3CGCA

Pyridine nucleotide complexes with bacillus anthracis coenzyme a-disulfide reductase: a structural analysis of dual nad(p)h specificity
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
444
structure length
444
Chain Sequence
MNYVIIGGDAAGMSAAMQIVRNDENANVVTLEKGEIYSYAQCGLPYVISGAIASTEKLIARNVKTFRDKYGIDAKVRHEVTKVDTEKKIVYAEHTKTKDVFEFSYDRLLIATGVRPVMPEWEGRDLQGVHLLKTIPDAERILKTLETNKVEDVTIIGGGAIGLEMAETFVELGKKVRMIERNDHIGTIYDGDMAEYIYKEADKHHIEILTNENVKAFKGNERVEAVETDKGTYKADLVLVSVGVKPNTDFLEGTNIRTNHKGAIEVNAYMQTNVQDVYAAGDCATHYHVIKEIHDHIPIGTTANKQGRLAGLNMLDKRRAFKGTLGTGIIKFMNLTLARTGLNEKEAKGLHIPYKTVKVDSTNMAGYYPNAKPLYLKLLYRSDTKQLLGGQVIGEEGVDKRIDVIAMALFNKMSIHDLEDVDLSYAPPYNSVWDPIQQAARRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pyridine nucleotide-disulfide oxidoreductase, class I
publication title Pyridine Nucleotide Complexes with Bacillus anthracis Coenzyme A-Disulfide Reductase: A Structural Analysis of Dual NAD(P)H Specificity.
pubmed doi rcsb
source organism Bacillus anthracis str.
molecule tags Oxidoreductase
total genus 151
structure length 444
sequence length 444
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3cgcA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3cgcA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3cgcA02
2IIDA 3CGEA 4ADWA 1QO8A 4H4WA 1BZLA 1S3BA 2JB2A 3WE0A 1PJ5A 1YY5A 4H2RA 3OZ2A 4O5UA 1CC6A 2E1MA 2H88A 2XLTA 3IWAA 2O9ZA 2GMJA 2X8GA 4UDRA 4D03A 1PS9A 2I0ZA 3CGDA 1JRXA 2X8HA 3GD4A 4USQA 5KWFA 3II4A 2R4JA 4LA1A 3AEDA 1ZP0A 1GRGA 5U63A 5JCMA 5C3JA 1VG9A 4YKGA 2WOWA 2Q6UA 3PS9A 4OPIA 2WOIA 3P9UA 4U8KA 4A99A 2VVLA 3CIRA 4H4UA 4J57A 4CY6A 1KDGA 5LV9A 4OPGA 1TDFA 2C3CA 4IA6A 3CGCA 2RABA 2WPFA 1CL0A 4AT2A 2XLSA 1N4WA 2GR3A 2B9WA 4EM3A 3DK4A 2C72A 3DMEA 3M13A 1MXTA 4JN9A 4BJZA 1NG4A 5EBKA 4EMIA 4CCQA 5BRTA 3RP8A 2OLOA 3ALJA 1CJ2A 1OJCA 2XLRA 4Z25A 1K4QA 4CCRA 3QVRA 4EQRA 1VQWA 3NYCA 2Q0KA 4A7AA 2B7SA 3S61A 1IUWA 4M52A 4K7ZA 1IJHA 3CNTA 4EQSA 4TM1A 3AEFA 2XLPA 2B9XA 2BK4A 3SGLA 1JEHA 2YG6A 4RG3A 3AE4A 1GRHA 2BA9A 2WOVA 3DK9A 3AE9A 3NLCA 5BVAA 3UKHA 4HB9A 3EANA 4AT0A 1N4VA 3V76A 2CDUA 4Z24A 3IHGA 1EBDA 3SFEA 2YR6A 4A79A 3AE7A 2ZZCA 1KNRA 2V60A 3GDPA 2ARDA 4MJWA 2BS2A 1CJCA 2DKIA 2RGHA 3L1RA 1GRTA 2GQWA 4EMWA 4Z2TA 3QFBA 2XCGA 1H82A 4TLXA 3OC4A 3K7QX 4JNAA 1B8SA 1V59A 2YLSA 1ZOYA 2VQ7A 5BULA 2B9YA 1YQ3A 2GAHB 3IF9A 3FG2P 3P4PA 2C7GA 3UOZA 4Z43A 3DGHA 1YKJA 2OA1A 1LV0A 1GXFA 2YAUA 2BK3A 3B6DA 3P1WA 3M12A 3UP5A 4YSHA 1OJDA 2XVJA 1LQTA 4TM4A 4U8IA 1PN0A 2W0HA 3CGBA 4ZCDA 3ICTA 4YWOA 4TM3A 3LXDA 5KRQA 1FEAA 2C66A 2YG3A 3RP7A 4EMJA 3UKQA 1GOSA 1QJDA 3AE2A 4KX6A 2VVMA 3GD3A 3F8RA 3C96A 4N9XA 4K2XA 3AE6A 5FS6A 2WU5A 2EQ6A 4B63A 2R45A 4A6NA 4EIPA 1KFYA 2EQ8A 2ZZ0A 1Y56B 3KPFA 4J33A 2BC1A 4BK3A 2FJAA 2XFNA 5JCNA 2R4EA 2YR4A 3NK0X 4A65A 4YSYA 4YTNA 3QSEA 2GH5A 2TMDA 3CNSA 3QJ4A 4J31A 1D7LA 2VOUA 3AYLA 2R0PA 2WQYA 4H7UA 3CNDA 2JB1A 3NN6X 1L9EA 4NEVA 2WDRA 3GWDA 2YLXA 2BK5A 1LJ1A 2FBWA 2WS3A 5EOWA 2CVJA 1VG0A 5HYMA 4WCTA 2YG4A 4OVIA 2OAMA 1GT8A 4RSLA 1GTHA 3ABVA 2WHDA 3RNMA 1GTEA 4GF7A 4U8OA 5IQ4A 1M6IA 4RG4A 1REOA 4U2LA 4BJYA 1UKVG 3P4SA 2TPRA 5CKUA 4GR1A 3AEGA 3CPJG 3Q9TA 3BNUA 4I59A 2WETA 1ZKQA 1F6MA 2GF3A 5EB5A 1X31B 3VR9A 1E6EA 4WX1A 2VRLA 1PBDA 3AD8B 3LZXA 4H2NA 2GR1A 4FDCB 1RYIA 4X9MA 2QA2A 5DBJA 4DSGA 2BACA 4GUVA 4AOXA 1DXLA 5TR3A 1PBBA 2JB3A 3AB1A 3RHAA 1DOEA 4APNA 1NDAA 1BF3A 1IUVA 3EPTA 3UKKA 3VRBA 3ZYXA 3CPIG 4OPDA 3GSIA 1ZOVA 1ONFA 4B68A 1PHHA 4YKFA 2YG7A 2XVHA 5GRTA 1E1KA 3DK8A 3NIXA 4LU6A 5KOWA 3K7MX 4PABA 4CNKA 4K5RA 4P9SA 2OLNA 3ATQA 3IC9A 3DJEA 4XWRA 3AE1A 1PJ7A 4C77A 1XANA 4JQ9A 1Q1RA 2ACZA 1H7XA 5GSNA 2XYOA 2Q0LA 2H89A 4H4YA 1LVLA 5U1OA 3VQRA 1SEZA 4BURA 1Q9IA 4NTCA 2ZZBA 1GRBA 4TM0A 3FBSA 5U25A 4YXDA 5C2TA 5BUKA 4J56A 3NTDA 2C3DA 3UKPA 1BGJA 2AAQA 1F3PA 1P2HA 2JAEA 5J7XA 2A8XA 2WU2A 2YVGA 1RSGA 2V61A 5CQFA 1OJAA 1M64A 1D4EA 2JBVA 4U8LA 2R0GA 2YM2A 2XLUA 1B37A 1MOKA 1PXBA 4U8MA 4IA5A 3FPZA 3NYEA 3B3RA 4AP3A 3ICRA 1CC4A 4IVOB 3ICSA 1TDEA 4XWZA 3AEBA 1JU2A 1RP0A 1YQ4A 3AD7B 3BHKA 3QSSA 4JY3A 1DNCA 3E1TA 3I6DA 4U8JA 4ZCCA 4AP1A 1H84A 2C70A 3QFAA 1CC2A 1BWCA 3QVPA 2Q7VA 4OPLA 4EQWA 3V3NA 5KVIA 3FMWA 4OPTA 4FX9A 4EIQA 2Y6RA 2EQ9A 4ZN0A 4H4SA 3NK1X 1JNRA 1NPXA 1KF6A 3AD9B 5FS7A 1IUXA 3JSKA 3LJPA 4Y4NA 4H4ZA 1ZMDA 4A9WA 3GWFA 2E4GA 3NGCX 5HHFA 5ER0A 2NVKX 2YR5A 3ALMA 2B7RA 3G5RA 5FMHA 1CHUA 1NEKA 2X8CA 2VVLG 3H8IA 3P4RA 4GCMA 4H4QA 2A89A 2PHHA 4CY8A 4DSHA 1FL2A 1GETA 2WESA 2EQ7A 2YVFA 3SM8A 3T37A 4C3XA 1EL9A 3PVCA 1PXAA 4K22A 3LOVA 1ZY8A 2GVCA 3DJDA 3KVEA 4OCGA 2YQUA 2R46A 4YSZA 1AOGA 4DNAA 2NPXA 2WBAA 5FS8A 1B4VA 3BNMA 5EB4A 2CFYA 1CBOA 2C65A 4H50A 1Y56A 4D04A 3C4NA 4B66A 1H83A 1ELIA 2OALA 1NHSA 4H4TA 3CNJA 2FJBA 2XVEA 3DJGX 3C4AA 3URHA 4C74A 2YLTA 4BK1A 1KSUA 2WPEA 2RGJA 3NYFA 1YQZA 4YTPA 4H4PA 1N1PA 2XVFA 3G5QA 1PBEA 4A6NB 1O94A 3UOXA 2YLZA 4YTMA 2F5ZA 2V5ZA 1LQUA 3NN0X 1FOHA 1E39A 2C67A 2QCUA 4FK1A 4Z44A 4USRA 2Z5XA 4J34A 2QAEA 3EF6A 4ICYA 3VRDB 3AEEA 3UOVA 2YWLA 2X50A 1PXCA 2XFPA 1Z6LA 1LTXR 1NHRA 3BHFA 2V3BA 1GSNA 1PDHA 2GV8A 3UTGA 2JK6A 3GRTA 3KLJA 4C3YA 2APGA 1IUSA 2WP5A 4Z26A 3UKLA 4UDPA 4JNQA 3R9UA 4GRTA 2V6OA 2GQFA 4NEWA 4H2QA 3COXA 3AE8A 1DJNA 1S2QA 3K7TA 2Y6QA 3NNEA 4O5QA 3O0HA 1NG3A 3D8XA 1E1NA 4K5SA 3DA1A 1XHCA 2R9ZA 1IUTA 1TYPA 1DODA 2VRMA 3AE3A 3UCLA 4PAAA 4H4RA 1EL8A 2VZ2A 2VQBA 1H6VA 3I3LA 1GRAA 3H8LA 4H2PA 3UTEA 3HZLA 4U2SA 1COYA 5JCIA 2YG5A 2WDQA 3BI5A 3F8DA 5M0ZA 2XFQA 4HA6A 3KU9A 4XXGA 4UP3A 3RP6A 3GRSA 3EAOA 1CJ4A 1D4DA 1Y0PA 3H4KA 1F8RA 4U8PA 1O5WA 3KD9A 1ZX9A 3LB8A 1S3EA 4U8NA 1GNDA 1DOBA 4J2WA 3LADA 1FEBA 1TDKA 3Q6JA 1H81A 1FECA 1EL7A 1N4UA 1JRZA 4NTDA 5KXJA 3VR8A 4GDEA 3P4QA 2C73A 4I58A 3NTAA 3F8PA 2GB0A 1L0VA 3GDNA 2YM1A 1HYUA 1PJ6A 5L46A 3IHMA 4C5OA 4X9NA 3ITJA 4BK2A 3K30A 1OJ9A 3NK2X 1L9CA 2WP9A 1NHQA 2AQJA 1E1LA 3UOYA 1GPEA 3AXBA 3CPHG 2BXRA 2BYBA 2V3AA 4X4JA 4GDPA 1CF3A 1GESA 2WPCA 1E1MA 1DOCA 1H86A 2C76A 3REDA 2PYXA 3QSMA 2A87A 1H7WA 4EQXA 3GMCA 4FK1C 2XFOA 3ISHA 2YLWA 1TDNA 2J3NA 4B69A 4Z2RA 3SQPA 1E7PA 2GMHA 1F8WA 1P2EA 2CULA 3AEAA 4IV9A 3NHOX 4JY2A 1BGNA 2BS3A 4H4XA 2AR8A 3ALLA 1MO9A 3NH3X 2BC0A 5KOXA 2GAGB 1XDIA 3GYJA 4U2TA 2C64A 3GMBA 4J36A 1GERA 1S2YA 1XPQA 2BABA 4Y4MA 3AYJA 2XVIA 5JCLA 1L9DA 1ZDLA 4OPUA 3L8KA 2GEWA 5IPYA 3GYIA 2X3NA 1D7YA 3ZDNA 1D5TA 2JKCA 1GREA 2QA1A 3CTYA 1LPFA 1JRYA 3G5SA 5HY5A 3S5WA 3M0OA 3PO7A 5J60A 3NG7X 1GEUA 3NKSA 5HXIA 2XDOA 3UTFA 3DJJA 2WEUA 4A5LA 2YLRA 2ZBWA 1QLBA 4OPCA 2WDVA 3UTHA 1EL5A 3AYIA 3KKJA 3UKFA 4CRTA 3DGZA 2BXSA 4AOSA 1KSSA 5KVHA 2HQMA 1FCDA 2R0CA 1K0JA 1JOAA 4BV6A 3AE5A 1K0IA 3CN8A 1GALA 3NT6A 4CBQA 2BS4A 2UZZA 1BKWA 4LIIA 4DGKA 4IVMB 1DJQA 1TDOA 5FS9A 1B5QA 1F8SA 1Q1WA 4JDRA 4REKA 2E5VA 3V3OA 4NTEA 2BCPA 1VRQB 1VDCA 3CNPA 2GRTA 2B76A 4TLZA 4ECHA 1NHPA 3KA7A 1W4XA 2FJEA 3VRAA 3UKAA 4NZHA 1O95A 2IVEA 1ZMCA 2XFUA 2GR2A 1CJ3A 1KNPA 3LZWA 1D4CA 5M10A 4H4VA 2WP6A 2IVDA 2YVJA 4CNJA 4EM4A 1NENA 1PBFA 4B1BA 5JCKA 4B65A 3SFDA 1IUUA 3ADAB 1NAAA 3DH9A 1ZK7A 4YSXA 1GRFA 4KPRA 3FIMB 2BCGG 2FJDA 3ATRA 4B67A 1JNZA 2DKHA 4Z2UA 1OJTA 3BI4A 4B64A 1K0LA 3AWIA 4UDQA 1GV4A 5IQ1A 4YT0A 3BI2A 3D1CA 2GR0A 3AECA 1TRBA 3NRNA 2RGOA 2C75A 3UP4A 1TYTA 4Y4LA 4E0VA 1PBCA 2X99A 2Z5YA 4K8DA
chains in the Genus database with same CATH superfamily
2IIDA 4ADWA 1QO8A 4H2RA 2W3RA 3TCSA 4O5UA 1CC6A 3D47A 3CGDA 3SR6B 3FCPA 3AEDA 1ZP0A 1GRGA 5U63A 4YKGA 4OPIA 1SJDA 4U8KA 4A99A 2VVLA 3CIRA 3S47A 3ES8A 3ZVHB 3OPSA 3DMEA 3L5OA 3P93A 3ALJA 1CJ2A 1FFUC 4NNJA 3S61A 5FJOA 1IJHA 3CNTA 2XLPA 3VCCA 1EBGA 1JEHA 2YG6A 3NFUA 3MUCA 4G8TA 3DK9A 4TVWA 5BVAA 1N4VA 4Z24A 2V60A 3MY9A 4MJWA 2BS2A 3L1RA 3QFBA 1B8SA 1V59A 1ZOYA 3EKGA 3P4PA 2C7GA 3DGHA 1GXFA 2YAUA 2BK3A 3Q4DA 3P1WA 4YWSA 1OJDA 2XVJA 3DG3A 2W0HA 3V5FA 1FEAA 3CK5A 1NELA 3RCYA 3RP7A 4EMJA 3R1ZA 3AE2A 3F8RA 3DEQA 2EQ6A 3MKCA 2POZA 2R45A 1Y56B 4J33A 3U9IA 2R0PA 2WQYA 3CNDA 3NN6X 2NQLA 4WCTA 2YG4A 2OAMA 2PTZA 4RSLA 2WHDA 2TPRA 5CKUA 2QGYA 2QDDA 1X31B 1E6EA 2GR1A 4FDCB 4X9MA 2GL5A 3ZLHA 1DXLA 2OZ3A 1TKKA 1BF3A 3VRBA 3VC6A 1JPDX 3CPIG 1ZOVA 4YKFA 3UCCA 2XVHA 3K7MX 4P9SA 2OLNA 3IC9A 1PJ7A 2BRAA 2XYOA 3VQRA 2ZZBA 3CB3A 3TWAA 3R10A 1F3PA 5J7XA 2A8XA 2V61A 5CQFA 4U8LA 4IA5A 3FPZA 3ICRA 1KKOA 3KUMA 1PDYA 2PU0A 3BHKA 4JY3A 4GISA 3E1TA 3I6DA 4ZCCA 5FJRA 3QFAA 1BWCA 3I6EA 2Q7VA 4EQWA 3FMWA 4H4SA 3UXLA 5FS7A 1ZMDA 3GWFA 4A3RA 4ZOHB 2YR5A 4HCDA 2B7RA 1N61C 4GCMA 4H4QA 3JVAA 3SM8A 2YVFA 4JN8A 1W6TA 1PXAA 2R46A 2NPXA 5FS8A 3BSMA 5EB4A 3C4NA 4B66A 1NHSA 4H4TA 3CNJA 3URHA 4BK1A 2WPEA 3NYFA 1VQZA 1N1PA 2XVFA 2YLZA 3NN0X 4J34A 3AEEA 2PTYA 2QJJA 3V4BA 1PXCA 2XFPA 3I6TA 1GSNA 2GV8A 2JK6A 3N4FA 2AL1A 3R9UA 4JNQA 2GQFA 3SX6A 1DJNA 3O0HA 3DG7A 5BOFA 1STZA 3R07C 3THUA 2VRMA 1DODA 4H4RA 3SQSA 2VZ2A 1H6VA 3SBFA 2HZGA 3OW1A 4G73A 2YG5A 5M0ZA 2OKTA 4HYRA 1EC8A 1O5WA 1DTNA 1ZX9A 3LB8A 1S3EA 1TDKA 4JHMA 1JRZA 3BJSA 4GDEA 3RO6A 4IHCA 1L0VA 3T2ZA 1PJ6A 4BK2A 3UOYA 1GPEA 4X4JA 2WPCA 4DHGA 3PG6A 4FK1C 3ENLA 2YLWA 3V3WA 1P2EA 3HYXA 4JY2A 1BGNA 2AR8A 4E8GA 1XDIA 5BOEA 2OFJA 2C64A 3NVWB 1S2YA 2BABA 5KMQA 3T14A 3GYIA 1LPFA 4IZGA 3M0OA 3NG7X 5HXIA 4F4RA 4A5LA 2RDXA 2ZBWA 3I4KA 2WDVA 2BRYA 3KKJA 3UKFA 2W3SA 2HQMA 4DX3A 3RR1A 3AE5A 1GALA 4LIIA 4IVMB 1TDOA 2OVLA 4KPLA 3D46A 5FS9A 4REKA 2XGZA 3DG6A 2BCPA 2AL2B 3RITA 2GRTA 2B76A 4ECHA 1NHPA 1W4XA 2FJEA 2E5AA 2FKPA 2GR2A 1KNPA 5M10A 2YVJA 1RM6B 3FVDA 1PBFA 3JZUA 1MRAA 1IUUA 3JW7A 1RVKA 3ES7A 4YT0A 2GR0A 3AECA 3NRNA 2P3ZA 3DESA 3IJQA 4IL2A 4G6GA 1T3QC 3VA8A 1S3BA 3WE0A 2O9ZA 2GMJA 1XS2A 4USQA 3II4A 4LA1A 5JCMA 3P9UA 1KDGA 4IP4A 1TDFA 4KEMA 4IA6A 3ZVIA 2RABA 4AT2A 1N4WA 2GR3A 3T6CA 3DK4A 1X2HA 1MXTA 4JN9A 4BJZA 3T9PA 5EBKA 4EMIA 1NG4A 2OLOA 3N6HA 2XLRA 1K4QA 3QVRA 4EQRA 1VQWA 2PPGA 3NYCA 4A7AA 2P88A 4TM1A 2PODA 2BK4A 3SGLA 4RG3A 4GYPA 3AE4A 3NLCA 3T4WA 2YR6A 4H83A 5FJTA 4A79A 1CJCA 2RGHA 3TJIA 2XH0A 1GRTA 2GGGA 1TE6A 1H82A 3OC4A 3K7QX 4K8GA 2B9YA 4GFIA 1YQ3A 2GAHB 3IF9A 3FG2P 3UOZA 4Z43A 3M12A 4YSHA 3HPFA 4G7FA 3CGBA 4E6MA 2C66A 3UKQA 1GOSA 4KX6A 4N9XA 3AE6A 4B63A 4A6NA 1OEPA 3UCDA 1KFYA 2BC1A 3GYXA 2TMDA 4JN7A 3QJ4A 4J31A 2P8CA 1D7LA 1L9EA 3GWDA 5EOWA 2FBWA 4OVIA 3ABVA 4GF7A 1REOA 5EU9A 4U2LA 4BJYA 3P4SA 3T0KA 2PP3A 1ZKQA 4DWDA 3VR9A 3A7RA 4WX1A 3AD8B 3LZXA 1RYIA 3RRAA 4ZCWA 4HPNA 4AOXA 5TR3A 2JB3A 1PBBA 1DOEA 3UKKA 3DGBA 3GSIA 1ONFA 3ZLFA 2YG7A 4GGHA 3DK8A 5KOWA 4K5RA 3ATQA 3U4FA 3ZVHA 3SZCA 4H19A 4JQ9A 5ENLA 3PWIA 1N5WC 2OPJA 3TW9A 2H89A 1LVLA 1TZZA 2CHRA 1GRBA 4TM0A 5U25A 3UJEA 4YXDA 5C2TA 5BUKA 4J56A 3SJNA 3NTDA 2C3DA 3UKPA 1BGJA 2WU2A 3PWGA 3QN3A 2R0GA 2XLUA 5G5GB 3HYWA 1CC4A 3OTRA 1TDEA 4XWZA 1RP0A 1YQ4A 3QSSA 1DNCA 4AP1A 2C70A 3AN1A 3QVPA 2DW6A 4E4UA 5KVIA 2Y6RA 3NK1X 2PSNA 3JSKA 4Y4NA 4H4ZA 3NGCX 2ZC8A 5ER0A 2NVKX 1JCTA 3ALMA 2I5QA 5FMHA 1MDLA 1NEKA 2VVLG 2PHHA 1FL2A 1GETA 2OZTA 3T37A 4C3XA 3PVCA 4OCGA 4YSZA 1ZY8A 2PTWA 2GVCA 1R0MA 3FJ4A 4DNAA 5FJPA 3BNMA 2C65A 4H50A 1Y56A 2XVEA 1FO4A 3C4AA 2GDQA 3H8AA 2YLTA 4HNLA 2AKZA 1MUCA 3IJLA 2XH7A 3T2KA 1FOHA 4USRA 3VRDB 3EF6A 4ICYA 3UOVA 1Z6LA 4GIRA 1EBHA 4UDPA 3UXKA 2V6OA 4NEWA 3COXA 3AE8A 1JDFA 3K7TA 1E1NA 4K5SA 1XHCA 2R9ZA 1TYPA 1JROA 4PAAA 1EL8A 1GRAA 4H2PA 5JCIA 3BI5A 2XFQA 4XXGA 3EAOA 3H4KA 3FYYA 1DOBA 3LADA 3EUB3 1H81A 1EL7A 2XSXA 5KXJA 3SZWA 4I58A 3NTAA 3F8PA 3IHMA 2FYMA 3K30A 1L9CA 3P0WA 2XH4A 4GDPA 2C76A 3REDA 3H7VA 4M0XA 2A87A 3QSMA 1H7WA 3GMCA 3ISHA 1TDNA 1E7PA 1F8WA 4DXKA 3QTPA 3NHOX 4HN8A 2OLAA 3R0UA 2BC0A 3H70A 3NVYB 2GAGB 4U2TA 1KKRA 4Y4MA 5JCLA 1ZDLA 4OPUA 2X3NA 1D5TA 1JRYA 3PO7A 1GEUA 2XDOA 3UTFA 3CAWA 1QLBA 4OPCA 3Q45A 3UTHA 2BXSA 1KSSA 6ENLA 2O56A 3UGVA 3CN8A 3NT6A 2BS4A 4X2PA 4DGKA 3MQTA 1KN0A 1Q1WA 4JDRA 2E5VA 3GY1A 3STPA 4NTEA 1FHUA 4NZHA 3FV9A 3HYVA 5JCKA 3ADAB 1NAAA 4YSXA 2DKHA 3NZGA 3BI4A 4B64A 1EC9A 3EEZA 3BI2A 4E0VA 4Y4LA 1SB3B 1PBCA 4ROPA 2X99A 2Z5YA 4K8DA 2JB2A 3OZ2A 2H88A 3FXGA 4UDRA 4HNCA 1PS9A 2I0ZA 1JRXA 2X8HA 3SN4A 3GD4A 3P3BA 5C3JA 3QKEA 2WOWA 2Q6UA 1FHVA 2WOIA 4CY6A 5LV9A 4MGGA 4OPGA 2WPFA 1PDZA 4EM3A 2C72A 3PK7A 3RP8A 1OJCA 4Z25A 4GAPA 2Q0KA 2GGIA 4M52A 4K7ZA 1ZXIC 4K1WA 4EQSA 3AEFA 2B9XA 3PFRA 1GRHA 2BA9A 2WOVA 3AE9A 3UKHA 4HB9A 5JRBA 4AT0A 3SFEA 4A6GA 3AE7A 2ZZCA 3HW2A 3GDPA 1H2IA 2GQWA 4EMWA 4Z2TA 4JNAA 2YLSA 2VQ7A 5BULA 2OA1A 2QJNA 3R11A 3IK4A 3UP5A 4TM4A 4ZCDA 4GAVA 5KRQA 3GC2A 2VVMA 3GD3A 4M6UA 4IT1A 4K2XA 3DFYA 1BKHA 4K2SA 4EIPA 3NS1B 2ZZ0A 3KPFA 4YSYA 3NK0X 2R4EA 2YR4A 4A65A 4YTNA 3QSEA 2GH5A 3CNSA 3UJSA 2VOUA 3AYLA 4H7UA 2YLXA 2CVJA 1VG0A 4FP1A 1GT8A 1GTHA 3CYJA 3RNMA 1GTEA 5IQ4A 3SYIA 4RG4A 1KD0A 4HCHA 3GD6A 4GR1A 3CPJG 3BNUA 2WETA 5EB5A 2GF3A 2QQ6A 2VRLA 1PBDA 2W54A 4DSGA 2BACA 4APNA 1NDAA 2ONEA 3DDMA 2GSHA 1IUVA 3EPTA 3ZYXA 4B68A 1PHHA 5GRTA 4LU6A 3NIXA 5KMRA 4C77A 3OZMA 1V97A 1JPMA 4G6HA 1Q1RA 2ACZA 5GSNA 3NO1A 1ONEA 3NVVB 5U1OA 1SEZA 4BURA 4NTCA 3FBSA 4GGBA 3MWCA 2JAEA 2YVGA 2GGEA 1M64A 1OJAA 1B37A 4MMWA 4U8MA 3QLDA 3NYEA 4AP3A 4Z17A 3AEBA 4GMEA 1MDRA 2PP0A 4U8JA 3A7UA 1FIQB 3V3NA 4OPTA 2HXTA 4FX9A 2EQ9A 4ZN0A 1NPXA 1KF6A 3LJPA 5HHFA 3G5RA 1CHUA 1KCZA 1IYXA 3H8IA 3P4RA 1N60C 2A89A 2WESA 2EQ7A 5G5HB 1EL9A 4K22A 3DJDA 3KVEA 4II2A 2QDEA 2PGEA 3TJ4A 1CBOA 1SJAA 2FJBA 3B9JB 1WUEA 3CT2A 2RGJA 4J1OA 4H4PA 3VCNA 1PBEA 3GO2A 4A6NB 3UOXA 4G9KA 4YTMA 2F5ZA 1LQUA 1WYGA 2QAEA 2V3BA 3UTGA 3GRTA 3KLJA 2APGA 2WP5A 4Z26A 1VDVA 2PGWA 4H1ZA 4H2QA 1S2QA 2Y6QA 3D8XA 3UCLA 3AE3A 1F9CA 1SJBA 3H8LA 3I3LA 3UTEA 4U2SA 4H2HA 3F8DA 4HA6A 4UP3A 3CXOA 1F8RA 3KD9A 4U8NA 1GNDA 4J2WA 1FEBA 5KNLA 3Q6JA 1N4UA 2C73A 3K1GA 2YM1A 1N62C 4C5OA 3ITJA 3NK2X 2WP9A 1NHQA 2AQJA 1E1LA 3AXBA 2BYBA 2V3AA 1CF3A 1E1MA 4EQXA 1P48A 2XFOA 4B69A 3D9XA 3SQPA 2GMHA 2CULA 3AEAA 4H4XA 1ELSA 4J3ZA 3TTEA 3T31A 3AM9A 5KOXA 1MNSA 3GYJA 3N4EA 1GERA 1XPQA 3KPKA 2XVIA 2ZADA 4E5TA 3L8KA 2GEWA 5IPYA 2JKCA 3G5SA 5HY5A 3S5WA 5J60A 3NKSA 3DJJA 2WEUA 3IJIA 4CRTA 3ETRB 3ZLGA 4AOSA 5KVHA 1FCDA 1JOAA 4BV6A 1K0IA 3MZNA 4IP5A 5J04A 3NRZB 4E4FA 3SY4A 2P0IA 3V3OA 1VRQB 1VDCA 1L8PA 4TLZA 3KA7A 3UKAA 1O95A 1ZMCA 2XFUA 1CJ3A 3LZWA 2WP6A 2XH2A 1YEYA 4KWSA 4EM4A 1EC7A 4B65A 3SFDA 1ZK7A 4KPRA 3FIMB 2BCGG 4B67A 1JNZA 4Z2UA 1OJTA 1K0LA 3AWIA 4UDQA 3UP4A 1TYTA 4NWZA 3KU9A 3CGEA 4H4WA 1BZLA 1PJ5A 1YY5A 3DERA 2E1MA 4MKSA 2XLTA 3IWAA 4II3A 2X8GA 1N5XA 4D03A 3H12A 5KWFA 2R4JA 1SJCA 1VG9A 3PS9A 4H4UA 4J57A 2C3CA 3CGCA 4IL0A 3S5SA 1E9IA 1CL0A 2XLSA 5KMSA 2B9WA 2MNRA 3M13A 3SZ0A 3VFCA 4CCQA 5BRTA 4Z1YA 2QVHA 2PU1A 4CCRA 2B7SA 1IUWA 3UJ2A 1ECQA 3R25A 3EANA 2HNEA 3V76A 2CDUA 2OX4A 3IHGA 1EBDA 3RGTA 1KNRA 2ARDA 2DKIA 2XCGA 4TLXA 1YKJA 1LV0A 3B6DA 2MUCA 1LQTA 4U8IA 1PN0A 3T2YA 4DN1A 3ICTA 4YWOA 4TM3A 3LXDA 4KT2A 2YG3A 1QJDA 3C96A 1S7MA 5FS6A 2WU5A 2EQ8A 4BK3A 2FJAA 3TOYA 5JCNA 2XFNA 3NVZB 2JB1A 4NEVA 2WDRA 3QPEA 2BK5A 1LJ1A 2WS3A 5HYMA 2OQYA 3DFHA 4U8OA 1M6IA 1UKVG 3OP2A 3CXBA 4DYEA 3VC5A 2PCEA 3AEGA 3Q9TA 4I59A 1F6MA 4H2NA 1N63C 3B97A 2QA2A 5DBJA 4GUVA 3AB1A 3RHAA 4OPDA 2DW7A 1E1KA 4PABA 4CNKA 1R6WA 5FJUA 3DJEA 4XWRA 3AE1A 1XANA 2P8BA 1H7XA 2Q0LA 4H4YA 1Q9IA 2GGJA 2AAQA 2OQHA 2QJMA 1P2HA 1RSGA 2JBVA 1D4EA 4ZA0A 2YM2A 1MOKA 1PXBA 3B3RA 4EWJA 4IVOB 3ICSA 1JU2A 3AD7B 1H84A 1CC2A 4OPLA 4EIQA 3SSZA 1JNRA 3AD9B 3SN0A 1IUXA 4A9WA 2E4GA 3TWBA 2PP1A 3SZFA 2X8CA 4CY8A 3BOXA 4DSHA 2C4CA 4A35A 3LOVA 2YQUA 2AL2A 1AOGA 2WBAA 3A7AA 4HCLA 1B4VA 2HXUA 3SXIA 2CFYA 4D04A 1H83A 1ELIA 2OALA 3DJGX 4C74A 1KSUA 1YQZA 4YTPA 1NU5A 3G5QA 1O94A 4GYPC 2V5ZA 4FI4A 1E39A 2C67A 2QCUA 4FK1A 4Z44A 1JRPA 2Z5XA 2YWLA 2X50A 3V5CA 1LTXR 1NHRA 3BHFA 1PDHA 4C3YA 1IUSA 3UKLA 1FFVC 4GRTA 3CMMA 3T8QA 4O5QA 3NNEA 1NG3A 3DA1A 1IUTA 2VQBA 2OZ8A 3HZLA 1COYA 2WDQA 5KMPA 3RP6A 3GRSA 1CJ4A 1D4DA 1Y0PA 4U8PA 3UJFA 5IDZA 3NXLA 1FECA 4NTDA 3VR8A 3P4QA 3VDGA 2PS2A 2GB0A 3GDNA 1WUFA 1HYUA 5L46A 4X9NA 3AMZA 1OJ9A 3CPHG 2BXRA 1GESA 1DOCA 1H86A 2PYXA 3OZYA 2J3NA 4Z2RA 4ENLA 4IV9A 1P43A 3TQPA 2BS3A 3ALLA 1MO9A 3NH3X 3N6JA 3GMBA 4J36A 1BQGA 4G74A 3AYJA 1L9DA 3SN1A 1D7YA 3ZDNA 3CTYA 1GREA 2QA1A 3HRDC 1X2GA 2GGHA 2YLRA 1EL5A 3AYIA 3DGZA 2PA6A 2R0CA 1K0JA 2PTXA 4CBQA 2UZZA 1BKWA 7ENLA 1DJQA 3MSYA 2W55A 1XPYA 1B5QA 1F8SA 3UJRA 3CNPA 3VRAA 2IVEA 1D4CA 4H4VA 3R0KA 2IVDA 4CNJA 1NENA 4B1BA 2E3TA 3DH9A 1GRFA 2OG9A 2AKMA 2FJDA 3ATRA 2PMQA 4TVYA 1GV4A 5IQ1A 2OO6A 3D1CA 1TRBA 2RGOA 3DIPA 2C75A
chains in the Genus database with same CATH topology
2IIDA 4G6GA 3CGEA 4ADWA 1QO8A 4H4WA 1BZLA 1S3BA 2JB2A 3WE0A 1PJ5A 1YY5A 4H2RA 3OZ2A 4O5UA 1CC6A 2E1MA 2H88A 2XLTA 3IWAA 2O9ZA 2GMJA 4II3A 2X8GA 4UDRA 4D03A 1PS9A 2I0ZA 3CGDA 1JRXA 2X8HA 3GD4A 4USQA 5KWFA 3II4A 2R4JA 4LA1A 3AEDA 1ZP0A 1GRGA 5U63A 5JCMA 5C3JA 1VG9A 4YKGA 2WOWA 2Q6UA 3PS9A 4OPIA 2WOIA 3P9UA 4U8KA 4A99A 2VVLA 3CIRA 4H4UA 4J57A 4CY6A 1KDGA 5LV9A 4OPGA 1TDFA 2C3CA 4IA6A 3CGCA 2RABA 2WPFA 1CL0A 4AT2A 2XLSA 1N4WA 2GR3A 5KMSA 2B9WA 4EM3A 3DK4A 2C72A 3DMEA 4NWZA 3L5OA 3M13A 3SZ0A 1MXTA 4JN9A 4BJZA 1NG4A 5EBKA 4EMIA 4CCQA 5BRTA 3RP8A 2OLOA 3ALJA 1CJ2A 1OJCA 2XLRA 4Z25A 4GAPA 4NNJA 1K4QA 4CCRA 3QVRA 4EQRA 1VQWA 3NYCA 2Q0KA 4A7AA 2B7SA 3S61A 1IUWA 4M52A 4K7ZA 1IJHA 3CNTA 4EQSA 4TM1A 3AEFA 2XLPA 2B9XA 2BK4A 3SGLA 1JEHA 2YG6A 4RG3A 3AE4A 1GRHA 2BA9A 2WOVA 3DK9A 3AE9A 3NLCA 5BVAA 3UKHA 4HB9A 5JRBA 3EANA 4AT0A 1N4VA 3V76A 2CDUA 4Z24A 3IHGA 1EBDA 3SFEA 2YR6A 4A79A 3AE7A 1KNRA 2ZZCA 2V60A 3GDPA 2ARDA 4MJWA 1H2IA 1CJCA 2BS2A 2DKIA 2RGHA 3L1RA 1GRTA 2GQWA 4EMWA 4Z2TA 3QFBA 2XCGA 1H82A 4TLXA 3OC4A 3K7QX 4JNAA 1B8SA 1V59A 2YLSA 1ZOYA 2VQ7A 5BULA 2B9YA 1YQ3A 2GAHB 3IF9A 3FG2P 3P4PA 2C7GA 3UOZA 4Z43A 3DGHA 1YKJA 2OA1A 1LV0A 1GXFA 2YAUA 2BK3A 3B6DA 3P1WA 3M12A 3UP5A 4YSHA 1OJDA 2XVJA 1LQTA 4TM4A 4U8IA 1PN0A 2W0HA 3T2YA 3CGBA 4ZCDA 4GAVA 3ICTA 4YWOA 4TM3A 3LXDA 5KRQA 1FEAA 2C66A 2YG3A 3RP7A 4EMJA 3UKQA 1GOSA 1QJDA 3AE2A 4KX6A 2VVMA 3GD3A 3F8RA 3C96A 4N9XA 1S7MA 4K2XA 3AE6A 5FS6A 2WU5A 2EQ6A 4B63A 2R45A 4A6NA 4EIPA 1KFYA 2EQ8A 2ZZ0A 1Y56B 3KPFA 4J33A 2BC1A 4BK3A 2FJAA 2XFNA 5JCNA 2R4EA 2YR4A 3NK0X 4A65A 4YSYA 4YTNA 3GYXA 3QSEA 2GH5A 2TMDA 3CNSA 3QJ4A 4J31A 1D7LA 2VOUA 3AYLA 2R0PA 2WQYA 4H7UA 3CNDA 2JB1A 3NN6X 1L9EA 4NEVA 2WDRA 3GWDA 2YLXA 2BK5A 1LJ1A 2FBWA 2WS3A 5EOWA 2CVJA 1VG0A 5HYMA 4WCTA 2YG4A 4OVIA 2OAMA 1GT8A 4RSLA 1GTHA 3ABVA 2WHDA 3RNMA 1GTEA 4GF7A 4U8OA 5IQ4A 1M6IA 3SYIA 4RG4A 1REOA 4U2LA 4BJYA 1UKVG 3P4SA 2TPRA 3T0KA 5CKUA 4GR1A 3AEGA 3CPJG 3Q9TA 3BNUA 4I59A 2WETA 1ZKQA 1F6MA 2GF3A 5EB5A 1X31B 3VR9A 1E6EA 4WX1A 2VRLA 1PBDA 3AD8B 3LZXA 4H2NA 2GR1A 4FDCB 1RYIA 4X9MA 2QA2A 5DBJA 4DSGA 2BACA 4GUVA 4AOXA 1DXLA 5TR3A 1PBBA 2JB3A 3AB1A 3RHAA 1DOEA 4APNA 1NDAA 1BF3A 1IUVA 3EPTA 3UKKA 3VRBA 3ZYXA 3CPIG 4OPDA 3GSIA 1ZOVA 1ONFA 4B68A 1PHHA 4YKFA 2YG7A 2XVHA 5GRTA 1E1KA 3DK8A 3NIXA 4LU6A 5KOWA 3K7MX 4PABA 4CNKA 4K5RA 4P9SA 2OLNA 5KMRA 3ATQA 3IC9A 3DJEA 4XWRA 3AE1A 1PJ7A 4C77A 3SZCA 1XANA 4JQ9A 4G6HA 1Q1RA 2ACZA 2BRAA 1H7XA 5GSNA 2XYOA 2Q0LA 2H89A 4H4YA 1LVLA 5U1OA 3VQRA 1SEZA 4BURA 1Q9IA 4NTCA 2ZZBA 1GRBA 4TM0A 3FBSA 5U25A 4YXDA 5C2TA 5BUKA 4J56A 3NTDA 2C3DA 3UKPA 1BGJA 2AAQA 1F3PA 1P2HA 2JAEA 5J7XA 2A8XA 2WU2A 2YVGA 1RSGA 2V61A 5CQFA 1OJAA 1M64A 1D4EA 2JBVA 4U8LA 2R0GA 2YM2A 2XLUA 1B37A 1MOKA 1PXBA 4U8MA 4IA5A 3FPZA 3NYEA 3B3RA 4AP3A 3HYWA 3ICRA 1CC4A 4IVOB 3ICSA 1TDEA 4XWZA 3AEBA 1JU2A 1RP0A 1YQ4A 3AD7B 3BHKA 3QSSA 4JY3A 1DNCA 3E1TA 3I6DA 4U8JA 4ZCCA 4AP1A 1H84A 2C70A 3QFAA 1CC2A 1BWCA 3QVPA 2Q7VA 4OPLA 4EQWA 3V3NA 5KVIA 3FMWA 4OPTA 4FX9A 4EIQA 2Y6RA 2EQ9A 4ZN0A 4H4SA 3NK1X 1JNRA 1NPXA 1KF6A 3AD9B 5FS7A 1IUXA 3JSKA 3LJPA 4Y4NA 4H4ZA 1ZMDA 4A9WA 3GWFA 2E4GA 3NGCX 5HHFA 5ER0A 2NVKX 2YR5A 3ALMA 2B7RA 3SZFA 3G5RA 5FMHA 1CHUA 1NEKA 2X8CA 2VVLG 3H8IA 3P4RA 4GCMA 4H4QA 2A89A 2PHHA 4CY8A 4DSHA 2C4CA 1FL2A 1GETA 2WESA 2EQ7A 2YVFA 3SM8A 3T37A 4C3XA 1EL9A 3PVCA 1PXAA 4K22A 3LOVA 1ZY8A 2GVCA 3DJDA 3KVEA 4OCGA 2YQUA 2R46A 4YSZA 1AOGA 4DNAA 2NPXA 2WBAA 5FS8A 1B4VA 4II2A 3SXIA 3BNMA 5EB4A 2CFYA 1CBOA 2C65A 4H50A 1Y56A 4D04A 3C4NA 4B66A 1H83A 1ELIA 2OALA 1NHSA 4H4TA 3CNJA 2FJBA 2XVEA 3DJGX 3C4AA 3URHA 4C74A 2YLTA 4BK1A 1KSUA 2WPEA 2RGJA 3NYFA 1YQZA 4YTPA 4H4PA 1N1PA 2XVFA 3G5QA 1PBEA 4A6NB 1O94A 3UOXA 2YLZA 4G9KA 4YTMA 2F5ZA 2V5ZA 1LQUA 3NN0X 3T2KA 1FOHA 1E39A 2C67A 2QCUA 4FK1A 4Z44A 4USRA 2Z5XA 4J34A 2QAEA 3EF6A 4ICYA 3VRDB 3AEEA 3UOVA 2YWLA 2X50A 1PXCA 2XFPA 1Z6LA 1LTXR 1NHRA 3BHFA 2V3BA 1GSNA 1PDHA 2GV8A 3UTGA 2JK6A 3GRTA 3KLJA 4C3YA 2APGA 1IUSA 2WP5A 4Z26A 3UKLA 4UDPA 4JNQA 3R9UA 4GRTA 2V6OA 2GQFA 4NEWA 3CMMA 3COXA 4H2QA 3AE8A 3SX6A 1DJNA 1S2QA 3K7TA 2Y6QA 3NNEA 4O5QA 3O0HA 1NG3A 3D8XA 1E1NA 4K5SA 3DA1A 1XHCA 2R9ZA 1IUTA 1TYPA 1DODA 2VRMA 3AE3A 3UCLA 4PAAA 4H4RA 1EL8A 2VZ2A 2VQBA 1H6VA 3I3LA 1GRAA 3H8LA 4H2PA 3UTEA 3HZLA 4U2SA 1COYA 5JCIA 2YG5A 2WDQA 3BI5A 3F8DA 4G73A 5M0ZA 5KMPA 2XFQA 4HA6A 3KU9A 4XXGA 4UP3A 3RP6A 3GRSA 3EAOA 1CJ4A 1D4DA 1Y0PA 3H4KA 1F8RA 4U8PA 1O5WA 3KD9A 1ZX9A 3LB8A 1S3EA 4U8NA 1GNDA 1DOBA 4J2WA 3LADA 1FEBA 5KNLA 1TDKA 3Q6JA 1H81A 1FECA 1EL7A 1N4UA 1JRZA 4NTDA 5KXJA 3VR8A 4GDEA 3P4QA 2C73A 3SZWA 4I58A 3NTAA 3F8PA 2GB0A 1L0VA 3GDNA 2YM1A 3T2ZA 1HYUA 1PJ6A 5L46A 3IHMA 4C5OA 4X9NA 3ITJA 4BK2A 3K30A 1OJ9A 3NK2X 1L9CA 2WP9A 1NHQA 2AQJA 1E1LA 3UOYA 1GPEA 3AXBA 3CPHG 2BXRA 2V3AA 2BYBA 4X4JA 4GDPA 1CF3A 1GESA 2WPCA 1E1MA 1DOCA 1H86A 2C76A 3REDA 3PG6A 2PYXA 3QSMA 2A87A 1H7WA 4EQXA 3GMCA 4FK1C 2XFOA 3ISHA 2YLWA 1TDNA 2J3NA 4B69A 4Z2RA 3D9XA 3SQPA 1E7PA 2GMHA 1F8WA 1P2EA 2CULA 3AEAA 4IV9A 3HYXA 3NHOX 4JY2A 1BGNA 2BS3A 4H4XA 2AR8A 3ALLA 1MO9A 3NH3X 2BC0A 3T31A 5KOXA 2GAGB 1XDIA 3GYJA 4U2TA 2C64A 3GMBA 4J36A 1GERA 1S2YA 1XPQA 2BABA 3KPKA 3AYJA 2XVIA 5JCLA 4G74A 4Y4MA 1L9DA 5KMQA 3T14A 1ZDLA 4OPUA 3L8KA 2GEWA 5IPYA 3GYIA 2X3NA 1D7YA 3ZDNA 1D5TA 2JKCA 1GREA 2QA1A 3CTYA 1LPFA 1JRYA 3G5SA 5HY5A 3S5WA 3M0OA 3PO7A 5J60A 3NG7X 1GEUA 3NKSA 5HXIA 2XDOA 3UTFA 3DJJA 2WEUA 4A5LA 2YLRA 2ZBWA 1QLBA 4OPCA 2WDVA 3UTHA 2BRYA 1EL5A 3AYIA 3KKJA 3UKFA 4CRTA 3DGZA 2BXSA 4AOSA 1KSSA 5KVHA 2HQMA 1FCDA 2R0CA 1K0JA 1JOAA 4BV6A 3AE5A 1K0IA 3CN8A 1GALA 3NT6A 4CBQA 2BS4A 2UZZA 1BKWA 4LIIA 4DGKA 4IVMB 1DJQA 1TDOA 5FS9A 1KN0A 1B5QA 1Q1WA 4JDRA 1F8SA 4REKA 2E5VA 3SY4A 3V3OA 4NTEA 2BCPA 1VRQB 1VDCA 3CNPA 2GRTA 2B76A 4TLZA 4ECHA 1NHPA 3KA7A 1W4XA 2FJEA 3VRAA 3UKAA 4NZHA 1O95A 2IVEA 1ZMCA 2XFUA 2GR2A 1CJ3A 1KNPA 3LZWA 1D4CA 5M10A 4H4VA 2WP6A 2IVDA 2YVJA 4CNJA 4EM4A 3HYVA 1NENA 1PBFA 4B1BA 5JCKA 4B65A 3SFDA 1IUUA 3ADAB 1NAAA 3DH9A 1ZK7A 4YSXA 1GRFA 4KPRA 3FIMB 2BCGG 2FJDA 3ATRA 4B67A 1JNZA 2DKHA 4Z2UA 1OJTA 3BI4A 4B64A 1K0LA 3AWIA 4UDQA 1GV4A 5IQ1A 4YT0A 3BI2A 3D1CA 2GR0A 3AECA 1TRBA 3NRNA 2RGOA 2C75A 3UP4A 1TYTA 4Y4LA 4E0VA 1PBCA 2X99A 2Z5YA 4K8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IID A;  3CGE A;  4ADW A;  1QO8 A;  4H4W A;  1BZL A;  1S3B A;  2JB2 A;  3WE0 A;  1PJ5 A;  1YY5 A;  4H2R A;  3OZ2 A;  4O5U A;  1CC6 A;  2E1M A;  2H88 A;  2XLT A;  3IWA A;  2O9Z A;  2GMJ A;  2X8G A;  4UDR A;  4D03 A;  1PS9 A;  2I0Z A;  3CGD A;  1JRX A;  2X8H A;  3GD4 A;  4USQ A;  5KWF A;  3II4 A;  2R4J A;  4LA1 A;  3AED A;  1ZP0 A;  1GRG A;  5U63 A;  5JCM A;  5C3J A;  1VG9 A;  4YKG A;  2WOW A;  2Q6U A;  3PS9 A;  4OPI A;  2WOI A;  3P9U A;  4U8K A;  4A99 A;  2VVL A;  3CIR A;  4H4U A;  4J57 A;  4CY6 A;  1KDG A;  5LV9 A;  4OPG A;  1TDF A;  2C3C A;  4IA6 A;  3CGC A;  2RAB A;  2WPF A;  1CL0 A;  4AT2 A;  2XLS A;  1N4W A;  2GR3 A;  2B9W A;  4EM3 A;  3DK4 A;  2C72 A;  3DME A;  3M13 A;  1MXT A;  4JN9 A;  4BJZ A;  1NG4 A;  5EBK A;  4EMI A;  4CCQ A;  5BRT A;  3RP8 A;  2OLO A;  3ALJ A;  1CJ2 A;  1OJC A;  2XLR A;  4Z25 A;  1K4Q A;  4CCR A;  3QVR A;  4EQR A;  1VQW A;  3NYC A;  2Q0K A;  4A7A A;  2B7S A;  3S61 A;  1IUW A;  4M52 A;  4K7Z A;  1IJH A;  3CNT A;  4EQS A;  4TM1 A;  3AEF A;  2XLP A;  2B9X A;  2BK4 A;  3SGL A;  1JEH A;  2YG6 A;  4RG3 A;  3AE4 A;  1GRH A;  2BA9 A;  2WOV A;  3DK9 A;  3AE9 A;  3NLC A;  5BVA A;  3UKH A;  4HB9 A;  3EAN A;  4AT0 A;  1N4V A;  3V76 A;  2CDU A;  4Z24 A;  3IHG A;  1EBD A;  3SFE A;  2YR6 A;  4A79 A;  3AE7 A;  2ZZC A;  1KNR A;  2V60 A;  3GDP A;  2ARD A;  4MJW A;  2BS2 A;  1CJC A;  2DKI A;  2RGH A;  3L1R A;  1GRT A;  2GQW A;  4EMW A;  4Z2T A;  3QFB A;  2XCG A;  1H82 A;  4TLX A;  3OC4 A;  3K7Q X;  4JNA A;  1B8S A;  1V59 A;  2YLS A;  1ZOY A;  2VQ7 A;  5BUL A;  2B9Y A;  1YQ3 A;  2GAH B;  3IF9 A;  3FG2 P;  3P4P A;  2C7G A;  3UOZ A;  4Z43 A;  3DGH A;  1YKJ A;  2OA1 A;  1LV0 A;  1GXF A;  2YAU A;  2BK3 A;  3B6D A;  3P1W A;  3M12 A;  3UP5 A;  4YSH A;  1OJD A;  2XVJ A;  1LQT A;  4TM4 A;  4U8I A;  1PN0 A;  2W0H A;  3CGB A;  4ZCD A;  3ICT A;  4YWO A;  4TM3 A;  3LXD A;  5KRQ A;  1FEA A;  2C66 A;  2YG3 A;  3RP7 A;  4EMJ A;  3UKQ A;  1GOS A;  1QJD A;  3AE2 A;  4KX6 A;  2VVM A;  3GD3 A;  3F8R A;  3C96 A;  4N9X A;  4K2X A;  3AE6 A;  5FS6 A;  2WU5 A;  2EQ6 A;  4B63 A;  2R45 A;  4A6N A;  4EIP A;  1KFY A;  2EQ8 A;  2ZZ0 A;  1Y56 B;  3KPF A;  4J33 A;  2BC1 A;  4BK3 A;  2FJA A;  2XFN A;  5JCN A;  2R4E A;  2YR4 A;  3NK0 X;  4A65 A;  4YSY A;  4YTN A;  3QSE A;  2GH5 A;  2TMD A;  3CNS A;  3QJ4 A;  4J31 A;  1D7L A;  2VOU A;  3AYL A;  2R0P A;  2WQY A;  4H7U A;  3CND A;  2JB1 A;  3NN6 X;  1L9E A;  4NEV A;  2WDR A;  3GWD A;  2YLX A;  2BK5 A;  1LJ1 A;  2FBW A;  2WS3 A;  5EOW A;  2CVJ A;  1VG0 A;  5HYM A;  4WCT A;  2YG4 A;  4OVI A;  2OAM A;  1GT8 A;  4RSL A;  1GTH A;  3ABV A;  2WHD A;  3RNM A;  1GTE A;  4GF7 A;  4U8O A;  5IQ4 A;  1M6I A;  4RG4 A;  1REO A;  4U2L A;  4BJY A;  1UKV G;  3P4S A;  2TPR A;  5CKU A;  4GR1 A;  3AEG A;  3CPJ G;  3Q9T A;  3BNU A;  4I59 A;  2WET A;  1ZKQ A;  1F6M A;  2GF3 A;  5EB5 A;  1X31 B;  3VR9 A;  1E6E A;  4WX1 A;  2VRL A;  1PBD A;  3AD8 B;  3LZX A;  4H2N A;  2GR1 A;  4FDC B;  1RYI A;  4X9M A;  2QA2 A;  5DBJ A;  4DSG A;  2BAC A;  4GUV A;  4AOX A;  1DXL A;  5TR3 A;  1PBB A;  2JB3 A;  3AB1 A;  3RHA A;  1DOE A;  4APN A;  1NDA A;  1BF3 A;  1IUV A;  3EPT A;  3UKK A;  3VRB A;  3ZYX A;  3CPI G;  4OPD A;  3GSI A;  1ZOV A;  1ONF A;  4B68 A;  1PHH A;  4YKF A;  2YG7 A;  2XVH A;  5GRT A;  1E1K A;  3DK8 A;  3NIX A;  4LU6 A;  5KOW A;  3K7M X;  4PAB A;  4CNK A;  4K5R A;  4P9S A;  2OLN A;  3ATQ A;  3IC9 A;  3DJE A;  4XWR A;  3AE1 A;  1PJ7 A;  4C77 A;  1XAN A;  4JQ9 A;  1Q1R A;  2ACZ A;  1H7X A;  5GSN A;  2XYO A;  2Q0L A;  2H89 A;  4H4Y A;  1LVL A;  5U1O A;  3VQR A;  1SEZ A;  4BUR A;  1Q9I A;  4NTC A;  2ZZB A;  1GRB A;  4TM0 A;  3FBS A;  5U25 A;  4YXD A;  5C2T A;  5BUK A;  4J56 A;  3NTD A;  2C3D A;  3UKP A;  1BGJ A;  2AAQ A;  1F3P A;  1P2H A;  2JAE A;  5J7X A;  2A8X A;  2WU2 A;  2YVG A;  1RSG A;  2V61 A;  5CQF A;  1OJA A;  1M64 A;  1D4E A;  2JBV A;  4U8L A;  2R0G A;  2YM2 A;  2XLU A;  1B37 A;  1MOK A;  1PXB A;  4U8M A;  4IA5 A;  3FPZ A;  3NYE A;  3B3R A;  4AP3 A;  3ICR A;  1CC4 A;  4IVO B;  3ICS A;  1TDE A;  4XWZ A;  3AEB A;  1JU2 A;  1RP0 A;  1YQ4 A;  3AD7 B;  3BHK A;  3QSS A;  4JY3 A;  1DNC A;  3E1T A;  3I6D A;  4U8J A;  4ZCC A;  4AP1 A;  1H84 A;  2C70 A;  3QFA A;  1CC2 A;  1BWC A;  3QVP A;  2Q7V A;  4OPL A;  4EQW A;  3V3N A;  5KVI A;  3FMW A;  4OPT A;  4FX9 A;  4EIQ A;  2Y6R A;  2EQ9 A;  4ZN0 A;  4H4S A;  3NK1 X;  1JNR A;  1NPX A;  1KF6 A;  3AD9 B;  5FS7 A;  1IUX A;  3JSK A;  3LJP A;  4Y4N A;  4H4Z A;  1ZMD A;  4A9W A;  3GWF A;  2E4G A;  3NGC X;  5HHF A;  5ER0 A;  2NVK X;  2YR5 A;  3ALM A;  2B7R A;  3G5R A;  5FMH A;  1CHU A;  1NEK A;  2X8C A;  2VVL G;  3H8I A;  3P4R A;  4GCM A;  4H4Q A;  2A89 A;  2PHH A;  4CY8 A;  4DSH A;  1FL2 A;  1GET A;  2WES A;  2EQ7 A;  2YVF A;  3SM8 A;  3T37 A;  4C3X A;  1EL9 A;  3PVC A;  1PXA A;  4K22 A;  3LOV A;  1ZY8 A;  2GVC A;  3DJD A;  3KVE A;  4OCG A;  2YQU A;  2R46 A;  4YSZ A;  1AOG A;  4DNA A;  2NPX A;  2WBA A;  5FS8 A;  1B4V A;  3BNM A;  5EB4 A;  2CFY A;  1CBO A;  2C65 A;  4H50 A;  1Y56 A;  4D04 A;  3C4N A;  4B66 A;  1H83 A;  1ELI A;  2OAL A;  1NHS A;  4H4T A;  3CNJ A;  2FJB A;  2XVE A;  3DJG X;  3C4A A;  3URH A;  4C74 A;  2YLT A;  4BK1 A;  1KSU A;  2WPE A;  2RGJ A;  3NYF A;  1YQZ A;  4YTP A;  4H4P A;  1N1P A;  2XVF A;  3G5Q A;  1PBE A;  4A6N B;  1O94 A;  3UOX A;  2YLZ A;  4YTM A;  2F5Z A;  2V5Z A;  1LQU A;  3NN0 X;  1FOH A;  1E39 A;  2C67 A;  2QCU A;  4FK1 A;  4Z44 A;  4USR A;  2Z5X A;  4J34 A;  2QAE A;  3EF6 A;  4ICY A;  3VRD B;  3AEE A;  3UOV A;  2YWL A;  2X50 A;  1PXC A;  2XFP A;  1Z6L A;  1LTX R;  1NHR A;  3BHF A;  2V3B A;  1GSN A;  1PDH A;  2GV8 A;  3UTG A;  2JK6 A;  3GRT A;  3KLJ A;  4C3Y A;  2APG A;  1IUS A;  2WP5 A;  4Z26 A;  3UKL A;  4UDP A;  4JNQ A;  3R9U A;  4GRT A;  2V6O A;  2GQF A;  4NEW A;  4H2Q A;  3COX A;  3AE8 A;  1DJN A;  1S2Q A;  3K7T A;  2Y6Q A;  3NNE A;  4O5Q A;  3O0H A;  1NG3 A;  3D8X A;  1E1N A;  4K5S A;  3DA1 A;  1XHC A;  2R9Z A;  1IUT A;  1TYP A;  1DOD A;  2VRM A;  3AE3 A;  3UCL A;  4PAA A;  4H4R A;  1EL8 A;  2VZ2 A;  2VQB A;  1H6V A;  3I3L A;  1GRA A;  3H8L A;  4H2P A;  3UTE A;  3HZL A;  4U2S A;  1COY A;  5JCI A;  2YG5 A;  2WDQ A;  3BI5 A;  3F8D A;  5M0Z A;  2XFQ A;  4HA6 A;  3KU9 A;  4XXG A;  4UP3 A;  3RP6 A;  3GRS A;  3EAO A;  1CJ4 A;  1D4D A;  1Y0P A;  3H4K A;  1F8R A;  4U8P A;  1O5W A;  3KD9 A;  1ZX9 A;  3LB8 A;  1S3E A;  4U8N A;  1GND A;  1DOB A;  4J2W A;  3LAD A;  1FEB A;  1TDK A;  3Q6J A;  1H81 A;  1FEC A;  1EL7 A;  1N4U A;  1JRZ A;  4NTD A;  5KXJ A;  3VR8 A;  4GDE A;  3P4Q A;  2C73 A;  4I58 A;  3NTA A;  3F8P A;  2GB0 A;  1L0V A;  3GDN A;  2YM1 A;  1HYU A;  1PJ6 A;  5L46 A;  3IHM A;  4C5O A;  4X9N A;  3ITJ A;  4BK2 A;  3K30 A;  1OJ9 A;  3NK2 X;  1L9C A;  2WP9 A;  1NHQ A;  2AQJ A;  1E1L A;  3UOY A;  1GPE A;  3AXB A;  3CPH G;  2BXR A;  2BYB A;  2V3A A;  4X4J A;  4GDP A;  1CF3 A;  1GES A;  2WPC A;  1E1M A;  1DOC A;  1H86 A;  2C76 A;  3RED A;  2PYX A;  3QSM A;  2A87 A;  1H7W A;  4EQX A;  3GMC A;  4FK1 C;  2XFO A;  3ISH A;  2YLW A;  1TDN A;  2J3N A;  4B69 A;  4Z2R A;  3SQP A;  1E7P A;  2GMH A;  1F8W A;  1P2E A;  2CUL A;  3AEA A;  4IV9 A;  3NHO X;  4JY2 A;  1BGN A;  2BS3 A;  4H4X A;  2AR8 A;  3ALL A;  1MO9 A;  3NH3 X;  2BC0 A;  5KOX A;  2GAG B;  1XDI A;  3GYJ A;  4U2T A;  2C64 A;  3GMB A;  4J36 A;  1GER A;  1S2Y A;  1XPQ A;  2BAB A;  4Y4M A;  3AYJ A;  2XVI A;  5JCL A;  1L9D A;  1ZDL A;  4OPU A;  3L8K A;  2GEW A;  5IPY A;  3GYI A;  2X3N A;  1D7Y A;  3ZDN A;  1D5T A;  2JKC A;  1GRE A;  2QA1 A;  3CTY A;  1LPF A;  1JRY A;  3G5S A;  5HY5 A;  3S5W A;  3M0O A;  3PO7 A;  5J60 A;  3NG7 X;  1GEU A;  3NKS A;  5HXI A;  2XDO A;  3UTF A;  3DJJ A;  2WEU A;  4A5L A;  2YLR A;  2ZBW A;  1QLB A;  4OPC A;  2WDV A;  3UTH A;  1EL5 A;  3AYI A;  3KKJ A;  3UKF A;  4CRT A;  3DGZ A;  2BXS A;  4AOS A;  1KSS A;  5KVH A;  2HQM A;  1FCD A;  2R0C A;  1K0J A;  1JOA A;  4BV6 A;  3AE5 A;  1K0I A;  3CN8 A;  1GAL A;  3NT6 A;  4CBQ A;  2BS4 A;  2UZZ A;  1BKW A;  4LII A;  4DGK A;  4IVM B;  1DJQ A;  1TDO A;  5FS9 A;  1B5Q A;  1F8S A;  1Q1W A;  4JDR A;  4REK A;  2E5V A;  3V3O A;  4NTE A;  2BCP A;  1VRQ B;  1VDC A;  3CNP A;  2GRT A;  2B76 A;  4TLZ A;  4ECH A;  1NHP A;  3KA7 A;  1W4X A;  2FJE A;  3VRA A;  3UKA A;  4NZH A;  1O95 A;  2IVE A;  1ZMC A;  2XFU A;  2GR2 A;  1CJ3 A;  1KNP A;  3LZW A;  1D4C A;  5M10 A;  4H4V A;  2WP6 A;  2IVD A;  2YVJ A;  4CNJ A;  4EM4 A;  1NEN A;  1PBF A;  4B1B A;  5JCK A;  4B65 A;  3SFD A;  1IUU A;  3ADA B;  1NAA A;  3DH9 A;  1ZK7 A;  4YSX A;  1GRF A;  4KPR A;  3FIM B;  2BCG G;  2FJD A;  3ATR A;  4B67 A;  1JNZ A;  2DKH A;  4Z2U A;  1OJT A;  3BI4 A;  4B64 A;  1K0L A;  3AWI A;  4UDQ A;  1GV4 A;  5IQ1 A;  4YT0 A;  3BI2 A;  3D1C A;  2GR0 A;  3AEC A;  1TRB A;  3NRN A;  2RGO A;  2C75 A;  3UP4 A;  1TYT A;  4Y4L A;  4E0V A;  1PBC A;  2X99 A;  2Z5Y A;  4K8D A; 
#chains in the Genus database with same CATH topology
 2IID A;  4ADW A;  1QO8 A;  4H2R A;  2W3R A;  3TCS A;  4O5U A;  1CC6 A;  3D47 A;  3CGD A;  3SR6 B;  3FCP A;  3AED A;  1ZP0 A;  1GRG A;  5U63 A;  4YKG A;  4OPI A;  1SJD A;  4U8K A;  4A99 A;  2VVL A;  3CIR A;  3S47 A;  3ES8 A;  3ZVH B;  3OPS A;  3DME A;  3L5O A;  3P93 A;  3ALJ A;  1CJ2 A;  1FFU C;  4NNJ A;  3S61 A;  5FJO A;  1IJH A;  3CNT A;  2XLP A;  3VCC A;  1EBG A;  1JEH A;  2YG6 A;  3NFU A;  3MUC A;  4G8T A;  3DK9 A;  4TVW A;  5BVA A;  1N4V A;  4Z24 A;  2V60 A;  3MY9 A;  4MJW A;  2BS2 A;  3L1R A;  3QFB A;  1B8S A;  1V59 A;  1ZOY A;  3EKG A;  3P4P A;  2C7G A;  3DGH A;  1GXF A;  2YAU A;  2BK3 A;  3Q4D A;  3P1W A;  4YWS A;  1OJD A;  2XVJ A;  3DG3 A;  2W0H A;  3V5F A;  1FEA A;  3CK5 A;  1NEL A;  3RCY A;  3RP7 A;  4EMJ A;  3R1Z A;  3AE2 A;  3F8R A;  3DEQ A;  2EQ6 A;  3MKC A;  2POZ A;  2R45 A;  1Y56 B;  4J33 A;  3U9I A;  2R0P A;  2WQY A;  3CND A;  3NN6 X;  2NQL A;  4WCT A;  2YG4 A;  2OAM A;  2PTZ A;  4RSL A;  2WHD A;  2TPR A;  5CKU A;  2QGY A;  2QDD A;  1X31 B;  1E6E A;  2GR1 A;  4FDC B;  4X9M A;  2GL5 A;  3ZLH A;  1DXL A;  2OZ3 A;  1TKK A;  1BF3 A;  3VRB A;  3VC6 A;  1JPD X;  3CPI G;  1ZOV A;  4YKF A;  3UCC A;  2XVH A;  3K7M X;  4P9S A;  2OLN A;  3IC9 A;  1PJ7 A;  2BRA A;  2XYO A;  3VQR A;  2ZZB A;  3CB3 A;  3TWA A;  3R10 A;  1F3P A;  5J7X A;  2A8X A;  2V61 A;  5CQF A;  4U8L A;  4IA5 A;  3FPZ A;  3ICR A;  1KKO A;  3KUM A;  1PDY A;  2PU0 A;  3BHK A;  4JY3 A;  4GIS A;  3E1T A;  3I6D A;  4ZCC A;  5FJR A;  3QFA A;  1BWC A;  3I6E A;  2Q7V A;  4EQW A;  3FMW A;  4H4S A;  3UXL A;  5FS7 A;  1ZMD A;  3GWF A;  4A3R A;  4ZOH B;  2YR5 A;  4HCD A;  2B7R A;  1N61 C;  4GCM A;  4H4Q A;  3JVA A;  3SM8 A;  2YVF A;  4JN8 A;  1W6T A;  1PXA A;  2R46 A;  2NPX A;  5FS8 A;  3BSM A;  5EB4 A;  3C4N A;  4B66 A;  1NHS A;  4H4T A;  3CNJ A;  3URH A;  4BK1 A;  2WPE A;  3NYF A;  1VQZ A;  1N1P A;  2XVF A;  2YLZ A;  3NN0 X;  4J34 A;  3AEE A;  2PTY A;  2QJJ A;  3V4B A;  1PXC A;  2XFP A;  3I6T A;  1GSN A;  2GV8 A;  2JK6 A;  3N4F A;  2AL1 A;  3R9U A;  4JNQ A;  2GQF A;  3SX6 A;  1DJN A;  3O0H A;  3DG7 A;  5BOF A;  1STZ A;  3R07 C;  3THU A;  2VRM A;  1DOD A;  4H4R A;  3SQS A;  2VZ2 A;  1H6V A;  3SBF A;  2HZG A;  3OW1 A;  4G73 A;  2YG5 A;  5M0Z A;  2OKT A;  4HYR A;  1EC8 A;  1O5W A;  1DTN A;  1ZX9 A;  3LB8 A;  1S3E A;  1TDK A;  4JHM A;  1JRZ A;  3BJS A;  4GDE A;  3RO6 A;  4IHC A;  1L0V A;  3T2Z A;  1PJ6 A;  4BK2 A;  3UOY A;  1GPE A;  4X4J A;  2WPC A;  4DHG A;  3PG6 A;  4FK1 C;  3ENL A;  2YLW A;  3V3W A;  1P2E A;  3HYX A;  4JY2 A;  1BGN A;  2AR8 A;  4E8G A;  1XDI A;  5BOE A;  2OFJ A;  2C64 A;  3NVW B;  1S2Y A;  2BAB A;  5KMQ A;  3T14 A;  3GYI A;  1LPF A;  4IZG A;  3M0O A;  3NG7 X;  5HXI A;  4F4R A;  4A5L A;  2RDX A;  2ZBW A;  3I4K A;  2WDV A;  2BRY A;  3KKJ A;  3UKF A;  2W3S A;  2HQM A;  4DX3 A;  3RR1 A;  3AE5 A;  1GAL A;  4LII A;  4IVM B;  1TDO A;  2OVL A;  4KPL A;  3D46 A;  5FS9 A;  4REK A;  2XGZ A;  3DG6 A;  2BCP A;  2AL2 B;  3RIT A;  2GRT A;  2B76 A;  4ECH A;  1NHP A;  1W4X A;  2FJE A;  2E5A A;  2FKP A;  2GR2 A;  1KNP A;  5M10 A;  2YVJ A;  1RM6 B;  3FVD A;  1PBF A;  3JZU A;  1MRA A;  1IUU A;  3JW7 A;  1RVK A;  3ES7 A;  4YT0 A;  2GR0 A;  3AEC A;  3NRN A;  2P3Z A;  3DES A;  3IJQ A;  4IL2 A;  4G6G A;  1T3Q C;  3VA8 A;  1S3B A;  3WE0 A;  2O9Z A;  2GMJ A;  1XS2 A;  4USQ A;  3II4 A;  4LA1 A;  5JCM A;  3P9U A;  1KDG A;  4IP4 A;  1TDF A;  4KEM A;  4IA6 A;  3ZVI A;  2RAB A;  4AT2 A;  1N4W A;  2GR3 A;  3T6C A;  3DK4 A;  1X2H A;  1MXT A;  4JN9 A;  4BJZ A;  3T9P A;  5EBK A;  4EMI A;  1NG4 A;  2OLO A;  3N6H A;  2XLR A;  1K4Q A;  3QVR A;  4EQR A;  1VQW A;  2PPG A;  3NYC A;  4A7A A;  2P88 A;  4TM1 A;  2POD A;  2BK4 A;  3SGL A;  4RG3 A;  4GYP A;  3AE4 A;  3NLC A;  3T4W A;  2YR6 A;  4H83 A;  5FJT A;  4A79 A;  1CJC A;  2RGH A;  3TJI A;  2XH0 A;  1GRT A;  2GGG A;  1TE6 A;  1H82 A;  3OC4 A;  3K7Q X;  4K8G A;  2B9Y A;  4GFI A;  1YQ3 A;  2GAH B;  3IF9 A;  3FG2 P;  3UOZ A;  4Z43 A;  3M12 A;  4YSH A;  3HPF A;  4G7F A;  3CGB A;  4E6M A;  2C66 A;  3UKQ A;  1GOS A;  4KX6 A;  4N9X A;  3AE6 A;  4B63 A;  4A6N A;  1OEP A;  3UCD A;  1KFY A;  2BC1 A;  3GYX A;  2TMD A;  4JN7 A;  3QJ4 A;  4J31 A;  2P8C A;  1D7L A;  1L9E A;  3GWD A;  5EOW A;  2FBW A;  4OVI A;  3ABV A;  4GF7 A;  1REO A;  5EU9 A;  4U2L A;  4BJY A;  3P4S A;  3T0K A;  2PP3 A;  1ZKQ A;  4DWD A;  3VR9 A;  3A7R A;  4WX1 A;  3AD8 B;  3LZX A;  1RYI A;  3RRA A;  4ZCW A;  4HPN A;  4AOX A;  5TR3 A;  2JB3 A;  1PBB A;  1DOE A;  3UKK A;  3DGB A;  3GSI A;  1ONF A;  3ZLF A;  2YG7 A;  4GGH A;  3DK8 A;  5KOW A;  4K5R A;  3ATQ A;  3U4F A;  3ZVH A;  3SZC A;  4H19 A;  4JQ9 A;  5ENL A;  3PWI A;  1N5W C;  2OPJ A;  3TW9 A;  2H89 A;  1LVL A;  1TZZ A;  2CHR A;  1GRB A;  4TM0 A;  5U25 A;  3UJE A;  4YXD A;  5C2T A;  5BUK A;  4J56 A;  3SJN A;  3NTD A;  2C3D A;  3UKP A;  1BGJ A;  2WU2 A;  3PWG A;  3QN3 A;  2R0G A;  2XLU A;  5G5G B;  3HYW A;  1CC4 A;  3OTR A;  1TDE A;  4XWZ A;  1RP0 A;  1YQ4 A;  3QSS A;  1DNC A;  4AP1 A;  2C70 A;  3AN1 A;  3QVP A;  2DW6 A;  4E4U A;  5KVI A;  2Y6R A;  3NK1 X;  2PSN A;  3JSK A;  4Y4N A;  4H4Z A;  3NGC X;  2ZC8 A;  5ER0 A;  2NVK X;  1JCT A;  3ALM A;  2I5Q A;  5FMH A;  1MDL A;  1NEK A;  2VVL G;  2PHH A;  1FL2 A;  1GET A;  2OZT A;  3T37 A;  4C3X A;  3PVC A;  4OCG A;  4YSZ A;  1ZY8 A;  2PTW A;  2GVC A;  1R0M A;  3FJ4 A;  4DNA A;  5FJP A;  3BNM A;  2C65 A;  4H50 A;  1Y56 A;  2XVE A;  1FO4 A;  3C4A A;  2GDQ A;  3H8A A;  2YLT A;  4HNL A;  2AKZ A;  1MUC A;  3IJL A;  2XH7 A;  3T2K A;  1FOH A;  4USR A;  3VRD B;  3EF6 A;  4ICY A;  3UOV A;  1Z6L A;  4GIR A;  1EBH A;  4UDP A;  3UXK A;  2V6O A;  4NEW A;  3COX A;  3AE8 A;  1JDF A;  3K7T A;  1E1N A;  4K5S A;  1XHC A;  2R9Z A;  1TYP A;  1JRO A;  4PAA A;  1EL8 A;  1GRA A;  4H2P A;  5JCI A;  3BI5 A;  2XFQ A;  4XXG A;  3EAO A;  3H4K A;  3FYY A;  1DOB A;  3LAD A;  3EUB 3;  1H81 A;  1EL7 A;  2XSX A;  5KXJ A;  3SZW A;  4I58 A;  3NTA A;  3F8P A;  3IHM A;  2FYM A;  3K30 A;  1L9C A;  3P0W A;  2XH4 A;  4GDP A;  2C76 A;  3RED A;  3H7V A;  4M0X A;  2A87 A;  3QSM A;  1H7W A;  3GMC A;  3ISH A;  1TDN A;  1E7P A;  1F8W A;  4DXK A;  3QTP A;  3NHO X;  4HN8 A;  2OLA A;  3R0U A;  2BC0 A;  3H70 A;  3NVY B;  2GAG B;  4U2T A;  1KKR A;  4Y4M A;  5JCL A;  1ZDL A;  4OPU A;  2X3N A;  1D5T A;  1JRY A;  3PO7 A;  1GEU A;  2XDO A;  3UTF A;  3CAW A;  1QLB A;  4OPC A;  3Q45 A;  3UTH A;  2BXS A;  1KSS A;  6ENL A;  2O56 A;  3UGV A;  3CN8 A;  3NT6 A;  2BS4 A;  4X2P A;  4DGK A;  3MQT A;  1KN0 A;  1Q1W A;  4JDR A;  2E5V A;  3GY1 A;  3STP A;  4NTE A;  1FHU A;  4NZH A;  3FV9 A;  3HYV A;  5JCK A;  3ADA B;  1NAA A;  4YSX A;  2DKH A;  3NZG A;  3BI4 A;  4B64 A;  1EC9 A;  3EEZ A;  3BI2 A;  4E0V A;  4Y4L A;  1SB3 B;  1PBC A;  4ROP A;  2X99 A;  2Z5Y A;  4K8D A;  2JB2 A;  3OZ2 A;  2H88 A;  3FXG A;  4UDR A;  4HNC A;  1PS9 A;  2I0Z A;  1JRX A;  2X8H A;  3SN4 A;  3GD4 A;  3P3B A;  5C3J A;  3QKE A;  2WOW A;  2Q6U A;  1FHV A;  2WOI A;  4CY6 A;  5LV9 A;  4MGG A;  4OPG A;  2WPF A;  1PDZ A;  4EM3 A;  2C72 A;  3PK7 A;  3RP8 A;  1OJC A;  4Z25 A;  4GAP A;  2Q0K A;  2GGI A;  4M52 A;  4K7Z A;  1ZXI C;  4K1W A;  4EQS A;  3AEF A;  2B9X A;  3PFR A;  1GRH A;  2BA9 A;  2WOV A;  3AE9 A;  3UKH A;  4HB9 A;  5JRB A;  4AT0 A;  3SFE A;  4A6G A;  3AE7 A;  2ZZC A;  3HW2 A;  3GDP A;  1H2I A;  2GQW A;  4EMW A;  4Z2T A;  4JNA A;  2YLS A;  2VQ7 A;  5BUL A;  2OA1 A;  2QJN A;  3R11 A;  3IK4 A;  3UP5 A;  4TM4 A;  4ZCD A;  4GAV A;  5KRQ A;  3GC2 A;  2VVM A;  3GD3 A;  4M6U A;  4IT1 A;  4K2X A;  3DFY A;  1BKH A;  4K2S A;  4EIP A;  3NS1 B;  2ZZ0 A;  3KPF A;  4YSY A;  3NK0 X;  2R4E A;  2YR4 A;  4A65 A;  4YTN A;  3QSE A;  2GH5 A;  3CNS A;  3UJS A;  2VOU A;  3AYL A;  4H7U A;  2YLX A;  2CVJ A;  1VG0 A;  4FP1 A;  1GT8 A;  1GTH A;  3CYJ A;  3RNM A;  1GTE A;  5IQ4 A;  3SYI A;  4RG4 A;  1KD0 A;  4HCH A;  3GD6 A;  4GR1 A;  3CPJ G;  3BNU A;  2WET A;  5EB5 A;  2GF3 A;  2QQ6 A;  2VRL A;  1PBD A;  2W54 A;  4DSG A;  2BAC A;  4APN A;  1NDA A;  2ONE A;  3DDM A;  2GSH A;  1IUV A;  3EPT A;  3ZYX A;  4B68 A;  1PHH A;  5GRT A;  4LU6 A;  3NIX A;  5KMR A;  4C77 A;  3OZM A;  1V97 A;  1JPM A;  4G6H A;  1Q1R A;  2ACZ A;  5GSN A;  3NO1 A;  1ONE A;  3NVV B;  5U1O A;  1SEZ A;  4BUR A;  4NTC A;  3FBS A;  4GGB A;  3MWC A;  2JAE A;  2YVG A;  2GGE A;  1M64 A;  1OJA A;  1B37 A;  4MMW A;  4U8M A;  3QLD A;  3NYE A;  4AP3 A;  4Z17 A;  3AEB A;  4GME A;  1MDR A;  2PP0 A;  4U8J A;  3A7U A;  1FIQ B;  3V3N A;  4OPT A;  2HXT A;  4FX9 A;  2EQ9 A;  4ZN0 A;  1NPX A;  1KF6 A;  3LJP A;  5HHF A;  3G5R A;  1CHU A;  1KCZ A;  1IYX A;  3H8I A;  3P4R A;  1N60 C;  2A89 A;  2WES A;  2EQ7 A;  5G5H B;  1EL9 A;  4K22 A;  3DJD A;  3KVE A;  4II2 A;  2QDE A;  2PGE A;  3TJ4 A;  1CBO A;  1SJA A;  2FJB A;  3B9J B;  1WUE A;  3CT2 A;  2RGJ A;  4J1O A;  4H4P A;  3VCN A;  1PBE A;  3GO2 A;  4A6N B;  3UOX A;  4G9K A;  4YTM A;  2F5Z A;  1LQU A;  1WYG A;  2QAE A;  2V3B A;  3UTG A;  3GRT A;  3KLJ A;  2APG A;  2WP5 A;  4Z26 A;  1VDV A;  2PGW A;  4H1Z A;  4H2Q A;  1S2Q A;  2Y6Q A;  3D8X A;  3UCL A;  3AE3 A;  1F9C A;  1SJB A;  3H8L A;  3I3L A;  3UTE A;  4U2S A;  4H2H A;  3F8D A;  4HA6 A;  4UP3 A;  3CXO A;  1F8R A;  3KD9 A;  4U8N A;  1GND A;  4J2W A;  1FEB A;  5KNL A;  3Q6J A;  1N4U A;  2C73 A;  3K1G A;  2YM1 A;  1N62 C;  4C5O A;  3ITJ A;  3NK2 X;  2WP9 A;  1NHQ A;  2AQJ A;  1E1L A;  3AXB A;  2BYB A;  2V3A A;  1CF3 A;  1E1M A;  4EQX A;  1P48 A;  2XFO A;  4B69 A;  3D9X A;  3SQP A;  2GMH A;  2CUL A;  3AEA A;  4H4X A;  1ELS A;  4J3Z A;  3TTE A;  3T31 A;  3AM9 A;  5KOX A;  1MNS A;  3GYJ A;  3N4E A;  1GER A;  1XPQ A;  3KPK A;  2XVI A;  2ZAD A;  4E5T A;  3L8K A;  2GEW A;  5IPY A;  2JKC A;  3G5S A;  5HY5 A;  3S5W A;  5J60 A;  3NKS A;  3DJJ A;  2WEU A;  3IJI A;  4CRT A;  3ETR B;  3ZLG A;  4AOS A;  5KVH A;  1FCD A;  1JOA A;  4BV6 A;  1K0I A;  3MZN A;  4IP5 A;  5J04 A;  3NRZ B;  4E4F A;  3SY4 A;  2P0I A;  3V3O A;  1VRQ B;  1VDC A;  1L8P A;  4TLZ A;  3KA7 A;  3UKA A;  1O95 A;  1ZMC A;  2XFU A;  1CJ3 A;  3LZW A;  2WP6 A;  2XH2 A;  1YEY A;  4KWS A;  4EM4 A;  1EC7 A;  4B65 A;  3SFD A;  1ZK7 A;  4KPR A;  3FIM B;  2BCG G;  4B67 A;  1JNZ A;  4Z2U A;  1OJT A;  1K0L A;  3AWI A;  4UDQ A;  3UP4 A;  1TYT A;  4NWZ A;  3KU9 A;  3CGE A;  4H4W A;  1BZL A;  1PJ5 A;  1YY5 A;  3DER A;  2E1M A;  4MKS A;  2XLT A;  3IWA A;  4II3 A;  2X8G A;  1N5X A;  4D03 A;  3H12 A;  5KWF A;  2R4J A;  1SJC A;  1VG9 A;  3PS9 A;  4H4U A;  4J57 A;  2C3C A;  3CGC A;  4IL0 A;  3S5S A;  1E9I A;  1CL0 A;  2XLS A;  5KMS A;  2B9W A;  2MNR A;  3M13 A;  3SZ0 A;  3VFC A;  4CCQ A;  5BRT A;  4Z1Y A;  2QVH A;  2PU1 A;  4CCR A;  2B7S A;  1IUW A;  3UJ2 A;  1ECQ A;  3R25 A;  3EAN A;  2HNE A;  3V76 A;  2CDU A;  2OX4 A;  3IHG A;  1EBD A;  3RGT A;  1KNR A;  2ARD A;  2DKI A;  2XCG A;  4TLX A;  1YKJ A;  1LV0 A;  3B6D A;  2MUC A;  1LQT A;  4U8I A;  1PN0 A;  3T2Y A;  4DN1 A;  3ICT A;  4YWO A;  4TM3 A;  3LXD A;  4KT2 A;  2YG3 A;  1QJD A;  3C96 A;  1S7M A;  5FS6 A;  2WU5 A;  2EQ8 A;  4BK3 A;  2FJA A;  3TOY A;  5JCN A;  2XFN A;  3NVZ B;  2JB1 A;  4NEV A;  2WDR A;  3QPE A;  2BK5 A;  1LJ1 A;  2WS3 A;  5HYM A;  2OQY A;  3DFH A;  4U8O A;  1M6I A;  1UKV G;  3OP2 A;  3CXB A;  4DYE A;  3VC5 A;  2PCE A;  3AEG A;  3Q9T A;  4I59 A;  1F6M A;  4H2N A;  1N63 C;  3B97 A;  2QA2 A;  5DBJ A;  4GUV A;  3AB1 A;  3RHA A;  4OPD A;  2DW7 A;  1E1K A;  4PAB A;  4CNK A;  1R6W A;  5FJU A;  3DJE A;  4XWR A;  3AE1 A;  1XAN A;  2P8B A;  1H7X A;  2Q0L A;  4H4Y A;  1Q9I A;  2GGJ A;  2AAQ A;  2OQH A;  2QJM A;  1P2H A;  1RSG A;  2JBV A;  1D4E A;  4ZA0 A;  2YM2 A;  1MOK A;  1PXB A;  3B3R A;  4EWJ A;  4IVO B;  3ICS A;  1JU2 A;  3AD7 B;  1H84 A;  1CC2 A;  4OPL A;  4EIQ A;  3SSZ A;  1JNR A;  3AD9 B;  3SN0 A;  1IUX A;  4A9W A;  2E4G A;  3TWB A;  2PP1 A;  3SZF A;  2X8C A;  4CY8 A;  3BOX A;  4DSH A;  2C4C A;  4A35 A;  3LOV A;  2YQU A;  2AL2 A;  1AOG A;  2WBA A;  3A7A A;  4HCL A;  1B4V A;  2HXU A;  3SXI A;  2CFY A;  4D04 A;  1H83 A;  1ELI A;  2OAL A;  3DJG X;  4C74 A;  1KSU A;  1YQZ A;  4YTP A;  1NU5 A;  3G5Q A;  1O94 A;  4GYP C;  2V5Z A;  4FI4 A;  1E39 A;  2C67 A;  2QCU A;  4FK1 A;  4Z44 A;  1JRP A;  2Z5X A;  2YWL A;  2X50 A;  3V5C A;  1LTX R;  1NHR A;  3BHF A;  1PDH A;  4C3Y A;  1IUS A;  3UKL A;  1FFV C;  4GRT A;  3CMM A;  3T8Q A;  4O5Q A;  3NNE A;  1NG3 A;  3DA1 A;  1IUT A;  2VQB A;  2OZ8 A;  3HZL A;  1COY A;  2WDQ A;  5KMP A;  3RP6 A;  3GRS A;  1CJ4 A;  1D4D A;  1Y0P A;  4U8P A;  3UJF A;  5IDZ A;  3NXL A;  1FEC A;  4NTD A;  3VR8 A;  3P4Q A;  3VDG A;  2PS2 A;  2GB0 A;  3GDN A;  1WUF A;  1HYU A;  5L46 A;  4X9N A;  3AMZ A;  1OJ9 A;  3CPH G;  2BXR A;  1GES A;  1DOC A;  1H86 A;  2PYX A;  3OZY A;  2J3N A;  4Z2R A;  4ENL A;  4IV9 A;  1P43 A;  3TQP A;  2BS3 A;  3ALL A;  1MO9 A;  3NH3 X;  3N6J A;  3GMB A;  4J36 A;  1BQG A;  4G74 A;  3AYJ A;  1L9D A;  3SN1 A;  1D7Y A;  3ZDN A;  3CTY A;  1GRE A;  2QA1 A;  3HRD C;  1X2G A;  2GGH A;  2YLR A;  1EL5 A;  3AYI A;  3DGZ A;  2PA6 A;  2R0C A;  1K0J A;  2PTX A;  4CBQ A;  2UZZ A;  1BKW A;  7ENL A;  1DJQ A;  3MSY A;  2W55 A;  1XPY A;  1B5Q A;  1F8S A;  3UJR A;  3CNP A;  3VRA A;  2IVE A;  1D4C A;  4H4V A;  3R0K A;  2IVD A;  4CNJ A;  1NEN A;  4B1B A;  2E3T A;  3DH9 A;  1GRF A;  2OG9 A;  2AKM A;  2FJD A;  3ATR A;  2PMQ A;  4TVY A;  1GV4 A;  5IQ1 A;  2OO6 A;  3D1C A;  1TRB A;  2RGO A;  3DIP A;  2C75 A; 
#chains in the Genus database with same CATH homology
 2IID A;  4G6G A;  3CGE A;  4ADW A;  1QO8 A;  4H4W A;  1BZL A;  1S3B A;  2JB2 A;  3WE0 A;  1PJ5 A;  1YY5 A;  4H2R A;  3OZ2 A;  4O5U A;  1CC6 A;  2E1M A;  2H88 A;  2XLT A;  3IWA A;  2O9Z A;  2GMJ A;  4II3 A;  2X8G A;  4UDR A;  4D03 A;  1PS9 A;  2I0Z A;  3CGD A;  1JRX A;  2X8H A;  3GD4 A;  4USQ A;  5KWF A;  3II4 A;  2R4J A;  4LA1 A;  3AED A;  1ZP0 A;  1GRG A;  5U63 A;  5JCM A;  5C3J A;  1VG9 A;  4YKG A;  2WOW A;  2Q6U A;  3PS9 A;  4OPI A;  2WOI A;  3P9U A;  4U8K A;  4A99 A;  2VVL A;  3CIR A;  4H4U A;  4J57 A;  4CY6 A;  1KDG A;  5LV9 A;  4OPG A;  1TDF A;  2C3C A;  4IA6 A;  3CGC A;  2RAB A;  2WPF A;  1CL0 A;  4AT2 A;  2XLS A;  1N4W A;  2GR3 A;  5KMS A;  2B9W A;  4EM3 A;  3DK4 A;  2C72 A;  3DME A;  4NWZ A;  3L5O A;  3M13 A;  3SZ0 A;  1MXT A;  4JN9 A;  4BJZ A;  1NG4 A;  5EBK A;  4EMI A;  4CCQ A;  5BRT A;  3RP8 A;  2OLO A;  3ALJ A;  1CJ2 A;  1OJC A;  2XLR A;  4Z25 A;  4GAP A;  4NNJ A;  1K4Q A;  4CCR A;  3QVR A;  4EQR A;  1VQW A;  3NYC A;  2Q0K A;  4A7A A;  2B7S A;  3S61 A;  1IUW A;  4M52 A;  4K7Z A;  1IJH A;  3CNT A;  4EQS A;  4TM1 A;  3AEF A;  2XLP A;  2B9X A;  2BK4 A;  3SGL A;  1JEH A;  2YG6 A;  4RG3 A;  3AE4 A;  1GRH A;  2BA9 A;  2WOV A;  3DK9 A;  3AE9 A;  3NLC A;  5BVA A;  3UKH A;  4HB9 A;  5JRB A;  3EAN A;  4AT0 A;  1N4V A;  3V76 A;  2CDU A;  4Z24 A;  3IHG A;  1EBD A;  3SFE A;  2YR6 A;  4A79 A;  3AE7 A;  1KNR A;  2ZZC A;  2V60 A;  3GDP A;  2ARD A;  4MJW A;  1H2I A;  1CJC A;  2BS2 A;  2DKI A;  2RGH A;  3L1R A;  1GRT A;  2GQW A;  4EMW A;  4Z2T A;  3QFB A;  2XCG A;  1H82 A;  4TLX A;  3OC4 A;  3K7Q X;  4JNA A;  1B8S A;  1V59 A;  2YLS A;  1ZOY A;  2VQ7 A;  5BUL A;  2B9Y A;  1YQ3 A;  2GAH B;  3IF9 A;  3FG2 P;  3P4P A;  2C7G A;  3UOZ A;  4Z43 A;  3DGH A;  1YKJ A;  2OA1 A;  1LV0 A;  1GXF A;  2YAU A;  2BK3 A;  3B6D A;  3P1W A;  3M12 A;  3UP5 A;  4YSH A;  1OJD A;  2XVJ A;  1LQT A;  4TM4 A;  4U8I A;  1PN0 A;  2W0H A;  3T2Y A;  3CGB A;  4ZCD A;  4GAV A;  3ICT A;  4YWO A;  4TM3 A;  3LXD A;  5KRQ A;  1FEA A;  2C66 A;  2YG3 A;  3RP7 A;  4EMJ A;  3UKQ A;  1GOS A;  1QJD A;  3AE2 A;  4KX6 A;  2VVM A;  3GD3 A;  3F8R A;  3C96 A;  4N9X A;  1S7M A;  4K2X A;  3AE6 A;  5FS6 A;  2WU5 A;  2EQ6 A;  4B63 A;  2R45 A;  4A6N A;  4EIP A;  1KFY A;  2EQ8 A;  2ZZ0 A;  1Y56 B;  3KPF A;  4J33 A;  2BC1 A;  4BK3 A;  2FJA A;  2XFN A;  5JCN A;  2R4E A;  2YR4 A;  3NK0 X;  4A65 A;  4YSY A;  4YTN A;  3GYX A;  3QSE A;  2GH5 A;  2TMD A;  3CNS A;  3QJ4 A;  4J31 A;  1D7L A;  2VOU A;  3AYL A;  2R0P A;  2WQY A;  4H7U A;  3CND A;  2JB1 A;  3NN6 X;  1L9E A;  4NEV A;  2WDR A;  3GWD A;  2YLX A;  2BK5 A;  1LJ1 A;  2FBW A;  2WS3 A;  5EOW A;  2CVJ A;  1VG0 A;  5HYM A;  4WCT A;  2YG4 A;  4OVI A;  2OAM A;  1GT8 A;  4RSL A;  1GTH A;  3ABV A;  2WHD A;  3RNM A;  1GTE A;  4GF7 A;  4U8O A;  5IQ4 A;  1M6I A;  3SYI A;  4RG4 A;  1REO A;  4U2L A;  4BJY A;  1UKV G;  3P4S A;  2TPR A;  3T0K A;  5CKU A;  4GR1 A;  3AEG A;  3CPJ G;  3Q9T A;  3BNU A;  4I59 A;  2WET A;  1ZKQ A;  1F6M A;  2GF3 A;  5EB5 A;  1X31 B;  3VR9 A;  1E6E A;  4WX1 A;  2VRL A;  1PBD A;  3AD8 B;  3LZX A;  4H2N A;  2GR1 A;  4FDC B;  1RYI A;  4X9M A;  2QA2 A;  5DBJ A;  4DSG A;  2BAC A;  4GUV A;  4AOX A;  1DXL A;  5TR3 A;  1PBB A;  2JB3 A;  3AB1 A;  3RHA A;  1DOE A;  4APN A;  1NDA A;  1BF3 A;  1IUV A;  3EPT A;  3UKK A;  3VRB A;  3ZYX A;  3CPI G;  4OPD A;  3GSI A;  1ZOV A;  1ONF A;  4B68 A;  1PHH A;  4YKF A;  2YG7 A;  2XVH A;  5GRT A;  1E1K A;  3DK8 A;  3NIX A;  4LU6 A;  5KOW A;  3K7M X;  4PAB A;  4CNK A;  4K5R A;  4P9S A;  2OLN A;  5KMR A;  3ATQ A;  3IC9 A;  3DJE A;  4XWR A;  3AE1 A;  1PJ7 A;  4C77 A;  3SZC A;  1XAN A;  4JQ9 A;  4G6H A;  1Q1R A;  2ACZ A;  2BRA A;  1H7X A;  5GSN A;  2XYO A;  2Q0L A;  2H89 A;  4H4Y A;  1LVL A;  5U1O A;  3VQR A;  1SEZ A;  4BUR A;  1Q9I A;  4NTC A;  2ZZB A;  1GRB A;  4TM0 A;  3FBS A;  5U25 A;  4YXD A;  5C2T A;  5BUK A;  4J56 A;  3NTD A;  2C3D A;  3UKP A;  1BGJ A;  2AAQ A;  1F3P A;  1P2H A;  2JAE A;  5J7X A;  2A8X A;  2WU2 A;  2YVG A;  1RSG A;  2V61 A;  5CQF A;  1OJA A;  1M64 A;  1D4E A;  2JBV A;  4U8L A;  2R0G A;  2YM2 A;  2XLU A;  1B37 A;  1MOK A;  1PXB A;  4U8M A;  4IA5 A;  3FPZ A;  3NYE A;  3B3R A;  4AP3 A;  3HYW A;  3ICR A;  1CC4 A;  4IVO B;  3ICS A;  1TDE A;  4XWZ A;  3AEB A;  1JU2 A;  1RP0 A;  1YQ4 A;  3AD7 B;  3BHK A;  3QSS A;  4JY3 A;  1DNC A;  3E1T A;  3I6D A;  4U8J A;  4ZCC A;  4AP1 A;  1H84 A;  2C70 A;  3QFA A;  1CC2 A;  1BWC A;  3QVP A;  2Q7V A;  4OPL A;  4EQW A;  3V3N A;  5KVI A;  3FMW A;  4OPT A;  4FX9 A;  4EIQ A;  2Y6R A;  2EQ9 A;  4ZN0 A;  4H4S A;  3NK1 X;  1JNR A;  1NPX A;  1KF6 A;  3AD9 B;  5FS7 A;  1IUX A;  3JSK A;  3LJP A;  4Y4N A;  4H4Z A;  1ZMD A;  4A9W A;  3GWF A;  2E4G A;  3NGC X;  5HHF A;  5ER0 A;  2NVK X;  2YR5 A;  3ALM A;  2B7R A;  3SZF A;  3G5R A;  5FMH A;  1CHU A;  1NEK A;  2X8C A;  2VVL G;  3H8I A;  3P4R A;  4GCM A;  4H4Q A;  2A89 A;  2PHH A;  4CY8 A;  4DSH A;  2C4C A;  1FL2 A;  1GET A;  2WES A;  2EQ7 A;  2YVF A;  3SM8 A;  3T37 A;  4C3X A;  1EL9 A;  3PVC A;  1PXA A;  4K22 A;  3LOV A;  1ZY8 A;  2GVC A;  3DJD A;  3KVE A;  4OCG A;  2YQU A;  2R46 A;  4YSZ A;  1AOG A;  4DNA A;  2NPX A;  2WBA A;  5FS8 A;  1B4V A;  4II2 A;  3SXI A;  3BNM A;  5EB4 A;  2CFY A;  1CBO A;  2C65 A;  4H50 A;  1Y56 A;  4D04 A;  3C4N A;  4B66 A;  1H83 A;  1ELI A;  2OAL A;  1NHS A;  4H4T A;  3CNJ A;  2FJB A;  2XVE A;  3DJG X;  3C4A A;  3URH A;  4C74 A;  2YLT A;  4BK1 A;  1KSU A;  2WPE A;  2RGJ A;  3NYF A;  1YQZ A;  4YTP A;  4H4P A;  1N1P A;  2XVF A;  3G5Q A;  1PBE A;  4A6N B;  1O94 A;  3UOX A;  2YLZ A;  4G9K A;  4YTM A;  2F5Z A;  2V5Z A;  1LQU A;  3NN0 X;  3T2K A;  1FOH A;  1E39 A;  2C67 A;  2QCU A;  4FK1 A;  4Z44 A;  4USR A;  2Z5X A;  4J34 A;  2QAE A;  3EF6 A;  4ICY A;  3VRD B;  3AEE A;  3UOV A;  2YWL A;  2X50 A;  1PXC A;  2XFP A;  1Z6L A;  1LTX R;  1NHR A;  3BHF A;  2V3B A;  1GSN A;  1PDH A;  2GV8 A;  3UTG A;  2JK6 A;  3GRT A;  3KLJ A;  4C3Y A;  2APG A;  1IUS A;  2WP5 A;  4Z26 A;  3UKL A;  4UDP A;  4JNQ A;  3R9U A;  4GRT A;  2V6O A;  2GQF A;  4NEW A;  3CMM A;  3COX A;  4H2Q A;  3AE8 A;  3SX6 A;  1DJN A;  1S2Q A;  3K7T A;  2Y6Q A;  3NNE A;  4O5Q A;  3O0H A;  1NG3 A;  3D8X A;  1E1N A;  4K5S A;  3DA1 A;  1XHC A;  2R9Z A;  1IUT A;  1TYP A;  1DOD A;  2VRM A;  3AE3 A;  3UCL A;  4PAA A;  4H4R A;  1EL8 A;  2VZ2 A;  2VQB A;  1H6V A;  3I3L A;  1GRA A;  3H8L A;  4H2P A;  3UTE A;  3HZL A;  4U2S A;  1COY A;  5JCI A;  2YG5 A;  2WDQ A;  3BI5 A;  3F8D A;  4G73 A;  5M0Z A;  5KMP A;  2XFQ A;  4HA6 A;  3KU9 A;  4XXG A;  4UP3 A;  3RP6 A;  3GRS A;  3EAO A;  1CJ4 A;  1D4D A;  1Y0P A;  3H4K A;  1F8R A;  4U8P A;  1O5W A;  3KD9 A;  1ZX9 A;  3LB8 A;  1S3E A;  4U8N A;  1GND A;  1DOB A;  4J2W A;  3LAD A;  1FEB A;  5KNL A;  1TDK A;  3Q6J A;  1H81 A;  1FEC A;  1EL7 A;  1N4U A;  1JRZ A;  4NTD A;  5KXJ A;  3VR8 A;  4GDE A;  3P4Q A;  2C73 A;  3SZW A;  4I58 A;  3NTA A;  3F8P A;  2GB0 A;  1L0V A;  3GDN A;  2YM1 A;  3T2Z A;  1HYU A;  1PJ6 A;  5L46 A;  3IHM A;  4C5O A;  4X9N A;  3ITJ A;  4BK2 A;  3K30 A;  1OJ9 A;  3NK2 X;  1L9C A;  2WP9 A;  1NHQ A;  2AQJ A;  1E1L A;  3UOY A;  1GPE A;  3AXB A;  3CPH G;  2BXR A;  2V3A A;  2BYB A;  4X4J A;  4GDP A;  1CF3 A;  1GES A;  2WPC A;  1E1M A;  1DOC A;  1H86 A;  2C76 A;  3RED A;  3PG6 A;  2PYX A;  3QSM A;  2A87 A;  1H7W A;  4EQX A;  3GMC A;  4FK1 C;  2XFO A;  3ISH A;  2YLW A;  1TDN A;  2J3N A;  4B69 A;  4Z2R A;  3D9X A;  3SQP A;  1E7P A;  2GMH A;  1F8W A;  1P2E A;  2CUL A;  3AEA A;  4IV9 A;  3HYX A;  3NHO X;  4JY2 A;  1BGN A;  2BS3 A;  4H4X A;  2AR8 A;  3ALL A;  1MO9 A;  3NH3 X;  2BC0 A;  3T31 A;  5KOX A;  2GAG B;  1XDI A;  3GYJ A;  4U2T A;  2C64 A;  3GMB A;  4J36 A;  1GER A;  1S2Y A;  1XPQ A;  2BAB A;  3KPK A;  3AYJ A;  2XVI A;  5JCL A;  4G74 A;  4Y4M A;  1L9D A;  5KMQ A;  3T14 A;  1ZDL A;  4OPU A;  3L8K A;  2GEW A;  5IPY A;  3GYI A;  2X3N A;  1D7Y A;  3ZDN A;  1D5T A;  2JKC A;  1GRE A;  2QA1 A;  3CTY A;  1LPF A;  1JRY A;  3G5S A;  5HY5 A;  3S5W A;  3M0O A;  3PO7 A;  5J60 A;  3NG7 X;  1GEU A;  3NKS A;  5HXI A;  2XDO A;  3UTF A;  3DJJ A;  2WEU A;  4A5L A;  2YLR A;  2ZBW A;  1QLB A;  4OPC A;  2WDV A;  3UTH A;  2BRY A;  1EL5 A;  3AYI A;  3KKJ A;  3UKF A;  4CRT A;  3DGZ A;  2BXS A;  4AOS A;  1KSS A;  5KVH A;  2HQM A;  1FCD A;  2R0C A;  1K0J A;  1JOA A;  4BV6 A;  3AE5 A;  1K0I A;  3CN8 A;  1GAL A;  3NT6 A;  4CBQ A;  2BS4 A;  2UZZ A;  1BKW A;  4LII A;  4DGK A;  4IVM B;  1DJQ A;  1TDO A;  5FS9 A;  1KN0 A;  1B5Q A;  1Q1W A;  4JDR A;  1F8S A;  4REK A;  2E5V A;  3SY4 A;  3V3O A;  4NTE A;  2BCP A;  1VRQ B;  1VDC A;  3CNP A;  2GRT A;  2B76 A;  4TLZ A;  4ECH A;  1NHP A;  3KA7 A;  1W4X A;  2FJE A;  3VRA A;  3UKA A;  4NZH A;  1O95 A;  2IVE A;  1ZMC A;  2XFU A;  2GR2 A;  1CJ3 A;  1KNP A;  3LZW A;  1D4C A;  5M10 A;  4H4V A;  2WP6 A;  2IVD A;  2YVJ A;  4CNJ A;  4EM4 A;  3HYV A;  1NEN A;  1PBF A;  4B1B A;  5JCK A;  4B65 A;  3SFD A;  1IUU A;  3ADA B;  1NAA A;  3DH9 A;  1ZK7 A;  4YSX A;  1GRF A;  4KPR A;  3FIM B;  2BCG G;  2FJD A;  3ATR A;  4B67 A;  1JNZ A;  2DKH A;  4Z2U A;  1OJT A;  3BI4 A;  4B64 A;  1K0L A;  3AWI A;  4UDQ A;  1GV4 A;  5IQ1 A;  4YT0 A;  3BI2 A;  3D1C A;  2GR0 A;  3AEC A;  1TRB A;  3NRN A;  2RGO A;  2C75 A;  3UP4 A;  1TYT A;  4Y4L A;  4E0V A;  1PBC A;  2X99 A;  2Z5Y A;  4K8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...