3CGCA

Pyridine nucleotide complexes with bacillus anthracis coenzyme a-disulfide reductase: a structural analysis of dual nad(p)h specificity
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
444
structure length
444
Chain Sequence
MNYVIIGGDAAGMSAAMQIVRNDENANVVTLEKGEIYSYAQCGLPYVISGAIASTEKLIARNVKTFRDKYGIDAKVRHEVTKVDTEKKIVYAEHTKTKDVFEFSYDRLLIATGVRPVMPEWEGRDLQGVHLLKTIPDAERILKTLETNKVEDVTIIGGGAIGLEMAETFVELGKKVRMIERNDHIGTIYDGDMAEYIYKEADKHHIEILTNENVKAFKGNERVEAVETDKGTYKADLVLVSVGVKPNTDFLEGTNIRTNHKGAIEVNAYMQTNVQDVYAAGDCATHYHVIKEIHDHIPIGTTANKQGRLAGLNMLDKRRAFKGTLGTGIIKFMNLTLARTGLNEKEAKGLHIPYKTVKVDSTNMAGYYPNAKPLYLKLLYRSDTKQLLGGQVIGEEGVDKRIDVIAMALFNKMSIHDLEDVDLSYAPPYNSVWDPIQQAARRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pyridine nucleotide-disulfide oxidoreductase, class I
publication title Pyridine Nucleotide Complexes with Bacillus anthracis Coenzyme A-Disulfide Reductase: A Structural Analysis of Dual NAD(P)H Specificity.
pubmed doi rcsb
source organism Bacillus anthracis str.
molecule tags Oxidoreductase
total genus 151
structure length 444
sequence length 444
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3cgcA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3cgcA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3cgcA02
2X8CA 4A65A 4NEVA 4NTCA 5C2TA 1FOHA 2XVFA 2YM1A 1M64A 5M10A 2HQMA 2E5VA 3II4A 3NHOX 4U2TA 1GRBA 3AEGA 4H4QA 1N4WA 3M12A 4XWZA 1KNPA 1Y56B 1BWCA 3ALMA 2CDUA 2YVJA 2EQ8A 2R45A 3FPZA 2XFQA 1CC6A 1NG3A 1PDHA 4NTEA 4WCTA 2WP6A 3AYIA 2BABA 1IUTA 4YKGA 1KDGA 4YTMA 1GALA 3I3LA 2DKHA 3F8RA 1GT8A 2XVJA 3RP6A 2VOUA 1ZMDA 2XFPA 3GWFA 2WOWA 4NEWA 2X8GA 3UOVA 1CJ2A 1LTXR 3CPJG 1JRXA 3NN0X 2BC0A 3P4SA 3AEFA 4EM3A 3K30A 4Z2RA 4JDRA 2NPXA 4AP3A 1B5QA 3AD8B 3NK2X 4JQ9A 2C75A 4EMJA 3DJEA 2YG4A 4UDRA 1EL9A 1PXCA 3CGEA 2C3DA 1CL0A 2WS3A 3DJDA 1OJCA 4ECHA 2WBAA 2XDOA 3AEBA 2OA1A 2XLUA 5CQFA 1MOKA 4EQRA 2A89A 2XYOA 3VQRA 3FG2P 2IVEA 3BHFA 4XXGA 3ATRA 4A7AA 3AD9B 1ZOVA 4J2WA 1N1PA 1P2EA 4J56A 2WP5A 3SQPA 3I6DA 1XDIA 3AE4A 4OPGA 3S61A 2ZZBA 1BKWA 3EAOA 4H2PA 2QCUA 3KKJA 4AT2A 1YKJA 2FJBA 2BS2A 1BGNA 5EBKA 5JCIA 1BZLA 1ZP0A 5EB4A 3L8KA 1L0VA 4EQWA 1REOA 3REDA 4Z2UA 2R9ZA 4APNA 1YY5A 1DXLA 4YSXA 3LXDA 4DNAA 1XANA 1H83A 2CFYA 1OJAA 2NVKX 4GDEA 2ARDA 2B7RA 1DODA 5ER0A 2ZZCA 2XFOA 4OPCA 1IUWA 1LQUA 5HXIA 1MXTA 4IVMB 4H4ZA 4H4SA 2IIDA 3UOZA 1P2HA 1H81A 2GH5A 3EF6A 3EPTA 1O5WA 3M13A 3DJJA 4OPIA 4X4JA 4B1BA 5J60A 2E1MA 2TPRA 3IHMA 2GQWA 3AYLA 4H7UA 4OPUA 3QSEA 1VQWA 1GNDA 5KXJA 3FMWA 3PVCA 2CULA 4E0VA 2ACZA 3LJPA 4CRTA 2WOIA 3BNMA 2WOVA 2BCPA 3UKAA 2X8HA 1KFYA 3ABVA 2ZZ0A 2BS4A 3BI4A 2WP9A 3NN6X 3UKKA 1Q9IA 2OALA 1H84A 3ZYXA 5IPYA 3LZXA 2E4GA 2OAMA 1YQ4A 4ICYA 2GAHB 1GTHA 1PN0A 3CIRA 3GDNA 2BS3A 3KA7A 4RSLA 5EOWA 4YSYA 1NDAA 1GEUA 3RP8A 1GOSA 1JNZA 1N4UA 3M0OA 3ADAB 2V61A 4K5SA 1VG9A 1GETA 2Q0LA 4IA6A 2GMJA 3RNMA 1D4CA 4A9WA 1IUSA 2GEWA 3AE1A 3Q6JA 3KU9A 4K8DA 1CBOA 3DGHA 1GSNA 1D7LA 2FJDA 4YSZA 3NG7X 2X3NA 4C3YA 5EB5A 5BUKA 3AD7B 4B69A 3WE0A 4LIIA 3GSIA 1BF3A 4YSHA 1O95A 3O0HA 3NH3X 1K4QA 2C3CA 1LV0A 3UKHA 4Z43A 1XHCA 3UKLA 3PS9A 4GUVA 3IHGA 2VZ2A 1PJ5A 1ZDLA 1LQTA 4JN9A 3Q9TA 1PXBA 3CNPA 2YLTA 1VRQB 3B3RA 3LZWA 4U2LA 1FEBA 3D1CA 1MO9A 4C3XA 3CTYA 2C70A 2VVLA 4EQSA 3LOVA 3GRSA 1PBEA 4B66A 3IWAA 4AP1A 2EQ6A 3RHAA 1GRFA 2FBWA 3KLJA 3KPFA 1CHUA 2V60A 3ISHA 1FL2A 4A79A 3LADA 4WX1A 3VRAA 1X31B 5C3JA 2JB3A 3UTEA 2XLTA 2R4JA 4CCQA 3GYIA 1EL8A 4U8KA 2YR4A 4HA6A 3GD4A 1KSUA 4CNKA 1VG0A 2R0PA 3C96A 1DJQA 1RYIA 3FBSA 2WQYA 2UZZA 3UTFA 4MJWA 2Y6QA 2JB2A 3SFDA 2YR5A 2XLPA 3IC9A 1UKVG 1EL7A 3KVEA 2AR8A 1EL5A 1GRAA 3ATQA 2BC1A 2V6OA 2YG7A 4U8MA 1NENA 2A87A 3C4AA 2WU2A 4GDPA 4PABA 4K7ZA 2TMDA 2PYXA 3GYJA 2YLWA 3BI2A 4RG3A 4A5LA 3GRTA 4I58A 3F8PA 3VRDB 2XFUA 3CPHG 3E1TA 4PAAA 4H4YA 4KPRA 3GDPA 1JRYA 3DGZA 3BHKA 5FS7A 4ADWA 1ZOYA 4BURA 2YLRA 4TLZA 5U63A 4C5OA 1JU2A 4EM4A 1S2QA 2Z5YA 2PHHA 3IF9A 2GR2A 2APGA 2WESA 3AE6A 1K0JA 4O5UA 2WDRA 4H4PA 4BK1A 1E1MA 3NT6A 4JY2A 4ZCCA 2XVEA 2BK5A 4J57A 3R9UA 3RP7A 1AOGA 4JNAA 2GRTA 1IUXA 1QO8A 4YXDA 1CJ4A 3SFEA 2WDQA 2EQ7A 5FMHA 1E39A 4U8OA 5J7XA 3V3OA 3H4KA 1EBDA 1DJNA 3AECA 1BGJA 2YM2A 2YG3A 1GV4A 4FX9A 1FCDA 1H86A 1LPFA 2R0CA 2JK6A 5GRTA 4BJYA 3NYEA 4EQXA 4U8LA 3OC4A 2JB1A 3DH9A 2F5ZA 2YWLA 1PBFA 4M52A 1CJ3A 2YLSA 3DK4A 4NZHA 1RSGA 2C66A 3CN8A 2WETA 3CPIG 4UP3A 2A8XA 2BA9A 1H7WA 4Y4MA 3CGBA 2BACA 3GD3A 3GWDA 5FS6A 1KF6A 5HYMA 1YQ3A 4DGKA 4U8IA 1TYTA 2VRMA 2RABA 4K5RA 5JCMA 4Y4LA 2EQ9A 2GV8A 2BXSA 1K0LA 4EIPA 4U8NA 4CY6A 1HYUA 3OZ2A 3QSMA 3NLCA 3PO7A 4B68A 3QVRA 4GRTA 2YG6A 1TDKA 3L1RA 4H2RA 1B8SA 2GR0A 3KD9A 4J36A 1H82A 4RG4A 4U8PA 1JNRA 1E1NA 1ONFA 2OLNA 4B64A 2BYBA 2XCGA 3UOXA 4USQA 2X99A 4GR1A 2VVLG 2V3AA 1XPQA 1GRHA 2B7SA 2Z5XA 4J33A 5GSNA 5L46A 4FDCB 1TDEA 3ICTA 4Z25A 1F8SA 3NTAA 3P4RA 5KVIA 4B67A 3NTDA 4YKFA 3H8IA 2C76A 3V3NA 4USRA 2GR1A 3NRNA 4U8JA 2R4EA 3NYFA 2C72A 1NG4A 3AB1A 5FS8A 1LVLA 2ZBWA 3DMEA 3NNEA 5LV9A 3K7TA 2VVMA 2YVFA 5JCKA 2BXRA 2C67A 1E1KA 1GREA 1PXAA 1S2YA 2XLSA 4IVOB 2J3NA 1CC4A 3CGDA 3NK1X 5BULA 1NPXA 4OVIA 1Z6LA 2Q0KA 3SM8A 4AT0A 1H7XA 5IQ1A 3AEEA 1GPEA 4FK1C 3AE2A 1ZMCA 1V59A 2FJAA 1PHHA 1F8WA 1VDCA 3H8LA 4GCMA 4BJZA 1OJ9A 2WHDA 5JCNA 3AEAA 4U2SA 4CY8A 2GR3A 1NAAA 1Q1RA 3AE8A 4O5QA 3COXA 3P1WA 4C77A 1YQZA 4H4WA 4H4RA 4EMIA 3GMCA 1QLBA 1S3BA 1GXFA 3AE3A 3UKFA 4A99A 3AWIA 2CVJA 5KWFA 1PS9A 2GAGB 4UDPA 4OPDA 3P9UA 4JNQA 1K0IA 2V5ZA 3CNTA 3NK0X 4HB9A 3CNJA 4IA5A 4H4XA 1OJDA 3ALJA 4N9XA 3UKQA 4BK3A 1IUUA 2WPCA 4H4TA 4EMWA 1N4VA 1S3EA 2XVIA 3URHA 2JAEA 2RGOA 2RGJA 4K22A 4EIQA 2GMHA 2I0ZA 4TM3A 1TYPA 2O9ZA 3NKSA 2B9YA 2VQBA 1F8RA 1CC2A 2C65A 2X50A 2VRLA 4ZN0A 1DNCA 2R46A 1IUVA 3ITJA 1GRTA 2QA1A 2YQUA 5KOXA 4GF7A 4H50A 4KX6A 1M6IA 3QSSA 2IVDA 3ALLA 1ELIA 1TRBA 4UDQA 4OCGA 4IV9A 4A6NA 1NHQA 1CJCA 2RGHA 1JEHA 1ZY8A 2WPEA 4H4VA 1KSSA 4TM0A 4YT0A 3BI5A 3S5WA 4AOXA 3VR8A 4BK2A 3AE5A 2W0HA 1DOCA 1L9CA 1ZKQA 2YLZA 3F8DA 2YAUA 1F3PA 1ZK7A 1D4EA 1TDFA 2YG5A 1SEZA 2WEUA 2QAEA 3NIXA 2H89A 2V3BA 2B76A 2Q6UA 3GMBA 4YWOA 3NGCX 2Y6RA 4OPLA 3VRBA 5BRTA 4NTDA 2WU5A 3UTHA 3AE9A 2WDVA 4Y4NA 2JKCA 3C4NA 1FEAA 2XFNA 2AQJA 4ZCDA 1D4DA 3VR9A 3V76A 4LA1A 1NHRA 3CGCA 3UCLA 3DK8A 4TLXA 3CNDA 1PJ7A 3UP5A 4K2XA 3UP4A 5TR3A 3AE7A 4FK1A 3D8XA 3K7QX 1QJDA 1W4XA 2QA2A 3QJ4A 5FS9A 4TM4A 4D03A 2AAQA 3NYCA 3CNSA 1GESA 4OPTA 4Z2TA 1JOAA 1H6VA 2C7GA 4LU6A 3P4QA 5IQ4A 2GQFA 4XWRA 3DK9A 4B65A 3AXBA 5U25A 1Y56A 1IJHA 1F6MA 1Q1WA 4CBQA 3LB8A 1B4VA 3B6DA 3JSKA 4X9MA 3ICSA 3ICRA 4P9SA 1CF3A 2GB0A 5DBJA 5CKUA 1L9EA 4H4UA 3EANA 1D7YA 3DA1A 1E7PA 1RP0A 1E1LA 3UOYA 1GTEA 5JCLA 3UTGA 5M0ZA 2GF3A 3SGLA 1JRZA 2GVCA 1DOEA 3G5QA 3AEDA 1Y0PA 1PBBA 1KNRA 3DJGX 2DKIA 4Z24A 3UKPA 2BK4A 1GRGA 2YR6A 4I59A 5U1OA 4BV6A 1PBDA 1NHSA 1PBCA 5KOWA 5KVHA 2C73A 1FECA 5HHFA 3QVPA 4REKA 1D5TA 4TM1A 4D04A 4A6NB 3G5SA 3QFAA 1PJ6A 3G5RA 2JBVA 3FIMB 2OLOA 1COYA 3T37A 2C64A 1LJ1A 1B37A 4C74A 4CNJA 3HZLA 1NEKA 1GERA 3P4PA 4B63A 5HY5A 2B9WA 5BVAA 3AYJA 1OJTA 2R0GA 1TDNA 4J31A 3BNUA 1DOBA 4H2NA 1ZX9A 2VQ7A 2YLXA 4Z44A 3ZDNA 2YVGA 4CCRA 4YTPA 2H88A 3K7MX 2WPFA 2BK3A 4J34A 1TDOA 4Z26A 3QFBA 2XVHA 1L9DA 1NHPA 5KRQA 4JY3A 4DSHA 2BCGG 2FJEA 2XLRA 4DSGA 2Q7VA 4YTNA 1O94A 1E6EA 4H2QA 4X9NA 4AOSA 2B9XA
chains in the Genus database with same CATH superfamily
2X8CA 2HQMA 4H4QA 1N4WA 1BWCA 2CDUA 1PDYA 2EQ8A 4TVYA 2R45A 1L8PA 2WP6A 2BABA 1IUTA 5KMPA 5ENLA 3U4FA 2OPJA 2WOWA 1LTXR 4YWSA 3NN0X 2BC0A 4EM3A 3K30A 3TJ4A 4AP3A 1FFUC 1RVKA 1CL0A 3MZNA 2WBAA 1MOKA 4EQRA 3VQRA 2IVEA 4H83A 3ATRA 3CMMA 3AE4A 4GAVA 2QCUA 3RCYA 3UJ2A 1YKJA 5EB4A 3NVWB 4EQWA 4APNA 1YY5A 3CYJA 4GYPA 4DN1A 3RGTA 2AL2A 1OJAA 4GDEA 2XFOA 3SN4A 3M13A 3DJJA 4FI4A 4B1BA 2E1MA 4OPUA 3QSEA 1VQWA 4EWJA 2CULA 2WOIA 3PWGA 2WOVA 3T2ZA 2X8HA 1KFYA 2ZZ0A 3U9IA 2E4GA 4YKGA 3CIRA 2XH2A 4K5SA 4DXKA 2C4CA 3RNMA 3H70A 4DWDA 3GO2A 1MRAA 1CBOA 2FJDA 3NG7X 2X3NA 5EB5A 3ZVIA 1BF3A 1K4QA 3V3WA 4ZOHB 4GUVA 1PJ5A 2P8BA 1PXBA 1VRQB 2XSXA 1MO9A 1PBEA 3RHAA 2AKZA 1GRFA 3T8QA 3CB3A 4A79A 2R4JA 1EL8A 3FBSA 2UZZA 2JB2A 2YR5A 2XLPA 3IC9A 1UKVG 1EL7A 2AR8A 1EL5A 2PP1A 2V6OA 4KT2A 2YG7A 4U8MA 2A87A 4K7ZA 4I58A 3CPHG 3E1TA 4PAAA 4KWSA 4KPRA 3SN1A 1ZOYA 3OZYA 3IF9A 2Z5YA 2PHHA 4HYRA 2APGA 1SJBA 3DFYA 2XVEA 4JNAA 1IUXA 3VCCA 3V3OA 1EBDA 2YM2A 2YG3A 1GV4A 1H86A 2JK6A 4BJYA 4EQXA 4U8LA 2YLSA 2C66A 3DDMA 3I6EA 2BA9A 3CGBA 3CAWA 2BACA 3GD3A 3NRZB 3QN3A 1YQ3A 2VRMA 3AMZA 2EQ9A 4U8NA 3GC2A 3PO7A 1PDZA 1XPYA 3L1RA 4J36A 1H82A 3DFHA 1E1NA 3UOXA 1TE6A 2VVLG 3SBFA 5GSNA 2PTYA 1TDEA 2C76A 1NG4A 3DMEA 2XH0A 3K7TA 2BXRA 1E1KA 2J3NA 2Q0KA 4II3A 3TCSA 4AT0A 2PS2A 4FK1C 4JHMA 3AE2A 1ZMCA 1V59A 1OJ9A 4U2SA 3BJSA 3KUMA 3COXA 4C77A 3A7AA 1YQZA 4EMIA 3GMCA 1GXFA 4OPDA 5JRBA 3CNJA 4IA5A 3PG6A 4N9XA 1N4VA 3R07C 3URHA 3ES7A 2GMHA 2I0ZA 4GAPA 2B9YA 2C65A 2R46A 1IUVA 3ITJA 1GRTA 4ZA0A 2OX4A 4KX6A 2AKMA 4IV9A 1NHQA 3UGVA 2RGHA 1ZY8A 5FJRA 3S5WA 1FO4A 1DOCA 3TWBA 3F8DA 1F3PA 2QGYA 3OP2A 3GMBA 4YWOA 4OPLA 4HN8A 4NTDA 3AE9A 1JRPA 2JKCA 3NVYB 3C4NA 4ZCDA 3H12A 1D4DA 3UCLA 3SXIA 3UP5A 4K2XA 5TR3A 3AE7A 4FK1A 3K7QX 1QJDA 2QA2A 2PTXA 2W3RA 5FS9A 1WUEA 2PU0A 1H6VA 2C7GA 5BOEA 4CBQA 3LB8A 1B4VA 3JSKA 4X9MA 4HPNA 1CF3A 1E7PA 3DEQA 3SGLA 1JRZA 1DOEA 3Q45A 2DKIA 3SZ0A 3NVZB 2BK4A 1GRGA 4HCDA 1FECA 3N6JA 3QFAA 1PJ6A 3G5RA 3ES8A 2HXTA 3HZLA 3MKCA 3V4BA 3VC5A 1TDNA 3N6HA 3ZDNA 3A7UA 4YTPA 3UJFA 6ENLA 2NQLA 2OG9A 3OZMA 4K1WA 4NNJA 4YTNA 1E6EA 2I5QA 5M10A 1FOHA 2YM1A 3II4A 1GRBA 2GDQA 3AEGA 4HCHA 1N5WC 1KNPA 1Y56B 3ALMA 2XFQA 1CC6A 4E5TA 2OKTA 4WCTA 3VC6A 1GALA 2HXUA 2BRYA 3I3LA 2DKHA 3F8RA 1GT8A 3RP6A 2VOUA 4JN8A 1R0MA 4NEWA 2X8GA 3NFUA 4G6GA 4Z2RA 4JDRA 4JQ9A 2C75A 1MUCA 3MUCA 4ECHA 3AEBA 2XLUA 5CQFA 2PSNA 2A89A 3BOXA 4A35A 3GD6A 1N1PA 1MDRA 3I6DA 2PP3A 2PGEA 2BS2A 1BZLA 3REDA 2R9ZA 1DXLA 4DNAA 1H83A 2CFYA 2NVKX 3T31A 1IUWA 3HYWA 3UOZA 1H81A 3Q4DA 3EPTA 3DG6A 4OPIA 4X4JA 4H7UA 3FMWA 4E0VA 3LJPA 3UJEA 4CRTA 4G8TA 2BCPA 3UKAA 2BS4A 2WP9A 3UKKA 3ZYXA 3LZXA 4U8JA 2GAHB 1GTHA 5EOWA 1NDAA 1GEUA 1GOSA 1N4UA 3SSZA 3JW7A 3I6TA 2V61A 3NXLA 1IUSA 3AE1A 3SR6B 3Q6JA 3DGHA 4YSZA 3WE0A 4LIIA 3R10A 3NH3X 2C3CA 4GMEA 3UKLA 3HPFA 3SQSA 2VZ2A 1ZDLA 1LQTA 3Q9TA 2YLTA 5BOFA 2E5AA 3D1CA 4C3XA 3A7RA 2VVLA 3LOVA 3GRSA 1CHUA 2V60A 1FL2A 3UCCA 3FVDA 3LADA 2OLAA 2XLTA 3GYIA 4HA6A 5G5HB 1IYXA 1DJQA 5EU9A 2Y6QA 3VCNA 3FJ4A 1EC9A 2BC1A 1NENA 3THUA 3C4AA 4E4UA 3BSMA 3GYJA 1X2HA 4A5LA 4H4YA 4HNLA 3GDPA 4BURA 1K0JA 1TZZA 2WDRA 4JY2A 3V5CA 4J57A 3R9UA 3SFEA 1E39A 5J7XA 3H8AA 5FJOA 3UCDA 1SB3B 1LPFA 5GRTA 2F5ZA 3ZLHA 1CJ3A 4IT1A 3DK4A 1RSGA 3CN8A 2A8XA 1YEYA 3GWDA 3R11A 1KF6A 3QKEA 4DGKA 2DW6A 1DTNA 4K5RA 1K0LA 4EIPA 4CY6A 3QSMA 3QVRA 1B8SA 2GR0A 4RG4A 1JNRA 3RITA 1ONFA 2OLNA 2BYBA 4USQA 2X99A 1GRHA 5L46A 4FDCB 4Z1YA 1F8SA 4B67A 4USRA 3NRNA 2C72A 1LVLA 5KMSA 2VVMA 2YVFA 1JCTA 1GREA 2P88A 1NPXA 4OVIA 1Z6LA 3SM8A 1H7XA 3H8LA 1PHHA 1VDCA 4BJZA 2WHDA 5JCNA 3AEAA 2GR3A 3VFCA 1S3BA 3AE3A 4A99A 3SZCA 2GAGB 4FP1A 1TKKA 3P9UA 1K0IA 3T2KA 2DW7A 3UKQA 2QJMA 2GL5A 1TYPA 4ZCWA 2VRLA 4ZN0A 2GSHA 4GF7A 1M6IA 3SN0A 2ZC8A 1ELIA 4UDQA 4OCGA 3VDGA 1R6WA 1N61C 3BI5A 4BK2A 4AOXA 2W0HA 3PFRA 1ZKQA 1ZK7A 1TDFA 1SEZA 3NIXA 2H89A 2B76A 3NGCX 3VRBA 3HYXA 4K8GA 1H2IA 2QVHA 2ZADA 2XFNA 3VR9A 3V76A 4LA1A 2O56A 3CGCA 3PK7A 1T3QC 3SX6A 5J04A 3R0KA 1F9CA 3NYCA 3CNSA 4LU6A 5IQ4A 4XWRA 3DK9A 5FJTA 1X2GA 4B65A 4IL2A 5U25A 2PODA 1Y56A 1IJHA 3B6DA 3R1ZA 2PMQA 3ENLA 1L9EA 3EANA 4DYEA 3MQTA 1RP0A 1E1LA 5JCLA 5M0ZA 2GF3A 3L5OA 1ZXIC 1ELSA 2YR6A 1RM6B 5KOWA 2P8CA 4E8GA 3QVPA 4REKA 1D5TA 4TM1A 4D04A 4A6NB 2JBVA 3H7VA 2OLOA 1B37A 2W54A 4CNJA 1NEKA 5BVAA 1OJTA 2QJNA 1ONEA 3BNUA 1DOBA 1ZX9A 2VQ7A 2YVGA 4CCRA 2H88A 2WPFA 1SJCA 1NHPA 5KRQA 1EBGA 3SJNA 2XLRA 4J3ZA 4DSGA 1O94A 3DG3A 3EUB3 4NTCA 1M64A 3NHOX 5KMRA 4HNCA 3R0UA 1E9IA 4XWZA 2YVJA 3FPZA 1NG3A 1PDHA 4NTEA 1KDGA 4YTMA 1JPDX 2XVJA 3NZGA 3TOYA 5G5GB 4HCLA 1ZMDA 2XFPA 3UOVA 1CJ2A 3P3BA 3SY4A 3P4SA 3AEFA 2NPXA 1B5QA 3NK2X 3DJEA 4UDRA 2WS3A 2OA1A 3FG2P 1ZOVA 1P2EA 4J56A 3SQPA 1XDIA 3S61A 2PCEA 1BKWA 4DHGA 2FJBA 2W55A 5EBKA 1ZP0A 3DG7A 3L8KA 4ROPA 7ENLA 1DODA 1LQUA 4H4ZA 4H4SA 2IIDA 3JZUA 1P2HA 2GH5A 2TPRA 3ZLGA 4II2A 3AYLA 5KXJA 1GNDA 2ACZA 3BNMA 1Q9IA 3R25A 4ICYA 4RSLA 1PN0A 3GDNA 4YSYA 3EKGA 3RP8A 3M0OA 4IA6A 2GMJA 1D4CA 3FV9A 3MWCA 3DGBA 4C3YA 3B9JB 3AD7B 4Z43A 1P48A 3IHGA 4G7FA 4JN9A 2FKPA 3CNPA 4U2LA 3T0KA 1FEBA 2C70A 4B66A 3IWAA 2EQ6A 3KPFA 3UTEA 4U8KA 2YR4A 2PA6A 1KSUA 1VG0A 4CNKA 2R0PA 3C96A 4MJWA 3SFDA 3KVEA 2OZTA 3ATQA 3I4KA 3DIPA 3UXKA 2WU2A 4PABA 3SYIA 1XS2A 2TMDA 2PYXA 4JN7A 3S5SA 3BI2A 4RG3A 3GRTA 1NU5A 3F8PA 2GGIA 3K1GA 1JRYA 5FS7A 4ADWA 1BKHA 5U63A 4C5OA 1KKOA 2GR2A 2WESA 2QJJA 4BK1A 3NT6A 4ZCCA 3RP7A 4Z17A 1QO8A 4YXDA 2EQ7A 4U8OA 3CT2A 4GGBA 2XH7A 1DJNA 3AECA 1BGJA 3IJLA 2HNEA 4FX9A 2AL1A 2JB1A 2YWLA 2WETA 4UP3A 1H7WA 5HYMA 3RR1A 4U8IA 2RABA 1VDVA 5JCMA 2PTWA 2BXSA 3GY1A 1HYUA 3NLCA 4GRTA 3FXGA 4H2HA 2YG6A 4H2RA 3KD9A 4U8PA 4B64A 3MY9A 4GR1A 2V3AA 3TQPA 4Z25A 3ICTA 3NTAA 3NTDA 3H8IA 2GR1A 4MGGA 3AB1A 5FS8A 3NNEA 5LV9A 2OO6A 2XLSA 4IVOB 2FYMA 1CC4A 3CGDA 3NK1X 5BULA 5IQ1A 1GPEA 2FJAA 4GCMA 1F8WA 4H19A 4GFIA 1W6TA 4H4RA 1KN0A 3UKFA 5KWFA 1PS9A 4UDPA 4JNQA 3NK0X 4H4XA 3ALJA 4EMWA 2XVIA 4M6UA 2RGOA 2RGJA 3HYVA 4K22A 4EIQA 2MUCA 4TM3A 3NKSA 1F8RA 2X50A 1DNCA 2QA1A 2YQUA 4H50A 3QSSA 1JDFA 4GGHA 3ALLA 4A6NA 1CJCA 1JEHA 4H4VA 2WPEA 5KMQA 3VR8A 1SJDA 3AE5A 1V97A 1D4EA 2YG5A 2GGJA 2WEUA 2QAEA 2XGZA 3ZLFA 2Q6UA 5BRTA 3IJIA 2WU5A 3UTHA 4Y4NA 2W3SA 4GISA 1N63C 1SJAA 4TLXA 3UP4A 1OEPA 1S7MA 3TWAA 3QJ4A 4TM4A 4D03A 4OPTA 4A6GA 3P4QA 5FJUA 3AXBA 2PP0A 1F6MA 3ICSA 3N4FA 1D7YA 1GTEA 3UTGA 1N60C 1FIQB 2GVCA 3G5QA 2GGHA 1Y0PA 1PBBA 4DX3A 4I59A 4BV6A 1PBDA 1PBCA 5KVHA 2C73A 5HHFA 2PTZA 3G5SA 3FIMB 3QTPA 1COYA 3T37A 4C74A 4TVWA 3ZVHB 3P4PA 4B63A 2OZ3A 3AYJA 2R0GA 4J31A 3FYYA 4H2NA 1MNSA 2YLXA 3KPKA 3T2YA 3K7MX 1FHUA 4J34A 1TDOA 2XVHA 1L9DA 3PWIA 3VA8A 2Q7VA 4H2QA 4X9NA 4A65A 4NEVA 5C2TA 4NWZA 2XVFA 2E5VA 4U2TA 4H1ZA 3M12A 2OQYA 2MNRA 4IZGA 3UJSA 3AYIA 3T6CA 1MDLA 3TW9A 3NS1B 3UXLA 3GWFA 1WYGA 4X2PA 1P43A 3N4EA 3CPJG 1JRXA 3AD8B 3QPEA 4EMJA 2YG4A 1EL9A 1PXCA 3CGEA 2C3DA 3DJDA 1OJCA 2XDOA 2XYOA 3JVAA 3BHFA 4XXGA 4A7AA 2POZA 3AD9B 4J2WA 2WP5A 4OPGA 4KEMA 2ZZBA 3EAOA 3GYXA 3CXBA 4H2PA 3KKJA 4AT2A 5JCIA 1BGNA 1REOA 4Z2UA 4YSXA 3DERA 4IP4A 2PPGA 3LXDA 4M0XA 1XANA 2ARDA 2B7RA 5ER0A 2ZZCA 4OPCA 3V5FA 3RO6A 5HXIA 1MXTA 4IVMB 2E3TA 3EF6A 1O5WA 5J60A 3IHMA 2GQWA 3PVCA 2GGGA 2ONEA 2P3ZA 3ABVA 3BI4A 3NN6X 4G73A 2OALA 1H84A 5IPYA 2OAMA 1YQ4A 1L0VA 3KA7A 2BS3A 5KNLA 3UJRA 4IHCA 1JNZA 4G74A 3ADAB 1VG9A 1GETA 2Q0LA 4A9WA 2GEWA 1KCZA 3KU9A 4K8DA 3AN1A 1GSNA 1D7LA 5BUKA 2RDXA 4B69A 3GSIA 4YSHA 3OPSA 1O95A 3MSYA 3O0HA 3UKHA 1LV0A 1XHCA 3OTRA 3PS9A 2OFJA 1FFVC 3CXOA 4E6MA 4F4RA 1N5XA 3B3RA 3LZWA 3CTYA 4EQSA 4AP1A 2FBWA 3KLJA 3ISHA 4WX1A 3T14A 3VRAA 1X31B 5C3JA 2JB3A 4CCQA 3GD4A 5FJPA 1EC7A 2AL2B 1EC8A 2XH4A 1RYIA 2WQYA 3UTFA 4MKSA 1GRAA 4KPLA 4GDPA 3FCPA 1WUFA 2YLWA 3VRDB 2XFUA 3SZWA 3DGZA 3BHKA 2YLRA 4TLZA 1JU2A 4EM4A 1S2QA 3AE6A 2OQHA 4O5UA 4H4PA 1E1MA 4G6HA 2BK5A 1AOGA 2GRTA 3T4WA 1CJ4A 4MMWA 2WDQA 5FMHA 4IL0A 3H4KA 3D47A 4GIRA 1FCDA 2R0CA 3STPA 3NYEA 1BQGA 3OC4A 3DH9A 1PBFA 4M52A 4NZHA 3CPIG 3D46A 4Y4MA 5FS6A 3IK4A 4K2SA 1TYTA 4Y4LA 2GV8A 3RRAA 3OZ2A 4B68A 1TDKA 3TJIA 2XCGA 3NO1A 1XPQA 2Z5XA 2B7SA 4J33A 4ENLA 3P4RA 5KVIA 4YKFA 3V3NA 3SZFA 2R4EA 3NYFA 2ZBWA 5JCKA 2C67A 1KD0A 1PXAA 1S2YA 3D9XA 2QDDA 2PU1A 2CHRA 1JROA 4J1OA 3AEEA 4G9KA 2OVLA 4CY8A 1NAAA 1Q1RA 3AE8A 4O5QA 3P1WA 4H4WA 1QLBA 3AWIA 2CVJA 2V5ZA 3CNTA 4HB9A 1OJDA 2PGWA 3CK5A 4BK3A 1IUUA 2WPCA 4H4TA 1S3EA 2JAEA 1FHVA 2O9ZA 3QLDA 2VQBA 1CC2A 5KOXA 2BRAA 2IVDA 3TTEA 1TRBA 1KKRA 4TM0A 1KSSA 4A3RA 4YT0A 3ZVHA 1L9CA 2YLZA 2YAUA 1JPMA 2V3BA 2Y6RA 3OW1A 3IJQA 2OZ8A 2WDVA 1FEAA 2AQJA 4E4FA 1NHRA 3DK8A 3CNDA 3B97A 1PJ7A 3D8XA 1W4XA 1VQZA 3HRDC 1STZA 2HZGA 2AAQA 1NELA 1GESA 4Z2TA 1JOAA 5IDZA 2GQFA 2P0IA 1Q1WA 3DESA 3AM9A 3EEZA 3ICRA 4P9SA 3P93A 2GGEA 2GB0A 5DBJA 5CKUA 4H4UA 3DA1A 3S47A 3UOYA 1N62C 3AEDA 3NVVB 1KNRA 3DJGX 4Z24A 3UKPA 5U1OA 1NHSA 4IP5A 3HW2A 3ETRB 2C64A 1LJ1A 1GERA 5HY5A 2B9WA 3T9PA 1EBHA 4Z44A 2QDEA 2BK3A 3P0WA 1ECQA 4Z26A 3QFBA 2QQ6A 4JY3A 4DSHA 2BCGG 4GYPC 2FJEA 4AOSA 2B9XA
chains in the Genus database with same CATH topology
2X8CA 4A65A 4NEVA 4NTCA 4NWZA 1FOHA 2XVFA 2YM1A 1M64A 5C2TA 2HQMA 5M10A 2E5VA 3II4A 3NHOX 4U2TA 1GRBA 5KMRA 3AEGA 4H4QA 1N4WA 3M12A 4XWZA 1KNPA 1Y56B 1BWCA 3ALMA 2CDUA 2YVJA 2EQ8A 2R45A 3FPZA 2XFQA 1CC6A 1NG3A 1PDHA 4NTEA 4WCTA 2WP6A 3AYIA 2BABA 1IUTA 5KMPA 4YKGA 1KDGA 4YTMA 1GALA 2BRYA 3I3LA 2DKHA 3F8RA 1GT8A 2XVJA 3RP6A 2VOUA 1ZMDA 2XFPA 3GWFA 2WOWA 4NEWA 2X8GA 3UOVA 1CJ2A 4G6GA 1LTXR 3CPJG 1JRXA 3SY4A 3NN0X 2BC0A 3P4SA 3AEFA 4EM3A 3K30A 4Z2RA 4JDRA 2NPXA 4AP3A 1B5QA 3AD8B 3NK2X 4JQ9A 2C75A 4EMJA 3DJEA 2YG4A 4UDRA 1EL9A 1PXCA 3CGEA 2C3DA 1CL0A 2WS3A 3DJDA 1OJCA 4ECHA 2WBAA 2XDOA 3AEBA 2OA1A 2XLUA 5CQFA 1MOKA 4EQRA 2A89A 2XYOA 3VQRA 3FG2P 2IVEA 3BHFA 4XXGA 3ATRA 4A7AA 3AD9B 1ZOVA 4J2WA 1N1PA 1P2EA 4J56A 2WP5A 3SQPA 3CMMA 1XDIA 3AE4A 3I6DA 4OPGA 2ZZBA 3S61A 1BKWA 3EAOA 4GAVA 3GYXA 4H2PA 2QCUA 3KKJA 4AT2A 1YKJA 2FJBA 2BS2A 5JCIA 1BGNA 5EBKA 1BZLA 1ZP0A 5EB4A 3L8KA 1L0VA 4EQWA 1REOA 3REDA 4Z2UA 2R9ZA 4APNA 1YY5A 1DXLA 4YSXA 3LXDA 4DNAA 1XANA 1H83A 2CFYA 1OJAA 2NVKX 4GDEA 2ARDA 2B7RA 1DODA 5ER0A 2ZZCA 2XFOA 4OPCA 1IUWA 1LQUA 3T31A 1MXTA 5HXIA 4IVMB 4H4ZA 4H4SA 2IIDA 3HYWA 3UOZA 1P2HA 1H81A 2GH5A 3EF6A 3EPTA 1O5WA 3M13A 3DJJA 4OPIA 4X4JA 4B1BA 5J60A 2E1MA 2TPRA 3IHMA 4II2A 2GQWA 3AYLA 4H7UA 4OPUA 3QSEA 1VQWA 1GNDA 5KXJA 3FMWA 3PVCA 2CULA 4E0VA 2ACZA 3LJPA 4CRTA 2WOIA 3BNMA 2WOVA 3T2ZA 2BCPA 3UKAA 2X8HA 1KFYA 3ABVA 2ZZ0A 2BS4A 3BI4A 2WP9A 3NN6X 4G73A 3UKKA 1Q9IA 2OALA 1H84A 3ZYXA 5IPYA 3LZXA 2E4GA 2OAMA 1YQ4A 4ICYA 2GAHB 1GTHA 1PN0A 3CIRA 3GDNA 2BS3A 3KA7A 4RSLA 5EOWA 5KNLA 4YSYA 1NDAA 1GEUA 3RP8A 3T2KA 1GOSA 1JNZA 1N4UA 4G74A 3M0OA 3ADAB 2V61A 4K5SA 1VG9A 1GETA 2Q0LA 4IA6A 2C4CA 2GMJA 3RNMA 1D4CA 4A9WA 1IUSA 2GEWA 3AE1A 3Q6JA 3KU9A 4K8DA 1CBOA 3DGHA 1GSNA 1D7LA 2FJDA 4YSZA 3NG7X 2X3NA 4C3YA 5EB5A 5BUKA 3AD7B 4B69A 3WE0A 4LIIA 3GSIA 1BF3A 4YSHA 1O95A 3O0HA 3NH3X 1K4QA 2C3CA 1LV0A 3UKHA 4Z43A 1XHCA 3UKLA 3PS9A 4GUVA 3IHGA 2VZ2A 1PJ5A 1ZDLA 1LQTA 4JN9A 3Q9TA 1PXBA 3CNPA 2YLTA 1VRQB 3B3RA 3LZWA 4U2LA 3T0KA 1FEBA 3D1CA 1MO9A 4C3XA 3CTYA 2C70A 2VVLA 4EQSA 3LOVA 3GRSA 1PBEA 4B66A 3IWAA 4AP1A 2EQ6A 3RHAA 1GRFA 2FBWA 3KLJA 3KPFA 1CHUA 2V60A 3ISHA 1FL2A 4A79A 3LADA 4WX1A 3T14A 1X31B 3VRAA 5C3JA 2JB3A 3UTEA 2XLTA 2R4JA 4CCQA 3GYIA 1EL8A 4U8KA 2YR4A 4HA6A 3GD4A 1KSUA 4CNKA 1VG0A 2R0PA 3C96A 1DJQA 1RYIA 3FBSA 2WQYA 2UZZA 3UTFA 4MJWA 2Y6QA 2JB2A 3SFDA 2YR5A 2XLPA 3IC9A 1UKVG 1EL7A 3KVEA 2AR8A 1EL5A 1GRAA 3ATQA 2BC1A 2V6OA 2YG7A 4U8MA 1NENA 2A87A 3C4AA 2WU2A 4GDPA 4PABA 3SYIA 4K7ZA 2TMDA 2PYXA 3GYJA 2YLWA 3BI2A 4RG3A 4A5LA 3GRTA 4I58A 3F8PA 3VRDB 2XFUA 3CPHG 3E1TA 4PAAA 4H4YA 4KPRA 3GDPA 1JRYA 3SZWA 3DGZA 3BHKA 5FS7A 4ADWA 1ZOYA 4BURA 2YLRA 4TLZA 5U63A 4C5OA 1JU2A 4EM4A 1S2QA 2Z5YA 2PHHA 3IF9A 2GR2A 2APGA 2WESA 3AE6A 1K0JA 4O5UA 2WDRA 4H4PA 4BK1A 1E1MA 3NT6A 4G6HA 4JY2A 2XVEA 4ZCCA 2BK5A 4J57A 3R9UA 3RP7A 1AOGA 4JNAA 2GRTA 1IUXA 1QO8A 4YXDA 1CJ4A 3SFEA 2WDQA 2EQ7A 5FMHA 1E39A 4U8OA 5J7XA 3V3OA 3H4KA 1EBDA 1DJNA 3AECA 1BGJA 2YM2A 2YG3A 1GV4A 4FX9A 1FCDA 1H86A 1LPFA 2R0CA 2JK6A 5GRTA 4BJYA 3NYEA 4EQXA 4U8LA 3OC4A 2JB1A 3DH9A 2F5ZA 2YWLA 1PBFA 4M52A 1CJ3A 2YLSA 3DK4A 4NZHA 1RSGA 2C66A 3CN8A 2WETA 3CPIG 4UP3A 2A8XA 2BA9A 1H7WA 4Y4MA 3CGBA 2BACA 3GD3A 3GWDA 5FS6A 1KF6A 5HYMA 1YQ3A 4DGKA 4U8IA 1TYTA 2VRMA 2RABA 4K5RA 5JCMA 4Y4LA 2EQ9A 2GV8A 2BXSA 1K0LA 4EIPA 4U8NA 4CY6A 1HYUA 3OZ2A 3QSMA 3NLCA 3PO7A 4B68A 3QVRA 4GRTA 2YG6A 1TDKA 3L1RA 4H2RA 1B8SA 2GR0A 3KD9A 4J36A 1H82A 4RG4A 4U8PA 1JNRA 1E1NA 1ONFA 2OLNA 4B64A 2BYBA 2XCGA 3UOXA 4USQA 2X99A 4GR1A 2VVLG 2V3AA 1XPQA 1GRHA 2B7SA 2Z5XA 4J33A 5GSNA 5L46A 4FDCB 1TDEA 3ICTA 4Z25A 1F8SA 3NTAA 3P4RA 5KVIA 4B67A 3NTDA 4YKFA 3H8IA 2C76A 3V3NA 4USRA 2GR1A 3NRNA 4U8JA 3SZFA 2R4EA 3NYFA 2C72A 1NG4A 3AB1A 5FS8A 1LVLA 2ZBWA 3DMEA 3NNEA 5LV9A 3K7TA 5KMSA 2VVMA 2YVFA 5JCKA 2BXRA 2C67A 1E1KA 1GREA 1PXAA 1S2YA 2XLSA 4IVOB 2J3NA 1CC4A 3D9XA 3CGDA 3NK1X 5BULA 1NPXA 4OVIA 1Z6LA 2Q0KA 4II3A 3SM8A 4AT0A 1H7XA 5IQ1A 3AEEA 1GPEA 4FK1C 4G9KA 3AE2A 1ZMCA 1V59A 2FJAA 1PHHA 1F8WA 1VDCA 3H8LA 4GCMA 4BJZA 1OJ9A 2WHDA 5JCNA 3AEAA 4U2SA 4CY8A 2GR3A 1NAAA 1Q1RA 3AE8A 4O5QA 3COXA 3P1WA 4C77A 1YQZA 4H4WA 4H4RA 4EMIA 3GMCA 1KN0A 1QLBA 1S3BA 1GXFA 3AE3A 3UKFA 4A99A 3AWIA 2CVJA 3SZCA 5KWFA 1PS9A 2GAGB 4UDPA 4OPDA 3P9UA 4JNQA 1K0IA 2V5ZA 3CNTA 3NK0X 5JRBA 4HB9A 3CNJA 4IA5A 3PG6A 4H4XA 1OJDA 3ALJA 4N9XA 3UKQA 4BK3A 1IUUA 2WPCA 4H4TA 4EMWA 1N4VA 1S3EA 2XVIA 3URHA 2JAEA 2RGOA 2RGJA 3HYVA 4K22A 4EIQA 2GMHA 2I0ZA 4TM3A 1TYPA 2O9ZA 4GAPA 3NKSA 2B9YA 2VQBA 1F8RA 1CC2A 2C65A 2X50A 2VRLA 4ZN0A 1DNCA 2R46A 1IUVA 3ITJA 1GRTA 2QA1A 2YQUA 5KOXA 2BRAA 4GF7A 4H50A 4KX6A 1M6IA 3QSSA 2IVDA 3ALLA 1ELIA 1TRBA 4UDQA 4OCGA 4IV9A 4A6NA 1NHQA 1CJCA 2RGHA 1JEHA 1ZY8A 2WPEA 4H4VA 1KSSA 4TM0A 5KMQA 3BI5A 4YT0A 3S5WA 4AOXA 3VR8A 4BK2A 3AE5A 2W0HA 1DOCA 1L9CA 1ZKQA 2YLZA 3F8DA 2YAUA 1F3PA 1ZK7A 1D4EA 1TDFA 2YG5A 1SEZA 2WEUA 2QAEA 3NIXA 2V3BA 2H89A 2B76A 2Q6UA 3GMBA 4YWOA 3NGCX 2Y6RA 4OPLA 3VRBA 5BRTA 4NTDA 3HYXA 2WU5A 3UTHA 3AE9A 2WDVA 4Y4NA 2JKCA 1H2IA 3C4NA 1FEAA 2XFNA 2AQJA 4ZCDA 1D4DA 3VR9A 3V76A 4LA1A 1NHRA 3CGCA 3UCLA 3DK8A 4TLXA 3CNDA 1PJ7A 3SXIA 3UP5A 4K2XA 3UP4A 5TR3A 3AE7A 4FK1A 3D8XA 3K7QX 1QJDA 1W4XA 1S7MA 2QA2A 3QJ4A 3SX6A 5FS9A 4TM4A 4D03A 2AAQA 3NYCA 3CNSA 1GESA 4OPTA 4Z2TA 1JOAA 1H6VA 2C7GA 4LU6A 3P4QA 5IQ4A 2GQFA 4XWRA 3DK9A 4B65A 3AXBA 5U25A 1Y56A 1IJHA 1F6MA 1Q1WA 4CBQA 3LB8A 1B4VA 3B6DA 3JSKA 4X9MA 3ICSA 3ICRA 4P9SA 1CF3A 2GB0A 5DBJA 5CKUA 1L9EA 4H4UA 3EANA 1D7YA 3DA1A 1E7PA 1RP0A 1E1LA 3UOYA 1GTEA 5JCLA 3UTGA 5M0ZA 2GF3A 3SGLA 3L5OA 1JRZA 2GVCA 1DOEA 3G5QA 3AEDA 1Y0PA 1PBBA 1KNRA 3DJGX 2DKIA 4Z24A 3SZ0A 3UKPA 2BK4A 1GRGA 2YR6A 4I59A 5U1OA 4BV6A 1PBDA 1NHSA 1PBCA 5KOWA 5KVHA 2C73A 1FECA 5HHFA 3QVPA 4REKA 1D5TA 4TM1A 4D04A 4A6NB 3G5SA 3QFAA 1PJ6A 3G5RA 2JBVA 3FIMB 2OLOA 1COYA 3T37A 2C64A 1LJ1A 1B37A 4C74A 4CNJA 3HZLA 1NEKA 1GERA 3P4PA 4B63A 5HY5A 2B9WA 5BVAA 3AYJA 1OJTA 2R0GA 1TDNA 4J31A 3BNUA 1DOBA 4H2NA 1ZX9A 2VQ7A 2YLXA 4Z44A 3ZDNA 2YVGA 4CCRA 4YTPA 2H88A 3KPKA 3T2YA 3K7MX 2WPFA 2BK3A 4J34A 1TDOA 4Z26A 3QFBA 2XVHA 1L9DA 1NHPA 5KRQA 4JY3A 4DSHA 2BCGG 2FJEA 2XLRA 4NNJA 4DSGA 2Q7VA 4YTNA 1O94A 1E6EA 4H2QA 4X9NA 4AOSA 2B9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X8C A;  4A65 A;  4NEV A;  4NTC A;  5C2T A;  1FOH A;  2XVF A;  2YM1 A;  1M64 A;  5M10 A;  2HQM A;  2E5V A;  3II4 A;  3NHO X;  4U2T A;  1GRB A;  3AEG A;  4H4Q A;  1N4W A;  3M12 A;  4XWZ A;  1KNP A;  1Y56 B;  1BWC A;  3ALM A;  2CDU A;  2YVJ A;  2EQ8 A;  2R45 A;  3FPZ A;  2XFQ A;  1CC6 A;  1NG3 A;  1PDH A;  4NTE A;  4WCT A;  2WP6 A;  3AYI A;  2BAB A;  1IUT A;  4YKG A;  1KDG A;  4YTM A;  1GAL A;  3I3L A;  2DKH A;  3F8R A;  1GT8 A;  2XVJ A;  3RP6 A;  2VOU A;  1ZMD A;  2XFP A;  3GWF A;  2WOW A;  4NEW A;  2X8G A;  3UOV A;  1CJ2 A;  1LTX R;  3CPJ G;  1JRX A;  3NN0 X;  2BC0 A;  3P4S A;  3AEF A;  4EM3 A;  3K30 A;  4Z2R A;  4JDR A;  2NPX A;  4AP3 A;  1B5Q A;  3AD8 B;  3NK2 X;  4JQ9 A;  2C75 A;  4EMJ A;  3DJE A;  2YG4 A;  4UDR A;  1EL9 A;  1PXC A;  3CGE A;  2C3D A;  1CL0 A;  2WS3 A;  3DJD A;  1OJC A;  4ECH A;  2WBA A;  2XDO A;  3AEB A;  2OA1 A;  2XLU A;  5CQF A;  1MOK A;  4EQR A;  2A89 A;  2XYO A;  3VQR A;  3FG2 P;  2IVE A;  3BHF A;  4XXG A;  3ATR A;  4A7A A;  3AD9 B;  1ZOV A;  4J2W A;  1N1P A;  1P2E A;  4J56 A;  2WP5 A;  3SQP A;  3I6D A;  1XDI A;  3AE4 A;  4OPG A;  3S61 A;  2ZZB A;  1BKW A;  3EAO A;  4H2P A;  2QCU A;  3KKJ A;  4AT2 A;  1YKJ A;  2FJB A;  2BS2 A;  1BGN A;  5EBK A;  5JCI A;  1BZL A;  1ZP0 A;  5EB4 A;  3L8K A;  1L0V A;  4EQW A;  1REO A;  3RED A;  4Z2U A;  2R9Z A;  4APN A;  1YY5 A;  1DXL A;  4YSX A;  3LXD A;  4DNA A;  1XAN A;  1H83 A;  2CFY A;  1OJA A;  2NVK X;  4GDE A;  2ARD A;  2B7R A;  1DOD A;  5ER0 A;  2ZZC A;  2XFO A;  4OPC A;  1IUW A;  1LQU A;  5HXI A;  1MXT A;  4IVM B;  4H4Z A;  4H4S A;  2IID A;  3UOZ A;  1P2H A;  1H81 A;  2GH5 A;  3EF6 A;  3EPT A;  1O5W A;  3M13 A;  3DJJ A;  4OPI A;  4X4J A;  4B1B A;  5J60 A;  2E1M A;  2TPR A;  3IHM A;  2GQW A;  3AYL A;  4H7U A;  4OPU A;  3QSE A;  1VQW A;  1GND A;  5KXJ A;  3FMW A;  3PVC A;  2CUL A;  4E0V A;  2ACZ A;  3LJP A;  4CRT A;  2WOI A;  3BNM A;  2WOV A;  2BCP A;  3UKA A;  2X8H A;  1KFY A;  3ABV A;  2ZZ0 A;  2BS4 A;  3BI4 A;  2WP9 A;  3NN6 X;  3UKK A;  1Q9I A;  2OAL A;  1H84 A;  3ZYX A;  5IPY A;  3LZX A;  2E4G A;  2OAM A;  1YQ4 A;  4ICY A;  2GAH B;  1GTH A;  1PN0 A;  3CIR A;  3GDN A;  2BS3 A;  3KA7 A;  4RSL A;  5EOW A;  4YSY A;  1NDA A;  1GEU A;  3RP8 A;  1GOS A;  1JNZ A;  1N4U A;  3M0O A;  3ADA B;  2V61 A;  4K5S A;  1VG9 A;  1GET A;  2Q0L A;  4IA6 A;  2GMJ A;  3RNM A;  1D4C A;  4A9W A;  1IUS A;  2GEW A;  3AE1 A;  3Q6J A;  3KU9 A;  4K8D A;  1CBO A;  3DGH A;  1GSN A;  1D7L A;  2FJD A;  4YSZ A;  3NG7 X;  2X3N A;  4C3Y A;  5EB5 A;  5BUK A;  3AD7 B;  4B69 A;  3WE0 A;  4LII A;  3GSI A;  1BF3 A;  4YSH A;  1O95 A;  3O0H A;  3NH3 X;  1K4Q A;  2C3C A;  1LV0 A;  3UKH A;  4Z43 A;  1XHC A;  3UKL A;  3PS9 A;  4GUV A;  3IHG A;  2VZ2 A;  1PJ5 A;  1ZDL A;  1LQT A;  4JN9 A;  3Q9T A;  1PXB A;  3CNP A;  2YLT A;  1VRQ B;  3B3R A;  3LZW A;  4U2L A;  1FEB A;  3D1C A;  1MO9 A;  4C3X A;  3CTY A;  2C70 A;  2VVL A;  4EQS A;  3LOV A;  3GRS A;  1PBE A;  4B66 A;  3IWA A;  4AP1 A;  2EQ6 A;  3RHA A;  1GRF A;  2FBW A;  3KLJ A;  3KPF A;  1CHU A;  2V60 A;  3ISH A;  1FL2 A;  4A79 A;  3LAD A;  4WX1 A;  3VRA A;  1X31 B;  5C3J A;  2JB3 A;  3UTE A;  2XLT A;  2R4J A;  4CCQ A;  3GYI A;  1EL8 A;  4U8K A;  2YR4 A;  4HA6 A;  3GD4 A;  1KSU A;  4CNK A;  1VG0 A;  2R0P A;  3C96 A;  1DJQ A;  1RYI A;  3FBS A;  2WQY A;  2UZZ A;  3UTF A;  4MJW A;  2Y6Q A;  2JB2 A;  3SFD A;  2YR5 A;  2XLP A;  3IC9 A;  1UKV G;  1EL7 A;  3KVE A;  2AR8 A;  1EL5 A;  1GRA A;  3ATQ A;  2BC1 A;  2V6O A;  2YG7 A;  4U8M A;  1NEN A;  2A87 A;  3C4A A;  2WU2 A;  4GDP A;  4PAB A;  4K7Z A;  2TMD A;  2PYX A;  3GYJ A;  2YLW A;  3BI2 A;  4RG3 A;  4A5L A;  3GRT A;  4I58 A;  3F8P A;  3VRD B;  2XFU A;  3CPH G;  3E1T A;  4PAA A;  4H4Y A;  4KPR A;  3GDP A;  1JRY A;  3DGZ A;  3BHK A;  5FS7 A;  4ADW A;  1ZOY A;  4BUR A;  2YLR A;  4TLZ A;  5U63 A;  4C5O A;  1JU2 A;  4EM4 A;  1S2Q A;  2Z5Y A;  2PHH A;  3IF9 A;  2GR2 A;  2APG A;  2WES A;  3AE6 A;  1K0J A;  4O5U A;  2WDR A;  4H4P A;  4BK1 A;  1E1M A;  3NT6 A;  4JY2 A;  4ZCC A;  2XVE A;  2BK5 A;  4J57 A;  3R9U A;  3RP7 A;  1AOG A;  4JNA A;  2GRT A;  1IUX A;  1QO8 A;  4YXD A;  1CJ4 A;  3SFE A;  2WDQ A;  2EQ7 A;  5FMH A;  1E39 A;  4U8O A;  5J7X A;  3V3O A;  3H4K A;  1EBD A;  1DJN A;  3AEC A;  1BGJ A;  2YM2 A;  2YG3 A;  1GV4 A;  4FX9 A;  1FCD A;  1H86 A;  1LPF A;  2R0C A;  2JK6 A;  5GRT A;  4BJY A;  3NYE A;  4EQX A;  4U8L A;  3OC4 A;  2JB1 A;  3DH9 A;  2F5Z A;  2YWL A;  1PBF A;  4M52 A;  1CJ3 A;  2YLS A;  3DK4 A;  4NZH A;  1RSG A;  2C66 A;  3CN8 A;  2WET A;  3CPI G;  4UP3 A;  2A8X A;  2BA9 A;  1H7W A;  4Y4M A;  3CGB A;  2BAC A;  3GD3 A;  3GWD A;  5FS6 A;  1KF6 A;  5HYM A;  1YQ3 A;  4DGK A;  4U8I A;  1TYT A;  2VRM A;  2RAB A;  4K5R A;  5JCM A;  4Y4L A;  2EQ9 A;  2GV8 A;  2BXS A;  1K0L A;  4EIP A;  4U8N A;  4CY6 A;  1HYU A;  3OZ2 A;  3QSM A;  3NLC A;  3PO7 A;  4B68 A;  3QVR A;  4GRT A;  2YG6 A;  1TDK A;  3L1R A;  4H2R A;  1B8S A;  2GR0 A;  3KD9 A;  4J36 A;  1H82 A;  4RG4 A;  4U8P A;  1JNR A;  1E1N A;  1ONF A;  2OLN A;  4B64 A;  2BYB A;  2XCG A;  3UOX A;  4USQ A;  2X99 A;  4GR1 A;  2VVL G;  2V3A A;  1XPQ A;  1GRH A;  2B7S A;  2Z5X A;  4J33 A;  5GSN A;  5L46 A;  4FDC B;  1TDE A;  3ICT A;  4Z25 A;  1F8S A;  3NTA A;  3P4R A;  5KVI A;  4B67 A;  3NTD A;  4YKF A;  3H8I A;  2C76 A;  3V3N A;  4USR A;  2GR1 A;  3NRN A;  4U8J A;  2R4E A;  3NYF A;  2C72 A;  1NG4 A;  3AB1 A;  5FS8 A;  1LVL A;  2ZBW A;  3DME A;  3NNE A;  5LV9 A;  3K7T A;  2VVM A;  2YVF A;  5JCK A;  2BXR A;  2C67 A;  1E1K A;  1GRE A;  1PXA A;  1S2Y A;  2XLS A;  4IVO B;  2J3N A;  1CC4 A;  3CGD A;  3NK1 X;  5BUL A;  1NPX A;  4OVI A;  1Z6L A;  2Q0K A;  3SM8 A;  4AT0 A;  1H7X A;  5IQ1 A;  3AEE A;  1GPE A;  4FK1 C;  3AE2 A;  1ZMC A;  1V59 A;  2FJA A;  1PHH A;  1F8W A;  1VDC A;  3H8L A;  4GCM A;  4BJZ A;  1OJ9 A;  2WHD A;  5JCN A;  3AEA A;  4U2S A;  4CY8 A;  2GR3 A;  1NAA A;  1Q1R A;  3AE8 A;  4O5Q A;  3COX A;  3P1W A;  4C77 A;  1YQZ A;  4H4W A;  4H4R A;  4EMI A;  3GMC A;  1QLB A;  1S3B A;  1GXF A;  3AE3 A;  3UKF A;  4A99 A;  3AWI A;  2CVJ A;  5KWF A;  1PS9 A;  2GAG B;  4UDP A;  4OPD A;  3P9U A;  4JNQ A;  1K0I A;  2V5Z A;  3CNT A;  3NK0 X;  4HB9 A;  3CNJ A;  4IA5 A;  4H4X A;  1OJD A;  3ALJ A;  4N9X A;  3UKQ A;  4BK3 A;  1IUU A;  2WPC A;  4H4T A;  4EMW A;  1N4V A;  1S3E A;  2XVI A;  3URH A;  2JAE A;  2RGO A;  2RGJ A;  4K22 A;  4EIQ A;  2GMH A;  2I0Z A;  4TM3 A;  1TYP A;  2O9Z A;  3NKS A;  2B9Y A;  2VQB A;  1F8R A;  1CC2 A;  2C65 A;  2X50 A;  2VRL A;  4ZN0 A;  1DNC A;  2R46 A;  1IUV A;  3ITJ A;  1GRT A;  2QA1 A;  2YQU A;  5KOX A;  4GF7 A;  4H50 A;  4KX6 A;  1M6I A;  3QSS A;  2IVD A;  3ALL A;  1ELI A;  1TRB A;  4UDQ A;  4OCG A;  4IV9 A;  4A6N A;  1NHQ A;  1CJC A;  2RGH A;  1JEH A;  1ZY8 A;  2WPE A;  4H4V A;  1KSS A;  4TM0 A;  4YT0 A;  3BI5 A;  3S5W A;  4AOX A;  3VR8 A;  4BK2 A;  3AE5 A;  2W0H A;  1DOC A;  1L9C A;  1ZKQ A;  2YLZ A;  3F8D A;  2YAU A;  1F3P A;  1ZK7 A;  1D4E A;  1TDF A;  2YG5 A;  1SEZ A;  2WEU A;  2QAE A;  3NIX A;  2H89 A;  2V3B A;  2B76 A;  2Q6U A;  3GMB A;  4YWO A;  3NGC X;  2Y6R A;  4OPL A;  3VRB A;  5BRT A;  4NTD A;  2WU5 A;  3UTH A;  3AE9 A;  2WDV A;  4Y4N A;  2JKC A;  3C4N A;  1FEA A;  2XFN A;  2AQJ A;  4ZCD A;  1D4D A;  3VR9 A;  3V76 A;  4LA1 A;  1NHR A;  3CGC A;  3UCL A;  3DK8 A;  4TLX A;  3CND A;  1PJ7 A;  3UP5 A;  4K2X A;  3UP4 A;  5TR3 A;  3AE7 A;  4FK1 A;  3D8X A;  3K7Q X;  1QJD A;  1W4X A;  2QA2 A;  3QJ4 A;  5FS9 A;  4TM4 A;  4D03 A;  2AAQ A;  3NYC A;  3CNS A;  1GES A;  4OPT A;  4Z2T A;  1JOA A;  1H6V A;  2C7G A;  4LU6 A;  3P4Q A;  5IQ4 A;  2GQF A;  4XWR A;  3DK9 A;  4B65 A;  3AXB A;  5U25 A;  1Y56 A;  1IJH A;  1F6M A;  1Q1W A;  4CBQ A;  3LB8 A;  1B4V A;  3B6D A;  3JSK A;  4X9M A;  3ICS A;  3ICR A;  4P9S A;  1CF3 A;  2GB0 A;  5DBJ A;  5CKU A;  1L9E A;  4H4U A;  3EAN A;  1D7Y A;  3DA1 A;  1E7P A;  1RP0 A;  1E1L A;  3UOY A;  1GTE A;  5JCL A;  3UTG A;  5M0Z A;  2GF3 A;  3SGL A;  1JRZ A;  2GVC A;  1DOE A;  3G5Q A;  3AED A;  1Y0P A;  1PBB A;  1KNR A;  3DJG X;  2DKI A;  4Z24 A;  3UKP A;  2BK4 A;  1GRG A;  2YR6 A;  4I59 A;  5U1O A;  4BV6 A;  1PBD A;  1NHS A;  1PBC A;  5KOW A;  5KVH A;  2C73 A;  1FEC A;  5HHF A;  3QVP A;  4REK A;  1D5T A;  4TM1 A;  4D04 A;  4A6N B;  3G5S A;  3QFA A;  1PJ6 A;  3G5R A;  2JBV A;  3FIM B;  2OLO A;  1COY A;  3T37 A;  2C64 A;  1LJ1 A;  1B37 A;  4C74 A;  4CNJ A;  3HZL A;  1NEK A;  1GER A;  3P4P A;  4B63 A;  5HY5 A;  2B9W A;  5BVA A;  3AYJ A;  1OJT A;  2R0G A;  1TDN A;  4J31 A;  3BNU A;  1DOB A;  4H2N A;  1ZX9 A;  2VQ7 A;  2YLX A;  4Z44 A;  3ZDN A;  2YVG A;  4CCR A;  4YTP A;  2H88 A;  3K7M X;  2WPF A;  2BK3 A;  4J34 A;  1TDO A;  4Z26 A;  3QFB A;  2XVH A;  1L9D A;  1NHP A;  5KRQ A;  4JY3 A;  4DSH A;  2BCG G;  2FJE A;  2XLR A;  4DSG A;  2Q7V A;  4YTN A;  1O94 A;  1E6E A;  4H2Q A;  4X9N A;  4AOS A;  2B9X A; 
#chains in the Genus database with same CATH topology
 2X8C A;  2HQM A;  4H4Q A;  1N4W A;  1BWC A;  2CDU A;  1PDY A;  2EQ8 A;  4TVY A;  2R45 A;  1L8P A;  2WP6 A;  2BAB A;  1IUT A;  5KMP A;  5ENL A;  3U4F A;  2OPJ A;  2WOW A;  1LTX R;  4YWS A;  3NN0 X;  2BC0 A;  4EM3 A;  3K30 A;  3TJ4 A;  4AP3 A;  1FFU C;  1RVK A;  1CL0 A;  3MZN A;  2WBA A;  1MOK A;  4EQR A;  3VQR A;  2IVE A;  4H83 A;  3ATR A;  3CMM A;  3AE4 A;  4GAV A;  2QCU A;  3RCY A;  3UJ2 A;  1YKJ A;  5EB4 A;  3NVW B;  4EQW A;  4APN A;  1YY5 A;  3CYJ A;  4GYP A;  4DN1 A;  3RGT A;  2AL2 A;  1OJA A;  4GDE A;  2XFO A;  3SN4 A;  3M13 A;  3DJJ A;  4FI4 A;  4B1B A;  2E1M A;  4OPU A;  3QSE A;  1VQW A;  4EWJ A;  2CUL A;  2WOI A;  3PWG A;  2WOV A;  3T2Z A;  2X8H A;  1KFY A;  2ZZ0 A;  3U9I A;  2E4G A;  4YKG A;  3CIR A;  2XH2 A;  4K5S A;  4DXK A;  2C4C A;  3RNM A;  3H70 A;  4DWD A;  3GO2 A;  1MRA A;  1CBO A;  2FJD A;  3NG7 X;  2X3N A;  5EB5 A;  3ZVI A;  1BF3 A;  1K4Q A;  3V3W A;  4ZOH B;  4GUV A;  1PJ5 A;  2P8B A;  1PXB A;  1VRQ B;  2XSX A;  1MO9 A;  1PBE A;  3RHA A;  2AKZ A;  1GRF A;  3T8Q A;  3CB3 A;  4A79 A;  2R4J A;  1EL8 A;  3FBS A;  2UZZ A;  2JB2 A;  2YR5 A;  2XLP A;  3IC9 A;  1UKV G;  1EL7 A;  2AR8 A;  1EL5 A;  2PP1 A;  2V6O A;  4KT2 A;  2YG7 A;  4U8M A;  2A87 A;  4K7Z A;  4I58 A;  3CPH G;  3E1T A;  4PAA A;  4KWS A;  4KPR A;  3SN1 A;  1ZOY A;  3OZY A;  3IF9 A;  2Z5Y A;  2PHH A;  4HYR A;  2APG A;  1SJB A;  3DFY A;  2XVE A;  4JNA A;  1IUX A;  3VCC A;  3V3O A;  1EBD A;  2YM2 A;  2YG3 A;  1GV4 A;  1H86 A;  2JK6 A;  4BJY A;  4EQX A;  4U8L A;  2YLS A;  2C66 A;  3DDM A;  3I6E A;  2BA9 A;  3CGB A;  3CAW A;  2BAC A;  3GD3 A;  3NRZ B;  3QN3 A;  1YQ3 A;  2VRM A;  3AMZ A;  2EQ9 A;  4U8N A;  3GC2 A;  3PO7 A;  1PDZ A;  1XPY A;  3L1R A;  4J36 A;  1H82 A;  3DFH A;  1E1N A;  3UOX A;  1TE6 A;  2VVL G;  3SBF A;  5GSN A;  2PTY A;  1TDE A;  2C76 A;  1NG4 A;  3DME A;  2XH0 A;  3K7T A;  2BXR A;  1E1K A;  2J3N A;  2Q0K A;  4II3 A;  3TCS A;  4AT0 A;  2PS2 A;  4FK1 C;  4JHM A;  3AE2 A;  1ZMC A;  1V59 A;  1OJ9 A;  4U2S A;  3BJS A;  3KUM A;  3COX A;  4C77 A;  3A7A A;  1YQZ A;  4EMI A;  3GMC A;  1GXF A;  4OPD A;  5JRB A;  3CNJ A;  4IA5 A;  3PG6 A;  4N9X A;  1N4V A;  3R07 C;  3URH A;  3ES7 A;  2GMH A;  2I0Z A;  4GAP A;  2B9Y A;  2C65 A;  2R46 A;  1IUV A;  3ITJ A;  1GRT A;  4ZA0 A;  2OX4 A;  4KX6 A;  2AKM A;  4IV9 A;  1NHQ A;  3UGV A;  2RGH A;  1ZY8 A;  5FJR A;  3S5W A;  1FO4 A;  1DOC A;  3TWB A;  3F8D A;  1F3P A;  2QGY A;  3OP2 A;  3GMB A;  4YWO A;  4OPL A;  4HN8 A;  4NTD A;  3AE9 A;  1JRP A;  2JKC A;  3NVY B;  3C4N A;  4ZCD A;  3H12 A;  1D4D A;  3UCL A;  3SXI A;  3UP5 A;  4K2X A;  5TR3 A;  3AE7 A;  4FK1 A;  3K7Q X;  1QJD A;  2QA2 A;  2PTX A;  2W3R A;  5FS9 A;  1WUE A;  2PU0 A;  1H6V A;  2C7G A;  5BOE A;  4CBQ A;  3LB8 A;  1B4V A;  3JSK A;  4X9M A;  4HPN A;  1CF3 A;  1E7P A;  3DEQ A;  3SGL A;  1JRZ A;  1DOE A;  3Q45 A;  2DKI A;  3SZ0 A;  3NVZ B;  2BK4 A;  1GRG A;  4HCD A;  1FEC A;  3N6J A;  3QFA A;  1PJ6 A;  3G5R A;  3ES8 A;  2HXT A;  3HZL A;  3MKC A;  3V4B A;  3VC5 A;  1TDN A;  3N6H A;  3ZDN A;  3A7U A;  4YTP A;  3UJF A;  6ENL A;  2NQL A;  2OG9 A;  3OZM A;  4K1W A;  4NNJ A;  4YTN A;  1E6E A;  2I5Q A;  5M10 A;  1FOH A;  2YM1 A;  3II4 A;  1GRB A;  2GDQ A;  3AEG A;  4HCH A;  1N5W C;  1KNP A;  1Y56 B;  3ALM A;  2XFQ A;  1CC6 A;  4E5T A;  2OKT A;  4WCT A;  3VC6 A;  1GAL A;  2HXU A;  2BRY A;  3I3L A;  2DKH A;  3F8R A;  1GT8 A;  3RP6 A;  2VOU A;  4JN8 A;  1R0M A;  4NEW A;  2X8G A;  3NFU A;  4G6G A;  4Z2R A;  4JDR A;  4JQ9 A;  2C75 A;  1MUC A;  3MUC A;  4ECH A;  3AEB A;  2XLU A;  5CQF A;  2PSN A;  2A89 A;  3BOX A;  4A35 A;  3GD6 A;  1N1P A;  1MDR A;  3I6D A;  2PP3 A;  2PGE A;  2BS2 A;  1BZL A;  3RED A;  2R9Z A;  1DXL A;  4DNA A;  1H83 A;  2CFY A;  2NVK X;  3T31 A;  1IUW A;  3HYW A;  3UOZ A;  1H81 A;  3Q4D A;  3EPT A;  3DG6 A;  4OPI A;  4X4J A;  4H7U A;  3FMW A;  4E0V A;  3LJP A;  3UJE A;  4CRT A;  4G8T A;  2BCP A;  3UKA A;  2BS4 A;  2WP9 A;  3UKK A;  3ZYX A;  3LZX A;  4U8J A;  2GAH B;  1GTH A;  5EOW A;  1NDA A;  1GEU A;  1GOS A;  1N4U A;  3SSZ A;  3JW7 A;  3I6T A;  2V61 A;  3NXL A;  1IUS A;  3AE1 A;  3SR6 B;  3Q6J A;  3DGH A;  4YSZ A;  3WE0 A;  4LII A;  3R10 A;  3NH3 X;  2C3C A;  4GME A;  3UKL A;  3HPF A;  3SQS A;  2VZ2 A;  1ZDL A;  1LQT A;  3Q9T A;  2YLT A;  5BOF A;  2E5A A;  3D1C A;  4C3X A;  3A7R A;  2VVL A;  3LOV A;  3GRS A;  1CHU A;  2V60 A;  1FL2 A;  3UCC A;  3FVD A;  3LAD A;  2OLA A;  2XLT A;  3GYI A;  4HA6 A;  5G5H B;  1IYX A;  1DJQ A;  5EU9 A;  2Y6Q A;  3VCN A;  3FJ4 A;  1EC9 A;  2BC1 A;  1NEN A;  3THU A;  3C4A A;  4E4U A;  3BSM A;  3GYJ A;  1X2H A;  4A5L A;  4H4Y A;  4HNL A;  3GDP A;  4BUR A;  1K0J A;  1TZZ A;  2WDR A;  4JY2 A;  3V5C A;  4J57 A;  3R9U A;  3SFE A;  1E39 A;  5J7X A;  3H8A A;  5FJO A;  3UCD A;  1SB3 B;  1LPF A;  5GRT A;  2F5Z A;  3ZLH A;  1CJ3 A;  4IT1 A;  3DK4 A;  1RSG A;  3CN8 A;  2A8X A;  1YEY A;  3GWD A;  3R11 A;  1KF6 A;  3QKE A;  4DGK A;  2DW6 A;  1DTN A;  4K5R A;  1K0L A;  4EIP A;  4CY6 A;  3QSM A;  3QVR A;  1B8S A;  2GR0 A;  4RG4 A;  1JNR A;  3RIT A;  1ONF A;  2OLN A;  2BYB A;  4USQ A;  2X99 A;  1GRH A;  5L46 A;  4FDC B;  4Z1Y A;  1F8S A;  4B67 A;  4USR A;  3NRN A;  2C72 A;  1LVL A;  5KMS A;  2VVM A;  2YVF A;  1JCT A;  1GRE A;  2P88 A;  1NPX A;  4OVI A;  1Z6L A;  3SM8 A;  1H7X A;  3H8L A;  1PHH A;  1VDC A;  4BJZ A;  2WHD A;  5JCN A;  3AEA A;  2GR3 A;  3VFC A;  1S3B A;  3AE3 A;  4A99 A;  3SZC A;  2GAG B;  4FP1 A;  1TKK A;  3P9U A;  1K0I A;  3T2K A;  2DW7 A;  3UKQ A;  2QJM A;  2GL5 A;  1TYP A;  4ZCW A;  2VRL A;  4ZN0 A;  2GSH A;  4GF7 A;  1M6I A;  3SN0 A;  2ZC8 A;  1ELI A;  4UDQ A;  4OCG A;  3VDG A;  1R6W A;  1N61 C;  3BI5 A;  4BK2 A;  4AOX A;  2W0H A;  3PFR A;  1ZKQ A;  1ZK7 A;  1TDF A;  1SEZ A;  3NIX A;  2H89 A;  2B76 A;  3NGC X;  3VRB A;  3HYX A;  4K8G A;  1H2I A;  2QVH A;  2ZAD A;  2XFN A;  3VR9 A;  3V76 A;  4LA1 A;  2O56 A;  3CGC A;  3PK7 A;  1T3Q C;  3SX6 A;  5J04 A;  3R0K A;  1F9C A;  3NYC A;  3CNS A;  4LU6 A;  5IQ4 A;  4XWR A;  3DK9 A;  5FJT A;  1X2G A;  4B65 A;  4IL2 A;  5U25 A;  2POD A;  1Y56 A;  1IJH A;  3B6D A;  3R1Z A;  2PMQ A;  3ENL A;  1L9E A;  3EAN A;  4DYE A;  3MQT A;  1RP0 A;  1E1L A;  5JCL A;  5M0Z A;  2GF3 A;  3L5O A;  1ZXI C;  1ELS A;  2YR6 A;  1RM6 B;  5KOW A;  2P8C A;  4E8G A;  3QVP A;  4REK A;  1D5T A;  4TM1 A;  4D04 A;  4A6N B;  2JBV A;  3H7V A;  2OLO A;  1B37 A;  2W54 A;  4CNJ A;  1NEK A;  5BVA A;  1OJT A;  2QJN A;  1ONE A;  3BNU A;  1DOB A;  1ZX9 A;  2VQ7 A;  2YVG A;  4CCR A;  2H88 A;  2WPF A;  1SJC A;  1NHP A;  5KRQ A;  1EBG A;  3SJN A;  2XLR A;  4J3Z A;  4DSG A;  1O94 A;  3DG3 A;  3EUB 3;  4NTC A;  1M64 A;  3NHO X;  5KMR A;  4HNC A;  3R0U A;  1E9I A;  4XWZ A;  2YVJ A;  3FPZ A;  1NG3 A;  1PDH A;  4NTE A;  1KDG A;  4YTM A;  1JPD X;  2XVJ A;  3NZG A;  3TOY A;  5G5G B;  4HCL A;  1ZMD A;  2XFP A;  3UOV A;  1CJ2 A;  3P3B A;  3SY4 A;  3P4S A;  3AEF A;  2NPX A;  1B5Q A;  3NK2 X;  3DJE A;  4UDR A;  2WS3 A;  2OA1 A;  3FG2 P;  1ZOV A;  1P2E A;  4J56 A;  3SQP A;  1XDI A;  3S61 A;  2PCE A;  1BKW A;  4DHG A;  2FJB A;  2W55 A;  5EBK A;  1ZP0 A;  3DG7 A;  3L8K A;  4ROP A;  7ENL A;  1DOD A;  1LQU A;  4H4Z A;  4H4S A;  2IID A;  3JZU A;  1P2H A;  2GH5 A;  2TPR A;  3ZLG A;  4II2 A;  3AYL A;  5KXJ A;  1GND A;  2ACZ A;  3BNM A;  1Q9I A;  3R25 A;  4ICY A;  4RSL A;  1PN0 A;  3GDN A;  4YSY A;  3EKG A;  3RP8 A;  3M0O A;  4IA6 A;  2GMJ A;  1D4C A;  3FV9 A;  3MWC A;  3DGB A;  4C3Y A;  3B9J B;  3AD7 B;  4Z43 A;  1P48 A;  3IHG A;  4G7F A;  4JN9 A;  2FKP A;  3CNP A;  4U2L A;  3T0K A;  1FEB A;  2C70 A;  4B66 A;  3IWA A;  2EQ6 A;  3KPF A;  3UTE A;  4U8K A;  2YR4 A;  2PA6 A;  1KSU A;  1VG0 A;  4CNK A;  2R0P A;  3C96 A;  4MJW A;  3SFD A;  3KVE A;  2OZT A;  3ATQ A;  3I4K A;  3DIP A;  3UXK A;  2WU2 A;  4PAB A;  3SYI A;  1XS2 A;  2TMD A;  2PYX A;  4JN7 A;  3S5S A;  3BI2 A;  4RG3 A;  3GRT A;  1NU5 A;  3F8P A;  2GGI A;  3K1G A;  1JRY A;  5FS7 A;  4ADW A;  1BKH A;  5U63 A;  4C5O A;  1KKO A;  2GR2 A;  2WES A;  2QJJ A;  4BK1 A;  3NT6 A;  4ZCC A;  3RP7 A;  4Z17 A;  1QO8 A;  4YXD A;  2EQ7 A;  4U8O A;  3CT2 A;  4GGB A;  2XH7 A;  1DJN A;  3AEC A;  1BGJ A;  3IJL A;  2HNE A;  4FX9 A;  2AL1 A;  2JB1 A;  2YWL A;  2WET A;  4UP3 A;  1H7W A;  5HYM A;  3RR1 A;  4U8I A;  2RAB A;  1VDV A;  5JCM A;  2PTW A;  2BXS A;  3GY1 A;  1HYU A;  3NLC A;  4GRT A;  3FXG A;  4H2H A;  2YG6 A;  4H2R A;  3KD9 A;  4U8P A;  4B64 A;  3MY9 A;  4GR1 A;  2V3A A;  3TQP A;  4Z25 A;  3ICT A;  3NTA A;  3NTD A;  3H8I A;  2GR1 A;  4MGG A;  3AB1 A;  5FS8 A;  3NNE A;  5LV9 A;  2OO6 A;  2XLS A;  4IVO B;  2FYM A;  1CC4 A;  3CGD A;  3NK1 X;  5BUL A;  5IQ1 A;  1GPE A;  2FJA A;  4GCM A;  1F8W A;  4H19 A;  4GFI A;  1W6T A;  4H4R A;  1KN0 A;  3UKF A;  5KWF A;  1PS9 A;  4UDP A;  4JNQ A;  3NK0 X;  4H4X A;  3ALJ A;  4EMW A;  2XVI A;  4M6U A;  2RGO A;  2RGJ A;  3HYV A;  4K22 A;  4EIQ A;  2MUC A;  4TM3 A;  3NKS A;  1F8R A;  2X50 A;  1DNC A;  2QA1 A;  2YQU A;  4H50 A;  3QSS A;  1JDF A;  4GGH A;  3ALL A;  4A6N A;  1CJC A;  1JEH A;  4H4V A;  2WPE A;  5KMQ A;  3VR8 A;  1SJD A;  3AE5 A;  1V97 A;  1D4E A;  2YG5 A;  2GGJ A;  2WEU A;  2QAE A;  2XGZ A;  3ZLF A;  2Q6U A;  5BRT A;  3IJI A;  2WU5 A;  3UTH A;  4Y4N A;  2W3S A;  4GIS A;  1N63 C;  1SJA A;  4TLX A;  3UP4 A;  1OEP A;  1S7M A;  3TWA A;  3QJ4 A;  4TM4 A;  4D03 A;  4OPT A;  4A6G A;  3P4Q A;  5FJU A;  3AXB A;  2PP0 A;  1F6M A;  3ICS A;  3N4F A;  1D7Y A;  1GTE A;  3UTG A;  1N60 C;  1FIQ B;  2GVC A;  3G5Q A;  2GGH A;  1Y0P A;  1PBB A;  4DX3 A;  4I59 A;  4BV6 A;  1PBD A;  1PBC A;  5KVH A;  2C73 A;  5HHF A;  2PTZ A;  3G5S A;  3FIM B;  3QTP A;  1COY A;  3T37 A;  4C74 A;  4TVW A;  3ZVH B;  3P4P A;  4B63 A;  2OZ3 A;  3AYJ A;  2R0G A;  4J31 A;  3FYY A;  4H2N A;  1MNS A;  2YLX A;  3KPK A;  3T2Y A;  3K7M X;  1FHU A;  4J34 A;  1TDO A;  2XVH A;  1L9D A;  3PWI A;  3VA8 A;  2Q7V A;  4H2Q A;  4X9N A;  4A65 A;  4NEV A;  5C2T A;  4NWZ A;  2XVF A;  2E5V A;  4U2T A;  4H1Z A;  3M12 A;  2OQY A;  2MNR A;  4IZG A;  3UJS A;  3AYI A;  3T6C A;  1MDL A;  3TW9 A;  3NS1 B;  3UXL A;  3GWF A;  1WYG A;  4X2P A;  1P43 A;  3N4E A;  3CPJ G;  1JRX A;  3AD8 B;  3QPE A;  4EMJ A;  2YG4 A;  1EL9 A;  1PXC A;  3CGE A;  2C3D A;  3DJD A;  1OJC A;  2XDO A;  2XYO A;  3JVA A;  3BHF A;  4XXG A;  4A7A A;  2POZ A;  3AD9 B;  4J2W A;  2WP5 A;  4OPG A;  4KEM A;  2ZZB A;  3EAO A;  3GYX A;  3CXB A;  4H2P A;  3KKJ A;  4AT2 A;  5JCI A;  1BGN A;  1REO A;  4Z2U A;  4YSX A;  3DER A;  4IP4 A;  2PPG A;  3LXD A;  4M0X A;  1XAN A;  2ARD A;  2B7R A;  5ER0 A;  2ZZC A;  4OPC A;  3V5F A;  3RO6 A;  5HXI A;  1MXT A;  4IVM B;  2E3T A;  3EF6 A;  1O5W A;  5J60 A;  3IHM A;  2GQW A;  3PVC A;  2GGG A;  2ONE A;  2P3Z A;  3ABV A;  3BI4 A;  3NN6 X;  4G73 A;  2OAL A;  1H84 A;  5IPY A;  2OAM A;  1YQ4 A;  1L0V A;  3KA7 A;  2BS3 A;  5KNL A;  3UJR A;  4IHC A;  1JNZ A;  4G74 A;  3ADA B;  1VG9 A;  1GET A;  2Q0L A;  4A9W A;  2GEW A;  1KCZ A;  3KU9 A;  4K8D A;  3AN1 A;  1GSN A;  1D7L A;  5BUK A;  2RDX A;  4B69 A;  3GSI A;  4YSH A;  3OPS A;  1O95 A;  3MSY A;  3O0H A;  3UKH A;  1LV0 A;  1XHC A;  3OTR A;  3PS9 A;  2OFJ A;  1FFV C;  3CXO A;  4E6M A;  4F4R A;  1N5X A;  3B3R A;  3LZW A;  3CTY A;  4EQS A;  4AP1 A;  2FBW A;  3KLJ A;  3ISH A;  4WX1 A;  3T14 A;  3VRA A;  1X31 B;  5C3J A;  2JB3 A;  4CCQ A;  3GD4 A;  5FJP A;  1EC7 A;  2AL2 B;  1EC8 A;  2XH4 A;  1RYI A;  2WQY A;  3UTF A;  4MKS A;  1GRA A;  4KPL A;  4GDP A;  3FCP A;  1WUF A;  2YLW A;  3VRD B;  2XFU A;  3SZW A;  3DGZ A;  3BHK A;  2YLR A;  4TLZ A;  1JU2 A;  4EM4 A;  1S2Q A;  3AE6 A;  2OQH A;  4O5U A;  4H4P A;  1E1M A;  4G6H A;  2BK5 A;  1AOG A;  2GRT A;  3T4W A;  1CJ4 A;  4MMW A;  2WDQ A;  5FMH A;  4IL0 A;  3H4K A;  3D47 A;  4GIR A;  1FCD A;  2R0C A;  3STP A;  3NYE A;  1BQG A;  3OC4 A;  3DH9 A;  1PBF A;  4M52 A;  4NZH A;  3CPI G;  3D46 A;  4Y4M A;  5FS6 A;  3IK4 A;  4K2S A;  1TYT A;  4Y4L A;  2GV8 A;  3RRA A;  3OZ2 A;  4B68 A;  1TDK A;  3TJI A;  2XCG A;  3NO1 A;  1XPQ A;  2Z5X A;  2B7S A;  4J33 A;  4ENL A;  3P4R A;  5KVI A;  4YKF A;  3V3N A;  3SZF A;  2R4E A;  3NYF A;  2ZBW A;  5JCK A;  2C67 A;  1KD0 A;  1PXA A;  1S2Y A;  3D9X A;  2QDD A;  2PU1 A;  2CHR A;  1JRO A;  4J1O A;  3AEE A;  4G9K A;  2OVL A;  4CY8 A;  1NAA A;  1Q1R A;  3AE8 A;  4O5Q A;  3P1W A;  4H4W A;  1QLB A;  3AWI A;  2CVJ A;  2V5Z A;  3CNT A;  4HB9 A;  1OJD A;  2PGW A;  3CK5 A;  4BK3 A;  1IUU A;  2WPC A;  4H4T A;  1S3E A;  2JAE A;  1FHV A;  2O9Z A;  3QLD A;  2VQB A;  1CC2 A;  5KOX A;  2BRA A;  2IVD A;  3TTE A;  1TRB A;  1KKR A;  4TM0 A;  1KSS A;  4A3R A;  4YT0 A;  3ZVH A;  1L9C A;  2YLZ A;  2YAU A;  1JPM A;  2V3B A;  2Y6R A;  3OW1 A;  3IJQ A;  2OZ8 A;  2WDV A;  1FEA A;  2AQJ A;  4E4F A;  1NHR A;  3DK8 A;  3CND A;  3B97 A;  1PJ7 A;  3D8X A;  1W4X A;  1VQZ A;  3HRD C;  1STZ A;  2HZG A;  2AAQ A;  1NEL A;  1GES A;  4Z2T A;  1JOA A;  5IDZ A;  2GQF A;  2P0I A;  1Q1W A;  3DES A;  3AM9 A;  3EEZ A;  3ICR A;  4P9S A;  3P93 A;  2GGE A;  2GB0 A;  5DBJ A;  5CKU A;  4H4U A;  3DA1 A;  3S47 A;  3UOY A;  1N62 C;  3AED A;  3NVV B;  1KNR A;  3DJG X;  4Z24 A;  3UKP A;  5U1O A;  1NHS A;  4IP5 A;  3HW2 A;  3ETR B;  2C64 A;  1LJ1 A;  1GER A;  5HY5 A;  2B9W A;  3T9P A;  1EBH A;  4Z44 A;  2QDE A;  2BK3 A;  3P0W A;  1ECQ A;  4Z26 A;  3QFB A;  2QQ6 A;  4JY3 A;  4DSH A;  2BCG G;  4GYP C;  2FJE A;  4AOS A;  2B9X A; 
#chains in the Genus database with same CATH homology
 2X8C A;  4A65 A;  4NEV A;  4NTC A;  4NWZ A;  1FOH A;  2XVF A;  2YM1 A;  1M64 A;  5C2T A;  2HQM A;  5M10 A;  2E5V A;  3II4 A;  3NHO X;  4U2T A;  1GRB A;  5KMR A;  3AEG A;  4H4Q A;  1N4W A;  3M12 A;  4XWZ A;  1KNP A;  1Y56 B;  1BWC A;  3ALM A;  2CDU A;  2YVJ A;  2EQ8 A;  2R45 A;  3FPZ A;  2XFQ A;  1CC6 A;  1NG3 A;  1PDH A;  4NTE A;  4WCT A;  2WP6 A;  3AYI A;  2BAB A;  1IUT A;  5KMP A;  4YKG A;  1KDG A;  4YTM A;  1GAL A;  2BRY A;  3I3L A;  2DKH A;  3F8R A;  1GT8 A;  2XVJ A;  3RP6 A;  2VOU A;  1ZMD A;  2XFP A;  3GWF A;  2WOW A;  4NEW A;  2X8G A;  3UOV A;  1CJ2 A;  4G6G A;  1LTX R;  3CPJ G;  1JRX A;  3SY4 A;  3NN0 X;  2BC0 A;  3P4S A;  3AEF A;  4EM3 A;  3K30 A;  4Z2R A;  4JDR A;  2NPX A;  4AP3 A;  1B5Q A;  3AD8 B;  3NK2 X;  4JQ9 A;  2C75 A;  4EMJ A;  3DJE A;  2YG4 A;  4UDR A;  1EL9 A;  1PXC A;  3CGE A;  2C3D A;  1CL0 A;  2WS3 A;  3DJD A;  1OJC A;  4ECH A;  2WBA A;  2XDO A;  3AEB A;  2OA1 A;  2XLU A;  5CQF A;  1MOK A;  4EQR A;  2A89 A;  2XYO A;  3VQR A;  3FG2 P;  2IVE A;  3BHF A;  4XXG A;  3ATR A;  4A7A A;  3AD9 B;  1ZOV A;  4J2W A;  1N1P A;  1P2E A;  4J56 A;  2WP5 A;  3SQP A;  3CMM A;  1XDI A;  3AE4 A;  3I6D A;  4OPG A;  2ZZB A;  3S61 A;  1BKW A;  3EAO A;  4GAV A;  3GYX A;  4H2P A;  2QCU A;  3KKJ A;  4AT2 A;  1YKJ A;  2FJB A;  2BS2 A;  5JCI A;  1BGN A;  5EBK A;  1BZL A;  1ZP0 A;  5EB4 A;  3L8K A;  1L0V A;  4EQW A;  1REO A;  3RED A;  4Z2U A;  2R9Z A;  4APN A;  1YY5 A;  1DXL A;  4YSX A;  3LXD A;  4DNA A;  1XAN A;  1H83 A;  2CFY A;  1OJA A;  2NVK X;  4GDE A;  2ARD A;  2B7R A;  1DOD A;  5ER0 A;  2ZZC A;  2XFO A;  4OPC A;  1IUW A;  1LQU A;  3T31 A;  1MXT A;  5HXI A;  4IVM B;  4H4Z A;  4H4S A;  2IID A;  3HYW A;  3UOZ A;  1P2H A;  1H81 A;  2GH5 A;  3EF6 A;  3EPT A;  1O5W A;  3M13 A;  3DJJ A;  4OPI A;  4X4J A;  4B1B A;  5J60 A;  2E1M A;  2TPR A;  3IHM A;  4II2 A;  2GQW A;  3AYL A;  4H7U A;  4OPU A;  3QSE A;  1VQW A;  1GND A;  5KXJ A;  3FMW A;  3PVC A;  2CUL A;  4E0V A;  2ACZ A;  3LJP A;  4CRT A;  2WOI A;  3BNM A;  2WOV A;  3T2Z A;  2BCP A;  3UKA A;  2X8H A;  1KFY A;  3ABV A;  2ZZ0 A;  2BS4 A;  3BI4 A;  2WP9 A;  3NN6 X;  4G73 A;  3UKK A;  1Q9I A;  2OAL A;  1H84 A;  3ZYX A;  5IPY A;  3LZX A;  2E4G A;  2OAM A;  1YQ4 A;  4ICY A;  2GAH B;  1GTH A;  1PN0 A;  3CIR A;  3GDN A;  2BS3 A;  3KA7 A;  4RSL A;  5EOW A;  5KNL A;  4YSY A;  1NDA A;  1GEU A;  3RP8 A;  3T2K A;  1GOS A;  1JNZ A;  1N4U A;  4G74 A;  3M0O A;  3ADA B;  2V61 A;  4K5S A;  1VG9 A;  1GET A;  2Q0L A;  4IA6 A;  2C4C A;  2GMJ A;  3RNM A;  1D4C A;  4A9W A;  1IUS A;  2GEW A;  3AE1 A;  3Q6J A;  3KU9 A;  4K8D A;  1CBO A;  3DGH A;  1GSN A;  1D7L A;  2FJD A;  4YSZ A;  3NG7 X;  2X3N A;  4C3Y A;  5EB5 A;  5BUK A;  3AD7 B;  4B69 A;  3WE0 A;  4LII A;  3GSI A;  1BF3 A;  4YSH A;  1O95 A;  3O0H A;  3NH3 X;  1K4Q A;  2C3C A;  1LV0 A;  3UKH A;  4Z43 A;  1XHC A;  3UKL A;  3PS9 A;  4GUV A;  3IHG A;  2VZ2 A;  1PJ5 A;  1ZDL A;  1LQT A;  4JN9 A;  3Q9T A;  1PXB A;  3CNP A;  2YLT A;  1VRQ B;  3B3R A;  3LZW A;  4U2L A;  3T0K A;  1FEB A;  3D1C A;  1MO9 A;  4C3X A;  3CTY A;  2C70 A;  2VVL A;  4EQS A;  3LOV A;  3GRS A;  1PBE A;  4B66 A;  3IWA A;  4AP1 A;  2EQ6 A;  3RHA A;  1GRF A;  2FBW A;  3KLJ A;  3KPF A;  1CHU A;  2V60 A;  3ISH A;  1FL2 A;  4A79 A;  3LAD A;  4WX1 A;  3T14 A;  1X31 B;  3VRA A;  5C3J A;  2JB3 A;  3UTE A;  2XLT A;  2R4J A;  4CCQ A;  3GYI A;  1EL8 A;  4U8K A;  2YR4 A;  4HA6 A;  3GD4 A;  1KSU A;  4CNK A;  1VG0 A;  2R0P A;  3C96 A;  1DJQ A;  1RYI A;  3FBS A;  2WQY A;  2UZZ A;  3UTF A;  4MJW A;  2Y6Q A;  2JB2 A;  3SFD A;  2YR5 A;  2XLP A;  3IC9 A;  1UKV G;  1EL7 A;  3KVE A;  2AR8 A;  1EL5 A;  1GRA A;  3ATQ A;  2BC1 A;  2V6O A;  2YG7 A;  4U8M A;  1NEN A;  2A87 A;  3C4A A;  2WU2 A;  4GDP A;  4PAB A;  3SYI A;  4K7Z A;  2TMD A;  2PYX A;  3GYJ A;  2YLW A;  3BI2 A;  4RG3 A;  4A5L A;  3GRT A;  4I58 A;  3F8P A;  3VRD B;  2XFU A;  3CPH G;  3E1T A;  4PAA A;  4H4Y A;  4KPR A;  3GDP A;  1JRY A;  3SZW A;  3DGZ A;  3BHK A;  5FS7 A;  4ADW A;  1ZOY A;  4BUR A;  2YLR A;  4TLZ A;  5U63 A;  4C5O A;  1JU2 A;  4EM4 A;  1S2Q A;  2Z5Y A;  2PHH A;  3IF9 A;  2GR2 A;  2APG A;  2WES A;  3AE6 A;  1K0J A;  4O5U A;  2WDR A;  4H4P A;  4BK1 A;  1E1M A;  3NT6 A;  4G6H A;  4JY2 A;  2XVE A;  4ZCC A;  2BK5 A;  4J57 A;  3R9U A;  3RP7 A;  1AOG A;  4JNA A;  2GRT A;  1IUX A;  1QO8 A;  4YXD A;  1CJ4 A;  3SFE A;  2WDQ A;  2EQ7 A;  5FMH A;  1E39 A;  4U8O A;  5J7X A;  3V3O A;  3H4K A;  1EBD A;  1DJN A;  3AEC A;  1BGJ A;  2YM2 A;  2YG3 A;  1GV4 A;  4FX9 A;  1FCD A;  1H86 A;  1LPF A;  2R0C A;  2JK6 A;  5GRT A;  4BJY A;  3NYE A;  4EQX A;  4U8L A;  3OC4 A;  2JB1 A;  3DH9 A;  2F5Z A;  2YWL A;  1PBF A;  4M52 A;  1CJ3 A;  2YLS A;  3DK4 A;  4NZH A;  1RSG A;  2C66 A;  3CN8 A;  2WET A;  3CPI G;  4UP3 A;  2A8X A;  2BA9 A;  1H7W A;  4Y4M A;  3CGB A;  2BAC A;  3GD3 A;  3GWD A;  5FS6 A;  1KF6 A;  5HYM A;  1YQ3 A;  4DGK A;  4U8I A;  1TYT A;  2VRM A;  2RAB A;  4K5R A;  5JCM A;  4Y4L A;  2EQ9 A;  2GV8 A;  2BXS A;  1K0L A;  4EIP A;  4U8N A;  4CY6 A;  1HYU A;  3OZ2 A;  3QSM A;  3NLC A;  3PO7 A;  4B68 A;  3QVR A;  4GRT A;  2YG6 A;  1TDK A;  3L1R A;  4H2R A;  1B8S A;  2GR0 A;  3KD9 A;  4J36 A;  1H82 A;  4RG4 A;  4U8P A;  1JNR A;  1E1N A;  1ONF A;  2OLN A;  4B64 A;  2BYB A;  2XCG A;  3UOX A;  4USQ A;  2X99 A;  4GR1 A;  2VVL G;  2V3A A;  1XPQ A;  1GRH A;  2B7S A;  2Z5X A;  4J33 A;  5GSN A;  5L46 A;  4FDC B;  1TDE A;  3ICT A;  4Z25 A;  1F8S A;  3NTA A;  3P4R A;  5KVI A;  4B67 A;  3NTD A;  4YKF A;  3H8I A;  2C76 A;  3V3N A;  4USR A;  2GR1 A;  3NRN A;  4U8J A;  3SZF A;  2R4E A;  3NYF A;  2C72 A;  1NG4 A;  3AB1 A;  5FS8 A;  1LVL A;  2ZBW A;  3DME A;  3NNE A;  5LV9 A;  3K7T A;  5KMS A;  2VVM A;  2YVF A;  5JCK A;  2BXR A;  2C67 A;  1E1K A;  1GRE A;  1PXA A;  1S2Y A;  2XLS A;  4IVO B;  2J3N A;  1CC4 A;  3D9X A;  3CGD A;  3NK1 X;  5BUL A;  1NPX A;  4OVI A;  1Z6L A;  2Q0K A;  4II3 A;  3SM8 A;  4AT0 A;  1H7X A;  5IQ1 A;  3AEE A;  1GPE A;  4FK1 C;  4G9K A;  3AE2 A;  1ZMC A;  1V59 A;  2FJA A;  1PHH A;  1F8W A;  1VDC A;  3H8L A;  4GCM A;  4BJZ A;  1OJ9 A;  2WHD A;  5JCN A;  3AEA A;  4U2S A;  4CY8 A;  2GR3 A;  1NAA A;  1Q1R A;  3AE8 A;  4O5Q A;  3COX A;  3P1W A;  4C77 A;  1YQZ A;  4H4W A;  4H4R A;  4EMI A;  3GMC A;  1KN0 A;  1QLB A;  1S3B A;  1GXF A;  3AE3 A;  3UKF A;  4A99 A;  3AWI A;  2CVJ A;  3SZC A;  5KWF A;  1PS9 A;  2GAG B;  4UDP A;  4OPD A;  3P9U A;  4JNQ A;  1K0I A;  2V5Z A;  3CNT A;  3NK0 X;  5JRB A;  4HB9 A;  3CNJ A;  4IA5 A;  3PG6 A;  4H4X A;  1OJD A;  3ALJ A;  4N9X A;  3UKQ A;  4BK3 A;  1IUU A;  2WPC A;  4H4T A;  4EMW A;  1N4V A;  1S3E A;  2XVI A;  3URH A;  2JAE A;  2RGO A;  2RGJ A;  3HYV A;  4K22 A;  4EIQ A;  2GMH A;  2I0Z A;  4TM3 A;  1TYP A;  2O9Z A;  4GAP A;  3NKS A;  2B9Y A;  2VQB A;  1F8R A;  1CC2 A;  2C65 A;  2X50 A;  2VRL A;  4ZN0 A;  1DNC A;  2R46 A;  1IUV A;  3ITJ A;  1GRT A;  2QA1 A;  2YQU A;  5KOX A;  2BRA A;  4GF7 A;  4H50 A;  4KX6 A;  1M6I A;  3QSS A;  2IVD A;  3ALL A;  1ELI A;  1TRB A;  4UDQ A;  4OCG A;  4IV9 A;  4A6N A;  1NHQ A;  1CJC A;  2RGH A;  1JEH A;  1ZY8 A;  2WPE A;  4H4V A;  1KSS A;  4TM0 A;  5KMQ A;  3BI5 A;  4YT0 A;  3S5W A;  4AOX A;  3VR8 A;  4BK2 A;  3AE5 A;  2W0H A;  1DOC A;  1L9C A;  1ZKQ A;  2YLZ A;  3F8D A;  2YAU A;  1F3P A;  1ZK7 A;  1D4E A;  1TDF A;  2YG5 A;  1SEZ A;  2WEU A;  2QAE A;  3NIX A;  2V3B A;  2H89 A;  2B76 A;  2Q6U A;  3GMB A;  4YWO A;  3NGC X;  2Y6R A;  4OPL A;  3VRB A;  5BRT A;  4NTD A;  3HYX A;  2WU5 A;  3UTH A;  3AE9 A;  2WDV A;  4Y4N A;  2JKC A;  1H2I A;  3C4N A;  1FEA A;  2XFN A;  2AQJ A;  4ZCD A;  1D4D A;  3VR9 A;  3V76 A;  4LA1 A;  1NHR A;  3CGC A;  3UCL A;  3DK8 A;  4TLX A;  3CND A;  1PJ7 A;  3SXI A;  3UP5 A;  4K2X A;  3UP4 A;  5TR3 A;  3AE7 A;  4FK1 A;  3D8X A;  3K7Q X;  1QJD A;  1W4X A;  1S7M A;  2QA2 A;  3QJ4 A;  3SX6 A;  5FS9 A;  4TM4 A;  4D03 A;  2AAQ A;  3NYC A;  3CNS A;  1GES A;  4OPT A;  4Z2T A;  1JOA A;  1H6V A;  2C7G A;  4LU6 A;  3P4Q A;  5IQ4 A;  2GQF A;  4XWR A;  3DK9 A;  4B65 A;  3AXB A;  5U25 A;  1Y56 A;  1IJH A;  1F6M A;  1Q1W A;  4CBQ A;  3LB8 A;  1B4V A;  3B6D A;  3JSK A;  4X9M A;  3ICS A;  3ICR A;  4P9S A;  1CF3 A;  2GB0 A;  5DBJ A;  5CKU A;  1L9E A;  4H4U A;  3EAN A;  1D7Y A;  3DA1 A;  1E7P A;  1RP0 A;  1E1L A;  3UOY A;  1GTE A;  5JCL A;  3UTG A;  5M0Z A;  2GF3 A;  3SGL A;  3L5O A;  1JRZ A;  2GVC A;  1DOE A;  3G5Q A;  3AED A;  1Y0P A;  1PBB A;  1KNR A;  3DJG X;  2DKI A;  4Z24 A;  3SZ0 A;  3UKP A;  2BK4 A;  1GRG A;  2YR6 A;  4I59 A;  5U1O A;  4BV6 A;  1PBD A;  1NHS A;  1PBC A;  5KOW A;  5KVH A;  2C73 A;  1FEC A;  5HHF A;  3QVP A;  4REK A;  1D5T A;  4TM1 A;  4D04 A;  4A6N B;  3G5S A;  3QFA A;  1PJ6 A;  3G5R A;  2JBV A;  3FIM B;  2OLO A;  1COY A;  3T37 A;  2C64 A;  1LJ1 A;  1B37 A;  4C74 A;  4CNJ A;  3HZL A;  1NEK A;  1GER A;  3P4P A;  4B63 A;  5HY5 A;  2B9W A;  5BVA A;  3AYJ A;  1OJT A;  2R0G A;  1TDN A;  4J31 A;  3BNU A;  1DOB A;  4H2N A;  1ZX9 A;  2VQ7 A;  2YLX A;  4Z44 A;  3ZDN A;  2YVG A;  4CCR A;  4YTP A;  2H88 A;  3KPK A;  3T2Y A;  3K7M X;  2WPF A;  2BK3 A;  4J34 A;  1TDO A;  4Z26 A;  3QFB A;  2XVH A;  1L9D A;  1NHP A;  5KRQ A;  4JY3 A;  4DSH A;  2BCG G;  2FJE A;  2XLR A;  4NNJ A;  4DSG A;  2Q7V A;  4YTN A;  1O94 A;  1E6E A;  4H2Q A;  4X9N A;  4AOS A;  2B9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...