 1A3QA 3TV8A 2X1OA 4MQXC 4PJGA 4EIGB 2CJ3A 2HH0H 4OD2A 5K59F 4Q9BA 3T0AA 5SWSA 4JG1H 4PI2A 4P2RA 2ZWZA 5I1AA 4O9HL 2ICES 5F9OH 2HJFA 4MAUH 2KZKA 1IM9D 1WIUA 5JHDD 3E9TA 3WN5C 2FHBA 1L4IA 2DRUA 2OI9B 4ZOCA 5F1IA 5H2BB 1KXTA 2Z92A 1G1KA 3FQRA 3QJRB 5IB2A 4QHUB 1NFKA 4J3OH 2IOMA 5D1QA 4UNUA 3THML 1FO0H 3ESOA 1NCNA 4U1MA 4X6CE 5FUCC 2XG5B 1QBLH 4ATWA 4M93B 1X5AA 3IPBA 2QDWA 1LMKA 1RU9L 4PLOB 3AQDA 1P0SE 3QJFA 4NQDA 5GRJL 4X4MA 4BFIA 4UOZA 4JGMA 2F2HA 1HJBC 5EBMA 3MV9D 1ZVSA 2KI6A 2QQKL 4G59C 4ZW3A 3QQXA 4WFGE 3LB6D 3LHPL 4Z7WE 5IW3A 2B3IA 3P73A 4N0UA 4UDUA 4BQ9A 1S9YA 3L4WA 2A73A 1UXLA 1HSAA 4P23B 1FYHB 4PJEB 3E2HC 2AKRA 5DZVA 1MG3C 3HC4H 3WTVA 1DSFH 2XBTA 5CN2A 3C6LC 5AL8A 4NLAA 3C8HA 1E6JL 3II3A 3KPSE 5CUSL 3VTMA 2X4NB 3US1A 1CICD 3W39B 3S7GA 2AXGA 5FYJH 2IQAA 2XIDA 3FAWA 4H8VA 3SDXE 1HZKA 5KG9A 2ZTBA 1S78C 1X5XA 1ZT7B 4GAGH 4JW3A 3KXFD 3BP7A 2P5EE 4K23L 4NQSB 4JFXA 1GW0A 1EXGA 1A7OL 1NL0H 4J6RH 1INQB 1IEBA 3KJ6L 3WY4A 5JIDA 2DJMA 3HUJF 2JB5L 2X4PA 4RMRA 3ZKXC 4L0ZA 3WIHA 5CO1A 2R7EB 4Y4FA 1D6VL 3S5ZA 2ZG1A 5F7YC 4XCNB 1ET8A 2XVBA 4I0PA 3D18A 1UTDA 2KQMA 2R0ZH 4KO5A 3UG3A 5BZDA 2CQVA 2CPUA 1DQIA 5FEBA 3HZVB 1YEIH 3UTZB 1ORSA 3TNMA 4JPQA 3BEWA 4JRWA 1U4EA 5E00A 1JZ8A 2CUAA 3EBGA 3WL9A 1FNHA 1IFHL 2GJZB 5ACZB 4DZBB 5DWUH 4DESA 1J0KA 1EHAA 2FGZA 3A67H 4QRQA 1XCTB 4LVNC 5J12B 2NXZB 4PRIE 5AW3B 3IMTA 3WXWH 4LESA 1BPVA 4WHYG 4PJXA 2NUPB 1LVEA 3NA9L 5MP6L 3SYOA 3GSRB 3NBNA 4AL8C 4LO9A 1JNHA 1IKFH 3AM8C 4AENB 5L4FA 4LLQB 4IRZA 1EMTH 1NDMA 3SPIA 3U4BL 2ZIDA 4Y7MA 1AO7E 4LDCA 4U3SB 2PP8A 3TA3C 3UTTD 2RHEA 5AEAA 1HEJC 1RULH 3WN6A 4ZFZB 2AI0L 3L95B 3O2VH 3S4SB 2ZXWB 4TQ8A 3TTSA 1HOEA 3BVXA 4N0FA 5F89B 3GF8A 4GSXA 4E41D 3FUHA 3VWKD 2YBGA 5H37H 3GPSA 3P4NB 1TZOA 3FRPA 4PLNC 5C71A 2BRRH 3FTVA 5TE7H 2BINA 1FFRA 2XN2A 4BXSV 4N2AA 5ICZB 1LO2L 3WXVH 1GXEA 5DS8A 3KD4A 1YCSA 3KPQA 5BV7B 5C0RH 5F7LB 3HC4L 4MB1A 3FNKA 4GMSL 3W2DL 4DP4X 2XXCB 3T8XB 2O61A 4U3CA 2AEPL 2WWOA 2H0PA 2V5MA 3GXTA 4J8RA 4YDKL 4MAUL 2ICWA 3RGVD 4PCYA 4YGAB 1VLXA 4LEEA 1G7PA 4M62L 4TQEL 1XSIA 3KWTA 5E99L 4N8VA 3PFUA 2BHYA 1SF3A 2JJWA 4ZO9A 3WEAA 2DKMA 2BNUB 1SYVB 2G3NA 15C8H 1HH9B 3BT2L 3WJJA 1I8LA 3GMQA 3SN6N 3WS3A 1FCGA 3LTVA 1NEPA 3OB8A 3IRPX 1Q9KB 1PZ5B 1SJHB 3BSZA 4R4BA 3V0DA 4ZFFA 3LD8B 4CMMA 4GUOA 1I7UA 1V54B 5C3TA 2WQXA 3L3JB 5C2BL 2QPEB 1JJUA 5E08L 1TPXB 4IOIB 3MLTA 3O2DH 1SLUA 3PU7A 2CUIA 4MJ2A 4XMWA 3UYOD 4YDLB 3UMNA 5J13B 3P77B 4ZNEA 2BHFA 1S7TB 4XNBA 2PCXA 1M7IB 5D2NE 4LL9A 3AG4B 1GGIH 1BAWA 5AW7B 1AGCB 4HS6A 4JO2H 5FM5O 2CSPA 1OAJA 2OKMA 3SGDH 4Y19B 4UCFA 2DBLH 4UQAA 3MBEB 1IBZA 3EFDL 4JRYE 3H54A 4LAQH 5E9DB 1ZLUH 2I5YL 5JIIA 1EJOL 1TZIA 2CDGA 1IT9H 4RWYH 4J4PD 2B1HH 3CZGA 2XXGA 4WV1C 5T3ZH 1I8UA 4FGMA 2K8QA 2ZCHL 3P4LA 5DMKB 4QRTB 1H6FA 1ZY9A 3NTCH 2NY4B 5K1NA 3EJUA 1WBXA 5KSUA 4CSPA 3GT6A 3CPLB 5HP5A 2KZWA 2H32H 4ZZFA 2ZOTA 2B5IB 3HG1A 1X9LA 2XKSA 3JV4B 4KVPA 1G1OA 5SWZE 2YN5A 1GCFA 5TH2A 4KQ4H 2C7UA 1IAIH 3X3FH 4GY4A 4XPAH 2NW3A 1BXXA 1QBLL 2R29L 1KJVB 2WVTA 4UT6A 1CUOA 2WUCL 1P7BA 3PY9A 3TYGH 1KPUA 3GJEA 2ICCA 1MWAB 1YMHB 2WNKA 1ZA6A 3CX5K 1EFQA 3CN1A 2SEBB 3MRJA 5DUPL 5TD4A 5TE6H 1QSEE 2WJ5A 2HA1A 1JGLH 5F96H 4UZSA 2DYPB 3SDCA 1Y18B 2ED7A 1A7QL 1HHJA 2H47C 5CCKH 2IQ9L 1TO4A 2ENSA 3BKYH 3GWJA 2W5PA 1ZHLB 1UC6A 2Q7YB 3TA4D 4KUZH 1PF3A 1KCRL 4FE9A 4KKRA 1TQCC 1RPQA 1NGYB 1U8IB 5K1VA 2A9NH 1MAJA 2VZ1A 1A9EB 4JZJB 5I19L 3TIEB 5IV2B 2D31B 3KM2A 4QT5B 1WK0A 4X0NA 1IEBB 3BO8A 5AW9B 3IXTB 4OJDH 3IAQA 3MJ8B 5IB5A 4F57L 5EU6B 5KG9B 5JXEA 5JPNB 3IMBA 3MV8D 5D7JD 1JDAA 2B1AL 1XBRA 2V2TB 2WTRB 2PUQT 5E1HB 3POCA 4D0CA 3KW8A 1JPFB 2W65B 3LIZA 4KRPC 1XSJA 4BK5A 1DN0B 1K4DB 5E7BA 3QH3A 1NKRA 2F18A 4NHCL 4LCCC 4Y2OB 4L4TE 2IXQB 4G6ML 2A6KA 4P59H 4UWQB 5CEYB 3UZEA 1A4AA 1XF3B 3D39D 3H0TA 4RX4A 3CQQA 1QLFA 2WTOA 4DFIA 5AD0B 4DN3L 4XXWC 1N19A 5LCVH 4JPWL 4H44C 4CW1A 3VQ1C 4S0SD 3ECWA 2XICA 2VLKE 2VSCA 4DQOH 1NWOA 3ARGA 1AP2B 1JNLL 1LEGA 4H5SA 4QRRA 4L3EB 1P7KB 2JI3A 2JCWA 4L2LA 1ZLUK 5FHBL 1URIA 1NICA 4U4BA 2DQEL 3O81A 4PRIB 1AIFB 5ICXB 5DJ6A 4RRPG 4PGEA 4TRPL 1T6BX 2YC1A 1XVSA 1U8PB 4LLVB 2GJRA 3PDOA 4G6KL 2DF3A 4IJ3C 4N2GA 1A6AB 1QWNA 2PCFA 2X4OB 4DIXA 3ZL2A 3QIWB 4F8NA 1AHMA 1YPZE 3EFOA 1BBDL 2QELA 5EF3A 4W6XB 1AS8A 4F92B 3HB3D 3QG7L 1S5IH 1LDPL 2WBJD 2NQ3A 3GRWA 4I0PC 4DO6A 1BFVH 5HTSA 1B2YA 3MXWL 1CS6A 2WAHA 4G42B 1QLRA 4HJUA 1B0RB 1Z9SA 2OMTB 4M7ZB 1G1YA 1U3YA 5CJOH 3MRGA 3WJJC 3CD4A 4JUTA 3PHOA 2PYED 3AREA 1GZQB 3B6SB 1PTZA 2E4FA 2WM0A 4K5OA 4X5XB 1X3DA 4OKVB 1KBVA 2R29H 3LZQA 3QQDA 4MRCA 3ARDC 2OXGA 4WWKD 3CK0H 2FR4B 1VSCA 5EU7C 2XWCA 1K6QL 4AL8L 3ETBJ 3QJOA 4IS6A 4IKNA 4K7PL 1RZ7H 1IBFA 3RFZB 5EZLA 1M2VB 1MI5D 1DUZB 2EDBA 1A7PL 2KQNA 4HOWA 1JSYA 5ERWB 3HI1B 1K8IA 3TBVB 3AS2A 2HJKA 1EPFA 2XTLA 2CJSA 3V8OA 4YFEA 4XPTL 5AOIA 3QWOB 4JFYA 3B83A 2XNAA 4NKDB 3IE9A 5EEVA 5F97E 1TCMA 4U6TA 4LU5L 2YGPA 2VERN 4FNLL 1N9PA 3WI9A 3B5GA 1UWGL 3AB0C 1C1EL 3V2AR 1H8LA 4DO4A 1A6VH 4FULA 4RGOL 4LRIA 3U7AA 5JOPD 3LJ3A 1AD0A 2K6YA 4KH2A 2ZAHA 4PJHE 2CZNA 3ARBC 4WWKA 2JI2A 3CZUB 2YD0A 2ZXAA 4FABL 4QWWD 4OIIL 3CIAA 3O41B 5IF0B 3TL5A 2F5BL 4NUGL 2EDRA 3QXWA 4NERA 4JO1L 1M6OA 1YNTF 2NDGA 4R8WL 4H88L 1F1AA 2PO6C 5LAXB 3QZOA 2Z7WA 3K72A 3O11A 3TPUB 4FLOA 4BWTA 5KSAB 1DQLH 4X6FB 2WV3A 1Y0LB 4P9HH 3PV6A 3ZDYF 1ZHLA 1AKJA 2DMCA 1CXIA 4JO8A 4K15A 1TU2A 3VNYA 3QEUA 4EIZC 2ZYIA 3RIAK 4F5CE 1CD0A 3S36L 1A1MB 1H3GA 4OCWL 4YMPA 4DP1X 2X70B 5HD8C 2CA3A 2ZSWB 5J13C 4XPBL 3BQVA 2DQMA 1EFXA 3RIAF 3AVEA 2BNRA 2TRYA 1VA9A 2OL3A 3TT3H 1G7MA 4HIIA 3BLKA 1A7QH 3CDGA 3DRTB 5J6HA 3ETTA 4KPHH 3HR6A 3FT4A 4YLQT 5I1IL 3EXLA 1RZJH 4G7YH 3N91A 1WBZA 4NRXB 1RK1A 3IDXL 4FA8A 4HIPA 1GR7A 1HSBA 5IBLC 2WLZA 5LNDA 2AV7A 5T1LB 1FVCA 2GKIA 1YPZA 2AITA 5HBBA 4ZW8A 4MVBC 3RGVB 3UJJH 4Q8BA 4NN7C 4XVUC 4AUJA 4WU7A 4PJXF 4FTVA 4AC4A 2ICEA 4WHDA 1W80A 4GW5A 2YD2A 1TJHH 4CC4A 2GJJA 1IAMA 3N43F 3LS5L 2DI7A 3U0WH 4NHCH 1BZ9A 4X9GA 4HOZA 4XMTA 2EXTA 4HKJB 2EDLA 3H9SD 1XBDA 1FH2A 1OQXA 1DL7L 1FI8C 4N1EA 5ILTL 2VLKA 2C3HA 2VLRD 1TEYA 3KAAA 3MPCA 4N0CC 5HJBA 2FWOA 5I8OL 3MLUL 2H1PL 2ZE0A 4B5ZA 5MEOB 3BVTA 4DKFH 1LDPH 4K55A 2IPTH 5IK3A 3FH7A 5IFJB 1IFGA 3ATEA 3LVTA 4X6EA 5C08B 3B9KA 3LYRA 4D0DA 5H94B 1NCTA 1P69B 2A9BA 2YK1H 3FN0H 1A6ZB 5D7LE 1E4KC 2R4SL 4LPTA 3MOQA 3VAEA 4OCMC 4Y4HA 1Q0XL 1WRFA 3ES6B 3SYQA 1BLNA 3C5XA 1PLGH 1NC2D 3P40A 1TITA 4KVNL 5DVLA 5FCSH 3SZKC 4U7KA 2CWRA 2VKXA 3RP1A 2IGLA 1FF5A 3S3CB 5AVZB 1HH6B 3DMMB 5C2BH 1TQUA 1MFMA 4R90H 1MQKH 1QVOB 4UDTA 3MUGB 3O6LH 1U91A 1TKWA 1UASA 2VDQH 3IS1X 4OF8A 2FD6L 4C47A 4N8CH 3FUKA 5EOCJ 2H8PA 3KL3A 3N40P 4WTZA 1ZLVK 3D9AH 4GQ9H 4HS3B 4J8RB 2DQFB 2CBMA 4AC2A 4DZ8A 4LBEB 3QG6A 2BIQA 4FFYL 4M00A 4XNMB 3K2IA 4AYGA 4EMZA 1E6OH 3HHRB 3ARFD 4U05A 1KTJA 3IGUA 4RLDA 3SKJL 2BIIA 1IGIL 4LOFA 3PWPA 4KI1A 4Y19E 4YZFE 4AIXA 3HS0B 1G9HA 5ICZA 1P5VB 4NKOA 5FC9A 1KELH 1RK0A 2IANB 2O6EA 5E94A 3RX8A 5HVHC 2AP2A 2UXFA 4KZEL 3BGFC 4QY8B 1LO0H 3RVTC 1C8QA 5J1AA 3INUL 2HKFH 3BWAA 5J1SC 1G9EA 2WLLA 2P8PA 4ZOEA 1CDJA 1N7MH 1KY7A 3DTDA 3GBEA 2H26B 5DRWA 4FLHA 1BOYA 5G55A 4GSUA 3O2WL 1F3DH 4JPVL 3VMOA 1Q94A 3EGXB 4FFVD 4TOYH 4TS6A 6TAAA 1EGJA 2XBZA 3PWLA 4FYSA 1VFAB 1I3GL 1OCRB 2VRAA 2Y5QA 4QRSB 2AI0H 3O2VL 1BWMA 4ZFQA 4MHHI 1QBBA 3PXLA 4LOUC 5CEXB 1SHWA 4YHPB 4ODUB 4KK8D 3FHEA 2O72A 1UHVA 5E2VL 1JD9A 1RI8A 3UJIL 2WCSA 4P23C 1YEJH 3ZBMA 4JRYA 3FXIC 2CJUL 3RYMA 3PAZA 3WKYA 3VDAA 2EZ0C 4XN1A 1G9NC 2GTZB 5GRWA 2X0UA 3WL9B 4LE8A 4FMVA 4XAKD 4X5QA 1OTSC 2AAAA 4GAYB 3BEWB 2RH0A 4GBXA 5EU5A 4FQHA 2DWTA 2WWKO 4NUJB 4X2UA 3V6OA 2AJUH 4GO9A 5D72L 4JLRB 1BREA 3HE6D 3NFNB 3IJHA 4M62H 1VKXA 1XGYL 1SOQA 3NGBB 3P3YA 2F9BT 1MPAH 2XYCA 4MMXC 4RGNC 4W9EC 3ZRSA 2OZ4A 1HCZA 4IK7A 2LU7A 2VERA 2V7NB 4L3ED 3UGXA 4X6CF 4JQVC 3RL1A 5IQ7L 5GZOD 2W0PA 5EB9A 1EBPA 4WO4B 3S3SA 4DCQB 4LAQL 3OF6D 2G2PA 3HFMH 2Z91B 5ALBH 1QNZH 2VIRB 3D4ZA 4UOW1 5CLZA 4X7EC 4PMFA 1M56B 3NT0A 3OHXA 2X87A 5DDHB 1DDHA 2ZXBA 3P4OB 4LCIH 1L6PA 3DGGB 5JO5B 4ONFL 4MBOA 3S8WA 5DZ9A 2F58L 1G1CA 1WT5C 1G7JB 3P73B 2XIBA 5E2TH 2RCSL 3UPAA 3G5XA 3HC3H 4NRYB 1OP5K 1RUAL 4Y4KC 1OGAD 4QR7A 4HQQL 1U41A 2VDNL 3V0EA 1UUSA 1UD3A 2HT3D 3L5IA 1A4CA 1C5CH 2XWXA 2AERT 1J9SA 4AEIH 4FLSA 5F7FA 1FFNA 3LKNB 4L3EE 5CGYD 5FYLD 5KAQG 2JKTM 2IOIA 5DZOA 3TO4D 3EH2A 5HHMD 3ZMRA 3VD7A 2CO7A 3DHMA 2ODIA 4TYUA 3DX7A 1UM4H 1N68A 3SPJA 5EF2A 2BOBB 4HS8H 4I4WB 5KVGH 2JF1A 1VEPA 1KYAA 1MHHB 1ORQA 2YHGA 1K4CB 3HE7B 4MXWH 4GRWB 1IGTB 3JTSB 1SHMA 4WW1B 1E3ZA 3SKJH 3DOSB 4FQCL 1IC0A 3VTAA 3BJ91 5EU4B 5IB1A 2K9FB 1T0PB 1LM8V 2FGWH 4PVMA 1OGTB 3D2TA 3JBG7 2XZZA 3CFKB 3ULSA 3EDJA 3OAYK 2F54A 4UQ9A 3VB8A 4XX5A 1ZGLM 4WW1A 2F61A 2A0LC 4FFWD 4PHXA 4WI5A 4PRDA 4JE4B 1GJIA 3ZVVA 1IEAA 1DZ0A 1G43A 2R0ZL 1NCJA 2F19L 3U0PA 1N3NB 3QJXA 4JFPB 1ASQA 2GBUA 3W5MA 2BOBA 4I4WA 2NY1B 4L9LB 4NKQB 4HK3J 4M61A 4O2FA 4NQCE 2P47B 4U0RB 5I23A 1A0QL 5ID0A 2VQ1A 4MWFA 2O5ZL 3CHOA 5T1DH 4A55A 3QUYD 1XGTB 4S1SL 2R4RL 4P5SA 1K85A 1E9OA 1AD9B 1KCVL 3UYPB 3IJ9A 3KBPA 4O2EB 4XWOC 1XGQA 2V5YA 4X98A 4NRYA 5KYUA 3WGVB 2D8KA 4TTGA 3CZKA 4P2AA 1MCWM 3RWGB 4LSUH 1C12A 4OIFA 4W9GC 1D5ZA 5H4ZA 4DT2A 1MUJA 1DVFB 4EUPG 4KDWA 3MV9E 4AW7A 2JK5A 2X38A 4P3DB 1J9TA 3QJQB 4JQIH 4EF3A 2G30A 4MNHA 3SDDA 1EHXA 3QIBC 5E6IB 3AT9A 5I1EL 2BVPB 3MA7A 3SDXA 2XTJB 2YFNA 4ZUUA 4ABUA 5C0FA 4V11A 1PKQE 4KTDL 1EZVX 4FQIL 5D7JC 4CADB 4W6WB 3KPSA 4GG6F 2E7CA 6FABH 5KYWA 5EU7E 4FOMA 4YWGL 4S0TD 1T0MA 1U95A 4R0LC 3WTXA 4HT1L 1AR1B 3ZO0A 1JZDC 4PREB 4ZUVB 5JHDE 3ZRCC 4L3CB 3MRCA 4N0UE 5E8DL 2Z1PA 3VNZA 5KVFE 1BFOB 4PJ8C 3O45B 1J8HE 4RNRB 5IQ7H 2OXHA 1RD6A 3FSOA 1MPAL 4NQDE 4TUOB 1FV1A 1ODAA 1OM9A 4Z23A 2G60H 4ZTPH 5L0QC 4JRYB 5E9DE 4PFEA 1PLAA 5CZKA 3D3VB 1ASPA 3SKNA 1BQKA 2R0WL 1IFRA 3VXUB 3O9WB 3MOAH 1NGPL 4GP4B 3DK0A 4W9ZA 4YHKH 2EINB 4K9JA 2F15A 4KX7A 2WO2B 4HSCX 2AZAA 5B1KA 2H5UA 4OLEA 2XVGA 3ALXA 3EDEA 4NP9A 3Q05A 2OJZL 4P4KD 3MO1B 1RIHL 2VDOB 3D25A 2AK4B 5T33H 4H88H 2QKSA 4PIRF 4Y5XA 4A63A 2VLRB 2P7TA 5HVFB 1KGWA 3DSNB 5JZ7D 2C9VA 4UNVA 3DO7A 3P9LA 2H2SD 2Q8AH 2F5BH 2QEJA 1P4LB 2XJLA 4JRXA 4NUGH 5CM1A 5K9QG 2G3ZA 4UANA 1S9XB 5F6HI 4HP5A 1JP5A 1N0XH 2FRGP 1TQBC 2NX5A 4QY8A 1J1PL 1PZBA 5C0CB 1S7RB 2VDMB 3HG3A 3BSHA 3D85B 2XN9A 3WEBA 1P4IL 3VXSB 2Z8VC 1JGIA 1R17A 4Y2DB 1MVFA 2WQSA 2XWTB 2NY0C 4NC1C 2Q8BH 2YPVH 4AIOA 2D7TL 1NUDA 1XD1A 1Z2KA 4EZJA 3U30B 4NO3B 1NC2B 1M9SA 2IGFL 1R3JA 4ZYKB 3QG6B 1TTUA 4MZIA 2EIDA 4OLXH 5IKCA 1OOWA 4Y5YA 1A21A 1E4WL 3B1TA 2X4QB 1KCWA 3MRLA 1YEKH 1QUPA 3WTYA 1OT1A 1G7HB 3B9EA 4BKLB 4YBQD 4WFHE 5EPMA 4Z7QB 1TKWB 3U6XA 4Z5RA 1O7DC 4UTBA 1P4LA 2YD1A 1H19A 5C8JA 2FLBT 1V5JA 3MUJA 4UUJA 3TJEL 2A9DA 3S4SG 4HIQA 3NRQA 2BVOA 2V9TA 4EUPH 3VFOB 2MHAA 3MLRL 4FJZA 3R18A 4JJHA 3H55A 1WEJH 1W9XA 3QDMB 1F41A 4TULH 4QXVA 2C5DC 4OF3A 5D9SA 1N2RB 3C60A 4FQJL 2EDJA 2IAND 1TJXA 5JQ6H 3CSYB 4ANKA 5HI3C 1I8AA 3AU0A 2QVFB 3RVXC 1P2CB 4S0HA 5TFSH 3M1OA 3JYCA 4M48H 5HGHA 3RDTD 5KBKA 1OVZA 3SOBH 4OZ4B 2OL3H 3L3KB 2WQVA 1EIBA 3AS1A 3GMNB 3IJEB 4AVHA 1R3HA 5AYUH 4OF0A 3DUUB 3KE0A 1L0QA 3SB3A 2H4EA 4N2EA 4ODBD 4Q4EA 1YMMD 4U4IA 2XZCL 1DVZA 3KLAB 1J1XL 4QGTA 2WXMA 2VKWA 4OD1H 4YO0A 4S1RH 3MROA 2ZOOA 3OAUH 1RZGA 2X3AA 3NJLA 1JAEA 4GI8A 2X6AA 2HFFA 4XO4A 1YEKL 3VA2C 2QVMA 1WFNA 3WHE1 2MJWA 5BOPA 1YPZB 4DHLA 5DYOB 1GGBH 1YSOA 2XV6B 3PWJA 2JXMB 2MCMA 5BJTA 1T21B 1JXJA 3Q2CA 4AJVA 5JIQA 4MASA 4QRPA 1I7RA 3ULVE 4NNPH 3RB7A 1S7UA 1I4FA 4PPTA 3KVPA 4KC3B 4KXZI 5E0FA 4YWGH 5IHZB 3D6GA 1QBMH 3UP1A 1JGEA 1I3RB 3DRQA 1CICB 1J9QA 1I82A 2KERA 1J9CT 4TM9A 2BP0A 3HE6B 5L9DL 2FE0A 4XVJL 3DX9B 3L1EA 2R23B 4QNPE 3N06B 4FQPA 2HKHL 4LCWD 1DANT 5FKAA 2NNAA 4IHOA 3TURA 3NDZE 4L5FE 2VQTA 3DSFL 3T6ZA 1RH8A 3TZVB 2DBJA 2Y3NA 4S1DD 4Z7WB 4HJGB 4GW1A 4KY1H 3GXFA 5LAXA 2J25A 4POUB 2ED6A 4YZFF 3VM7A 2AAVA 1KFAH 3KBHE 3LD8C 1CLCA 4KNSA 3W81A 2FJUB 4BA0A 5D70L 3HPLB 2JE8A 3ME0B 1S7SA 1R5WB 4KXBA 4XRCB 3ZHKA 4DP2X 4Z7QE 2FSDA 4LEXL 2LAAA 5KN5A 5KVMC 4UOQA 3L5XH 2L7QA 1CMOA 1QTPA 4F9PC 5E8PB 5AYQA 4DEUA 1XSOA 5J6GB 4BE5A 2GBAA 2QADC 2V37A 2NXZD 2ATPB 4BH7A 2R83A 4XR8C 1QFWI 3N85H 2FBJH 4G9FA 4JFEA 4N5EC 1QEWA 1M7UA 1F45A 2VJ0A 4LSQH 1GTNA 5F96L 3AAZA 1M7DA 2R0KL 3MCLH 2VLLB 2ZP9A 3GRBA 2HN7B 4C56B 1CVSC 4O58L 1SBSL 5E03A 1AGFA 2GTWB 1GC1L 2JKRM 4B7IA 3D2UA 4XH2B 4LRNH 5FO7B 1O6SB 1Y07A 3BUDA 3CSTA 5GISL 4Z3TA 4HT1H 1JPST 3FQTA 4UT9A 3LNHA 1ZCRA 2Z9TA 4Z8FH 2WXGA 2CK2A 2YBRB 2DQTH 1J0HA 2VUKA 5EIVA 5LB1A 2AABH 4JPKL 5I1LB 5CSBA 2CIKB 3ZL4L 5DEGB 2UWEE 3FRUB 3IJYA 4OGQC 1ZSHA 3RB5A 1BZOA 2V3DA 4M6NH 2OMYA 3EH5B 5ANMA 2XBDA 1GGUA 3V9EA 1PSKL 1R46A 1YC8A 3CLFL 3L17A 1SOXA 5I1CH 2VN5A 4NNYB 5IJDC 4KITB 2IANE 1SMOA 4IOSD 4Y16B 3WENA 2D3LA 2Z31D 4ZW6A 4MJID 3MJ9L 1OF0A 2CKBL 3DTXB 1E65A 4IRZL 4WUUD 1GTFA 3AWGA 4FL4B 1AAJA 4HC1A 3GBLA 4Z7UA 1QAWA 4XNYH 3L4ZA 5EU6E 3HBPA 1OSZB 4EVNB 1B3JA 5KWYC 1J5IA 3MRNA 4AK1A 3SDAB 2E6PA 3U0TA 1A0QH 1E9PA 1PMYA 4I3SL 3VH8B 3QDME 3EDKA 4BM7A 3DSFH 4PSRA 1CF8L 4JVWA 5AVQB 5C0BB 3CZJA 5KSBE 1A7RL 1NFDB 4BWWA 4L37A 1A64A 2IIJA 1BYPA 4FQXA 4N5ED 4OCRL 5D1XE 4F20A 5TQ2H 4QO1B 4CL7A 4YHYB 3KYMB 5HHOB 2XV3A 5C6TL 4Y2LA 3SBWC 1BG9A 3CLEH 3T3MB 2PPFA 5MERB 3T9WA 3IF1B 4FC3E 5CFHA 5JPMB 5SWZD 4RETB 1CFNB 2BFGA 5TF1H 4PIBA 3MBWA 1P6AB 4GLRI 2DTML 1MJUH 5F88A 4YR6B 4R84A 2AXHA 4F33B 1O6SA 2CNYA 1P1VA 2G2RA 2WB1A 5EZOL 2VSKB 4QEGA 4YHMH 3SKOB 4M6NL 5KYWB 3C5SB 5BRPA 3DDGA 5IREA 1IGYB 2D7PA 3LEVL 1JWSB 3DURA 1Q4NX 5EIIG 4U31A 4OM0L 4EXPX 5E8DH 1BM7A 2AF2A 3LKQA 1JTOA 4FFZH 1F5WA 3QZNA 1J0ZA 4JFZL 1T20B 4MNGE 5AYUL 1J05A 3MR9A 1KCVH 3DNKA 3VXRA 4DQAA 4DKTA 3MJ8A 3ARQA 1BQHB 5HYJD 1AC6A 4AITA 1SYSB 1HYSC 3M1CA 4JM0A 3ARUA 5GS2H 2EIMB 4QHLA 1L3WA 2XWRA 3RWGA 1IKNC 5E94B 1RURH 4HA1A 4K71C 1IM3D 3SKUD 1U8OA 4LEOA 4WKZA 4AM0B 4L05A 4P4KB 1NBCA 5DHYA 5E8EA 2H32A 4ORZC 1WHPA 2VR9A 4XBMA 3G08A 3TNNB 1SFHA 4CSZA 3FK3A 1XZWA 1XIWA 3HBGA 3LNGA 4NWTL 4DZ8B 5BQDA 3OR6A 2XA8L 4HD9A 4QUOA 5GZOA 1ZKAA 4KJQC 4RAVA 2V8LA 1T1WB 4LSPH 1DQKA 2UZIL 5HJDA 2EUXA 3QULB 4PJCB 2VLLA 4KXCA 1DJWA 4FFYH 3NQKA 3S35X 5D5MB 1RUPH 1J5CA 2NTSP 2V17H 2X7LA 3VGGA 3OMIB 2XWBB 1WH0A 5KJ7E 2XOTA 3IDYC 5C07A 1S5HB 2Q86B 1ODUA 4N2KA 1BLNB 2BC4B 4BZ1L 4TSAL 4K5MA 5E8PA 4HIJB 3VD3A 1Q1JH 4N0RA 5TE6L 1HTYA 5DYOA 1OAQL 3S37H 5DJ2B 4ZO6A 2QHRH 4YDJB 4M7LL 1S4IA 2FT6A 5AKTA 1INEL 4X7SL 1HOCB 5JXAL 1WD8A 3GSVB 2GBVA 3OMAB 4XCCL 4E41E 4YO0B 3IKCB 3BAKA 2K8MA 5IZ7A 4ERSH 1MHPH 4RBPH 1NCBL 3BSZH 5BZXA 3DX6B 2NY3B 2DQDL 3UBXI 4XXDA 3TYFB 3MLVH 1CC3A 3ORJA 5IMMB 3EYSL 3ZYZA 3QYNA 3GIZH 2HRPL 3T0XA 3V10A 1UZ8A 4S2SA 5HGDB 4AYDC 4ESKA 3IM1A 3VVWA 32C2A 5EV7A 5C7XL 3V6ZA 1AFVL 2R0LL 3KGTA 1CICA 1XL6A 3GSUB 2R59A 3MUHL 2J88L 1EEZA 2E47A 3IPFA 3CSYA 3MJ7B 3ZHLA 3IMSA 3WDJA 2JV6A 4LLAA 1S7UB 1X6LA 2YAMA 4Y4FC 4PRID 3KXFA 3S8GB 3VQ2C 1QRNA 3QR2A 2VR7A 4JZOA 1LEIA 2ORBH 1YYML 2M8XA 2XFGB 3PWJB 1W8NA 5FXCH 2YD3A 1CBJA 1N18A 5L2KE 4RRPM 1WZMA 2VH5L 2ZKXA 5KVGE 5AOLA 3FKUS 1KB5A 2W9DH 3I6GB 3QHFL 3C8DA 4LQFL 2NR6D 4YC2B 4KQ0A 1DQVA 1PBYA 1X5LA 1JTTA 3IJHB 3P11L 4N8VB 4V1DB 1ZJBA 2VW7A 2ZWNA 2YD5A 2EH7H 5K39A 4B9KC 3KHOA 5ISZA 4KPHL 3TH2T 5I1IH 2VR6A 3TIDA 1NCIA 2D9CA 3M1BA 5FYLE 5GGSB 3ZLQC 1BZEA 4GBXB 5EU5B 3S36X 4DOHB 2P5ED 4KZDH 5FDWA 1SXSA 4BSJA 1ZJAA 2HZHA 3G08B 4YDMA 3ABGA 5FF6A 3P02A 4A37A 3WIFA 2A99A 3FDWA 4GUCA 4IRSD 3PGDA 4FG0A 2XPGA 2Q6WB 2DJ4A 4N24A 3PE9A 1WZKA 4PJAF 3QIUA 3D0LB 1MWAL 4EDXB 4L0PB 2F08A 3NSYA 3FCSA 4L23A 2HT3C 1C7SA 4N0FB 5C09A 2X10A 2Z35A 2D3VA 3BP5B 3MV7E 1LO0L 4F1ZA 2I60L 1WYJA 5JIMA 1YEJL 3ILEA 4WFGD 4XNQB 2Q8BL 4KUCD 4OZHE 3HMWL 3SDYL 2DOCA 3ECBB 1LWHA 5EUKB 1MF2L 5F44A 3IGFA 3WIIL 4AGLA 2X5PA 2CHXA 4UQEA 1VESA 4G6AC 3VG9B 2DEWX 2WIIA 1R1CA 4JB9H 5ESVA 1H15A 4ELKA 5FYKD 4U6VH 3V0AC 2IO5A 2E5EA 2Z35B 2UXTA 4JQVA 1E28A 2XWJA 4YHLH 5I66B 3V0VB 5AFAA 2UZPA 1IGML 4FFZL 4OGXH 5J1TC 4GEIA 3VRLF 1FAKT 1DR9A 4QXGH 4N8CL 3FBQA 3VACA 3QI9C 3PLYA 3IT8D 3PGDB 1PNDA 1WC7A 1P9MC 2OK0L 1FBIL 2R8SH 2IALB 4K3EH 1JFQL 1RIHH 1D9KC 2R56H 4J3OD 5DJCB 3AXIA 3TVMA 3U4AA 4FNQA 3WIAA 3FW6A 3B3BA 1QP1A 2X09A 4NPYB 2HLFD 5DTFB 4RNRA 3CCHB 5FYLL 3D34A 1EXUA 3X13A 3CN3A 4L8SC 4C56D 1FE8L 5TF1L 3PHOB 1TTCA 4K3JH 3NP3A 5EOQH 3KPLB 4KY2A 1SF5A 4WEEA 4XVSL 3B2MA 3ARWA 1MCOH 3MJ6A 4XWGH 4OD3L 3GZKA 2A9CA 3QISA 1UFGA 3VH8A 4C4KT 3HZYA 4UB0L 1EJFA 4CU8A 4P5MB 3JWDH 4CADA 4K3DL 3C09C 5ITFB 4LGRB 1MLBA 1VGKA 3I9IA 1JHLH 3SGDI 5C7XH 1EDHA 4ZUUB 1TJMA 5JYLA 5LBSL 2WOYA 4LSSH 2OR9L 3NIFE 1FO0A 3GIZL 4ATTA 5J5EA 4PRBA 5L8JB 1KNOA 1NDTA 3TVMD 3C5ZD 1FFTB 2RCSH 3H8NA 4TKWA 4CBPA 2Z31B 1S5IL 3SDCD 1GYAA 5JDJA 3MV11 3ZE2B 4N0UB 4UDUB 4PGJA 4NCDA 1FPTL 2ADJB 2XYBA 4NQED 1GYCA 4TMPA 4X7SH 4YX2L 1DBBH 4I9XA 3TS8A 5I15H 4XZUA 1MAMH 3MOBH 1OTUC 8CGTA 5BW7A 5JW5A 4QTIL 1DQML 3CU1A 5DUBB 3RQ3A 4I2XA 1MFEL 1P9MA 1SJEB 1TZHA 5IQ9A 1Z5LA 5AL0A 3SQBA 1OW0C 1NEZA 4G83A 4EE2A 4BQ8A 2MPAH 1QFWM 5D1XD 2IXQA 4GAAA 1B0GA 2EAEA 1XXDC 3LN5A 3K4DA 1CYXA 5DJYB 1QKZL 2Q2EB 5F1IB 4L8SA 2Q3AA 3BKCL 3HIZA 4HKZB 1CXHA 3N3EA 1Y7VA 2BVPA 4FKEA 2CDFA 3LIZL 4R4ND 2D7MA 1H6TA 5AOZA 3WFHA 5SWZB 3FO1B 3HN8A 4HKXB 4E2OA 2AJZA 2JK5B 4LPYA 2F19H 3I3BA 4L8CB 3OG6B 3PGFH 3F7YB 3KR3H 1TF4A 4PTUB 2BK8A 3V0HA 3HAEH 1NFDE 2ICWJ 3T4YB 1AC0A 1KIPB 1A7RH 2OULB 3WY3A 3RVVD 4JY4B 3VFMA 3OAYH 1AZZC 4OZFH 3QORA 1NAKH 2F53E 3QIUC 3TBSA 1GGCL 1MFDL 2DPKA 4K5PA 3MXWH 2UWEB 4YHLL 1HINH 3L1OH 3FFDA 5GS1C 2ID5A 2Q7YA 4JANA 1BEYH 5J06A 3QRBA 3SE6A 1KLGB 3VFMB 4R5VA 3HI5L 1QW9A 4F8PA 4OM0H 4PLKD 4U6YA 3EDDA 2F5AH 4FNLH 5CS7A 2J5WA 5IM7B 5AKVA 1UM4L 2IPTL 1TVHB 1KXHA 1ZA6B 2FCBA 3MRKA 4XXCC 3VFGH 4JPIB 3GJEB 5F7AA 5DD6B 2VDLB 5DQ9B 3PWUA 4ZBJA 4WF7A 5BW7C 4CILA 4Z95H 4MB4A 4HIXL 4XP5L 3WNLA 3T4AA 2H6PB 3AROA 3IFNL 4IQHA 2OS7A 4H8UA 2MEJB 4R97B 5E2TL 4KV5E 1JYXA 2XVKA 2X4UB 4FS0A 3JV4A 3QCVH 4F3FA 3RWEB 4YVNA 1BQLH 1UWEH 1S8DA 3N41F 3GKZA 3OAZK 1OP3H 2QSQA 4M6ML 4WFFE 4W93A 2KHAA 4H25A 5I75B 1F3DJ 3HI1A 3OWRA 3I3DA 4RWHA 1DUZA 2VMEA 3MBWB 1AY1H 2G5RA 4BV1A 4GAYA 3ULVH 3AC0A 5F1SA 5JUEL 43C9A 1GZPB 1KDIA 4AGQA 3MN8A 2C3XA 5HGAB 4P0DA 2DQCL 4M7ZC 3NYKA 4XHJC 1YDPA 1MI5A 1NSNH 3OZKA 2JKSA 2F8IA 4Q58C 3WJLA 4FXGB 1NWPA 4NZTL 1OD7A 4LP4A 2DY2A 4YHPA 1JERA 2CKBH 4QHKI 5EIIB 1IQWL 4R4FH 4P4KC 2BIMA 1MCWW 2OL3L 3CFCH 5B39A 3ZE1B 4DCQA 1NM9A 3FN9A 5KVDE 4MAYA 4XN5A 4UTBL 2H3NB 2YLKA 2DM4A 2CH8A 3A6OA 4ANUA 3VFOA 1IE4A 2X6BA 1WBYB 1KIUB 3MLUH 2WMPB 3QZBA 4WHCA 3SJVE 3RFZC 2X40A 5AZUA 3UZEC 1VKXB 5FW7A 5E2VH 1I3UA