3CGCA

Pyridine nucleotide complexes with bacillus anthracis coenzyme a-disulfide reductase: a structural analysis of dual nad(p)h specificity
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
444
structure length
444
Chain Sequence
b'MNYVIIGGDAAGMSAAMQIVRNDENANVVTLEKGEIYSYAQCGLPYVISGAIASTEKLIARNVKTFRDKYGIDAKVRHEVTKVDTEKKIVYAEHTKTKDVFEFSYDRLLIATGVRPVMPEWEGRDLQGVHLLKTIPDAERILKTLETNKVEDVTIIGGGAIGLEMAETFVELGKKVRMIERNDHIGTIYDGDMAEYIYKEADKHHIEILTNENVKAFKGNERVEAVETDKGTYKADLVLVSVGVKPNTDFLEGTNIRTNHKGAIEVNAYMQTNVQDVYAAGDCATHYHVIKEIHDHIPIGTTANKQGRLAGLNMLDKRRAFKGTLGTGIIKFMNLTLARTGLNEKEAKGLHIPYKTVKVDSTNMAGYYPNAKPLYLKLLYRSDTKQLLGGQVIGEEGVDKRIDVIAMALFNKMSIHDLEDVDLSYAPPYNSVWDPIQQAARRAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pyridine nucleotide-disulfide oxidoreductase, class I
publication title Pyridine Nucleotide Complexes with Bacillus anthracis Coenzyme A-Disulfide Reductase: A Structural Analysis of Dual NAD(P)H Specificity.
pubmed doi rcsb
source organism Bacillus anthracis str.
molecule tags Oxidoreductase
total genus 151
structure length 444
sequence length 444
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3cgcA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3cgcA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3cgcA02
4K22A 2X50A 5FMHA 2C64A 2VQBA 3S61A 1PXAA 1TDKA 2B7RA 5C3JA 3NYFA 2IVEA 4ICYA 2GQWA 1ZMDA 1ZX9A 1YQZA 4Y4NA 3VR9A 2A89A 4B69A 4TM1A 1E1NA 3FG2P 4YSYA 4RSLA 3M12A 1LTXR 4I59A 1GTHA 4AP3A 4YWOA 1D4DA 1YY5A 5HXIA 4H4PA 1KF6A 3GMCA 4YSHA 3LXDA 4Z2RA 3T37A 4EIPA 5FS6A 3IHMA 3CGCA 1GTEA 5FS9A 2BS3A 4K5SA 5HYMA 2IIDA 2V3BA 2WPFA 2GMHA 4IA6A 4RG4A 4B63A 2H89A 2B9WA 2WP9A 4NTCA 4OPUA 4N9XA 2BS4A 3NT6A 3ITJA 1B5QA 4A7AA 4CCRA 1DOEA 3CPHG 2XYOA 3KVEA 2IVDA 2NVKX 3ATQA 1Y56B 2H88A 3K30A 1CF3A 1JNRA 2YG6A 3EANA 3NYEA 4A5LA 4EQWA 4CBQA 3PVCA 2RGHA 1CBOA 1DXLA 3ISHA 4JY3A 2OALA 1GV4A 1H86A 1DNCA 2NPXA 1E7PA 2Q7VA 2GR3A 3ALMA 3AYJA 4H2RA 3KPFA 2GF3A 1D7LA 1TYPA 4HA6A 4U2SA 3LADA 1K0IA 2ZZ0A 3LZXA 1O95A 2BYBA 4GUVA 1PBCA 4C3XA 1Q1RA 1NPXA 2WPEA 2GB0A 3D8XA 3RNMA 3BNMA 4XXGA 1S2YA 5IQ1A 1VQWA 4J33A 2GAGB 1GRTA 4AOSA 4K5RA 3NHOX 4TM0A 2YR5A 2YQUA 3AE3A 1E1MA 3CIRA 4I58A 4A6NB 2Y6RA 1PS9A 4H4YA 2C73A 2XLRA 3CGEA 3WE0A 1LJ1A 1FOHA 4EQXA 1OJCA 2R4EA 2XFPA 4H4UA 2R0PA 3AEBA 5J7XA 2R0GA 3UKFA 2X99A 1EL7A 1NENA 3II4A 3UKKA 3E1TA 2XVFA 1GRBA 1VG9A 3EPTA 3AEGA 4JDRA 3QVPA 4AT0A 4J36A 4H4XA 3AD7B 2CDUA 2XVJA 3L1RA 1FCDA 4EQSA 2FBWA 1F8WA 3GD4A 1TDFA 1DJQA 1GSNA 4X9NA 3KKJA 4C5OA 2FJDA 3LZWA 5DBJA 4C74A 2GVCA 2VVLG 1N4WA 3CPJG 4USQA 5L46A 2R45A 3AEEA 3FBSA 3SFEA 4GRTA 5KOWA 2XFOA 2XDOA 4U8PA 2EQ9A 1H6VA 4WCTA 1K0LA 1YQ4A 3C4AA 2XFNA 2WEUA 4GCMA 1ZMCA 3NK2X 4IA5A 1ZDLA 2JBVA 5LV9A 1EL8A 3GDNA 3K7MX 2GR1A 2QA2A 2RABA 4ADWA 2ACZA 4GR1A 3G5RA 4U8IA 1B8SA 1BGJA 3UKHA 1DJNA 4H2NA 2YR4A 1CJCA 3KU9A 4B64A 1NHQA 2BACA 2CULA 3DMEA 2JB1A 3NTAA 4O5QA 1JNZA 1TYTA 3ADAB 4EMJA 4JY2A 3LOVA 4A79A 3FIMB 2ZZBA 4LIIA 2WETA 1H7WA 2QA1A 3QFBA 2R46A 3G5SA 3NN6X 4BJZA 1GNDA 4NEWA 3CGDA 4HB9A 4PABA 2X8GA 1PN0A 2QCUA 1CJ4A 1L0VA 1QLBA 1BWCA 1VDCA 1ZK7A 1CL0A 2BK5A 2ARDA 2YM1A 1DODA 1NHSA 4BURA 4PAAA 3UTFA 3DJGX 4EM3A 4CRTA 3Q6JA 2XFUA 2YLTA 2GQFA 1OJTA 2YVGA 3Q9TA 3NK1X 2JAEA 5KVIA 2WQYA 4K7ZA 1OJAA 3B6DA 2VZ2A 3SM8A 1OJDA 3BHFA 3AEAA 4ECHA 2JB2A 1PJ7A 2C3DA 2WU2A 1RSGA 4TM3A 3B3RA 4IVOB 4YTPA 1TDNA 3IWAA 4EM4A 3AE7A 5ER0A 1GETA 1H84A 3DA1A 3P9UA 4OCGA 1W4XA 3GMBA 3UKQA 4D04A 4E0VA 2V60A 4H4RA 3F8RA 2AAQA 5C2TA 3P4QA 1IJHA 1JOAA 1MXTA 3QVRA 4U2TA 4U8LA 2F5ZA 3NKSA 1XPQA 3QFAA 1Y56A 3AE4A 4IVMB 4YKFA 3UOVA 2WBAA 1NHPA 2EQ8A 5CKUA 3NRNA 3OZ2A 3NK0X 2QAEA 2WDVA 1D4CA 3CNJA 2JB3A 3P4SA 1CC6A 1O94A 2BCPA 3AWIA 5KXJA 1B4VA 2XVEA 3IHGA 5FS8A 3AB1A 4Y4LA 3RP6A 3AE1A 2OAMA 1IUWA 1VRQB 1FEBA 1XANA 3VRDB 2BC0A 2GR2A 1E6EA 5EOWA 1ZKQA 2C3CA 3C96A 2B9YA 2B76A 2VVLA 1H83A 3BI4A 2E5VA 1O5WA 2BK4A 4Z24A 1TRBA 4FX9A 2GRTA 1COYA 2WDQA 2XVHA 4U8NA 1N4VA 2R4JA 2XLSA 2X3NA 3AE8A 4ZCCA 3RP7A 4C3YA 1GRAA 2GAHB 5GSNA 1KSUA 3UKPA 2VOUA 2Y6QA 4NZHA 3KA7A 3AE6A 4A6NA 3AD9B 1KNPA 4H4QA 3ZDNA 1JEHA 2V6OA 1L9DA 3UTEA 3ABVA 1ZP0A 1IUSA 1NDAA 2E4GA 3ALJA 4J2WA 3SQPA 2WOVA 3M0OA 4OPDA 5M0ZA 4BK2A 2WOIA 5U63A 1GESA 5J60A 1E1LA 1LVLA 2WS3A 5U1OA 1CHUA 4UDQA 5KOXA 4NTEA 2VQ7A 1BF3A 2AQJA 3GDPA 2DKHA 3NH3X 5EBKA 3BHKA 1GRFA 3L8KA 4Z2UA 1M64A 3GD3A 4BV6A 2XLTA 2GH5A 2PHHA 2WOWA 3CNTA 1F8SA 1GRGA 2B7SA 4H2QA 3LJPA 4WX1A 3UTGA 3D1CA 4K2XA 1NG4A 4ZN0A 2YM2A 1H7XA 1IUVA 3DJDA 5KRQA 1D7YA 3GRSA 4LA1A 4U8OA 5JCMA 2V5ZA 2YVFA 1M6IA 1ZOVA 4BK1A 3RHAA 2YR6A 5BVAA 2W0HA 4H4WA 3V3NA 2YAUA 4EQRA 2B9XA 2C7GA 2WHDA 2YLRA 1LPFA 1HYUA 2TMDA 1KSSA 1QO8A 2XLUA 3M13A 2RGOA 3AEFA 1Q1WA 1B37A 2Q0LA 2BXSA 2RGJA 1KNRA 2BCGG 2XLPA 3UOZA 1D5TA 4EMIA 3PO7A 1CJ2A 1PJ5A 4P9SA 3BNUA 1ZOYA 4IV9A 1FECA 1NG3A 4Y4MA 3GRTA 4H4VA 4B1BA 1MOKA 1D4EA 2YWLA 3REDA 1OJ9A 5TR3A 1P2EA 2C76A 1EBDA 3DK4A 3AE2A 2Q6UA 3GSIA 4YTNA 2ZZCA 3UCLA 4C77A 3CNSA 1EL5A 1FL2A 4XWRA 5KVHA 3I3LA 1GOSA 2YG3A 4B67A 2WDRA 3NG7X 4YT0A 1GEUA 2WESA 3KLJA 2XFQA 1XDIA 4XWZA 1CJ3A 5JCKA 2YG7A 1V59A 1ZY8A 1N4UA 2FJBA 3NNEA 3AXBA 3P4RA 3NIXA 5GRTA 4A65A 5JCNA 1VG0A 1GRHA 3DH9A 4H7UA 3F8DA 1YQ3A 2C72A 1GT8A 3H8LA 4J34A 4A9WA 1H81A 2BS2A 3ZYXA 2APGA 2GR0A 2OLNA 2JKCA 3UOYA 4Z43A 3CN8A 2YLZA 3LB8A 1PBDA 5IQ4A 1BZLA 1Q9IA 4J56A 4CNJA 2FJAA 1LQTA 2R0CA 2XCGA 2YG4A 4CCQA 3F8PA 3VR8A 4YSXA 2DKIA 4JN9A 2C65A 2YLWA 2J3NA 1YKJA 2YLXA 2CFYA 3GYJA 2AR8A 3GYIA 1QJDA 4JNQA 4H4TA 3CPIG 4BJYA 4B66A 4DGKA 4YKGA 4YSZA 3UOXA 5KWFA 1L9CA 1PBBA 1L9EA 3IF9A 1DOCA 1PBEA 4ZCDA 4Z2TA 2A87A 2O9ZA 4AOXA 3GWDA 4OPLA 3URHA 2OA1A 1X31B 2BA9A 5CQFA 4J31A 5U25A 1S2QA 4REKA 4DSGA 1PDHA 2GMJA 1GALA 1GPEA 3CNDA 3CGBA 1TDOA 3QSSA 3FPZA 3UTHA 1GXFA 1K0JA 4OPGA 4X9MA 1CC4A 1NHRA 3CTYA 3NLCA 4U8MA 4OPTA 1BGNA 1IUUA 1JRYA 1P2HA 2ZBWA 4YXDA 3ICRA 4B65A 4JNAA 4LU6A 5BULA 4OPCA 2GEWA 4M52A 2X8CA 3G5QA 4OPIA 2Z5XA 3DGHA 4DSHA 2YVJA 1PXCA 4AT2A 4H50A 2E1MA 2XVIA 4MJWA 3NYCA 3NTDA 3V76A 4FK1C 3DJJA 2VRLA 4TLXA 4H2PA 2BABA 2OLOA 3UKAA 4UDRA 2CVJA 4KPRA 3K7TA 5EB4A 3S5WA 3PS9A 3O0HA 2EQ6A 1CC2A 3NGCX 5JCIA 4AP1A 4CY8A 4GF7A 3AYLA 2V61A 3HZLA 2EQ7A 3C4NA 1E39A 2BK3A 3COXA 3AYIA 3JSKA 5IPYA 1PHHA 2YLSA 4U2LA 2GV8A 3ICTA 2JK6A 4UP3A 4Z44A 1PXBA 4TLZA 1RYIA 1F3PA 2HQMA 1FEAA 3AE5A 1IUXA 1Y0PA 3BI2A 3P4PA 4U8KA 3GWFA 2A8XA 2UZZA 1GREA 4H4SA 1AOGA 2BC1A 1MO9A 1F6MA 2TPRA 1BKWA 1REOA 3P1WA 4A99A 1UKVG 2BXRA 2VVMA 1JRZA 1Z6LA 3UP4A 2YG5A 4DNAA 4RG3A 4J57A 5EB5A 4Z25A 1K4QA 5HHFA 1GERA 1N1PA 3R9UA 5HY5A 4CNKA 4UDPA 1ONFA 3OC4A 3QSEA 4O5UA 2C70A 4K8DA 3H4KA 2VRMA 1NEKA 3VQRA 1E1KA 4FDCB 4Z26A 1JU2A 4NTDA 1TDEA 3SGLA 4EMWA 4GDEA 4B68A 4EIQA 4JQ9A 1RP0A 2FJEA 3DJEA 3VRBA 1S3BA 2C67A 5JCLA 3K7QX 3UP5A 4YTMA 4BK3A 1LQUA 3UKLA 1KDGA 4D03A 3ATRA 3RP8A 1SEZA 3V3OA 2I0ZA 1DOBA 4GDPA 3IC9A 4U8JA 2WP5A 3AE9A 2Z5YA 2WP6A 3SFDA 3AD8B 4OVIA 3DK8A 3DGZA 3QSMA 2Q0KA 1ELIA 1KFYA 5BRTA 3EF6A 1IUTA 4TM4A 4NEVA 3ICSA 1JRXA 4X4JA 4APNA 3KD9A 1S3EA 3BI5A 1PJ6A 1H82A 3EAOA 4H4ZA 1LV0A 4USRA 5M10A 1F8RA 2R9ZA 2C66A 2PYXA 3FMWA 3NN0X 5BUKA 3AEDA 3CNPA 2V3AA 1PBFA 3H8IA 2WPCA 3I6DA 4FK1A 4CY6A 2X8HA 3VRAA 1NAAA 1XHCA 3AECA 3ALLA 2WU5A 3DK9A 2C75A 1EL9A 3QJ4A 5FS7A 4KX6A
chains in the Genus database with same CATH superfamily
4K22A 2X50A 4K1WA 2VQBA 3NYFA 4TM1A 1GTHA 5FJTA 4Z2RA 3T37A 4EIPA 5ENLA 3IHMA 2BS3A 2IIDA 2V3BA 4DX3A 4B63A 3UCDA 4OPUA 1R6WA 1DOEA 2IVDA 3KVEA 4Z43A 1Y56B 1JNRA 2FYMA 2PGWA 1FHUA 3ZLHA 2OALA 2Q7VA 3ALMA 3AYJA 1TYPA 4U2SA 3V5CA 1O95A 4C3XA 3RNMA 3BNMA 4XXGA 1S2YA 1VQWA 4J33A 4AOSA 3NHOX 3T2ZA 2GDQA 3CIRA 3L5OA 3RITA 4EQXA 3AEBA 2R0GA 3UKFA 2X99A 4HPNA 3II4A 3UKKA 4HNLA 1VG9A 4JDRA 3QVPA 1N63C 4ENLA 2CDUA 4YWSA 3QPEA 4EQSA 3GD4A 2GGJA 4C5OA 4C74A 2GVCA 2R45A 3FBSA 3SFEA 3ES8A 4U8PA 1XPYA 4G7FA 1RM6B 1EL8A 2GR1A 2QA2A 1WUEA 2RABA 2ACZA 3UKHA 1CJCA 4B64A 1JNZA 4JY2A 4A79A 1ZXIC 2ZZBA 4LIIA 2WETA 3QFBA 4NNJA 4HB9A 1PN0A 3QN3A 2YM1A 3PK7A 4PAAA 3DJGX 3UJEA 3Q6JA 2YVGA 2XSXA 3SZCA 5KVIA 4K7ZA 2HXTA 3HW2A 2GGHA 2PTWA 4EM4A 1W4XA 3UJSA 3T4WA 4H4RA 3D47A 2AAQA 1IJHA 1PDZA 1JOAA 3QVRA 2F5ZA 1XPQA 1Y56A 5CKUA 3ES7A 2QAEA 1KD0A 1D4CA 1CC6A 3AWIA 3IHGA 4HYRA 4A3RA 1SJAA 2OAMA 1FEBA 1EC7A 2BC0A 4DN1A 1KN0A 2B76A 2E5VA 3SZ0A 2BRAA 1COYA 3AMZA 1F9CA 4H1ZA 1PDYA 2VOUA 2Y6QA 2GGGA 3AD9B 1KNPA 2P3ZA 3UTEA 2QDEA 1IUSA 2E4GA 3ALJA 4J2WA 2HZGA 5U63A 1GESA 3CK5A 5U1OA 3DG3A 1BF3A 2AQJA 3BHKA 3L8KA 4BV6A 2XLTA 2GH5A 3PWIA 5EU9A 4H2QA 4WX1A 3ENLA 4KPLA 4Z17A 1JPMA 3Q4DA 1ZOVA 2PODA 4KWSA 2B9XA 2C7GA 2WHDA 1HYUA 2TMDA 1KKRA 2RGJA 2XLPA 3UOZA 1PJ5A 4P9SA 3GRTA 4B1BA 1D4EA 2YWLA 3HYXA 5TR3A 1OJ9A 3AE2A 4YTNA 3DK4A 2ZZCA 1EL5A 1FL2A 4IHCA 1MDLA 4HCLA 1GOSA 4E8GA 2XFQA 1P48A 5JCKA 3R1ZA 1V59A 1ZY8A 3OTRA 3SQSA 3JW7A 5GRTA 3MSYA 1ECQA 1N5WC 3H8LA 2BS2A 2APGA 3P3BA 2JKCA 3UOYA 4H19A 2R0CA 3IK4A 4JN9A 2GGEA 2YLXA 3B9JB 4DGKA 5BUKA 1DOCA 1PBEA 4Z2TA 4AOXA 4M6UA 1X31B 2PP3A 4J31A 5U25A 1S2QA 4DSGA 4GGBA 3A7RA 3FPZA 4OPTA 2DW7A 1P2HA 2ZBWA 3ICRA 4B65A 4JNAA 2GEWA 5KMSA 2Z5XA 4DSHA 1MNSA 1PXCA 4AT2A 4H50A 3NTDA 3DJJA 2OLOA 3UKAA 4X2PA 2CVJA 3SYIA 5JCIA 3V3WA 4IP4A 3HZLA 3JSKA 3TCSA 1E39A 3COXA 2YLSA 4U2LA 4DHGA 4TLZA 2HQMA 3AE5A 1X2GA 1Y0PA 3BI2A 2DW6A 2UZZA 1REOA 4A99A 2BXRA 2PTXA 1FO4A 1Z6LA 2QJMA 1DTNA 4Z25A 1K4QA 2GSHA 5IDZA 5HHFA 4CNKA 2OX4A 3SBFA 3QSEA 3AN1A 3JVAA 4FDCB 1ELSA 1ONEA 1TDEA 4TVWA 4E5TA 1S3BA 2C67A 3BSMA 3VC6A 5JCLA 4YTMA 3UP5A 4D03A 3ATRA 3V3OA 2W55A 1DOBA 3CMMA 3DK8A 3DGZA 1KFYA 4TM4A 1SJCA 4NEVA 3ICSA 3MWCA 1S3EA 2R9ZA 3NN0X 1OEPA 3SX6A 3FJ4A 2V3AA 3H8IA 2WPCA 1N5XA 3I6DA 4CY6A 3VRAA 2OZ3A 3AECA 3ALLA 2WU5A 2C64A 3S61A 1TDKA 5C3JA 1ZX9A 4B69A 3U9IA 4RSLA 1LTXR 4AP3A 3R0UA 1D4DA 4IT1A 1YY5A 1GTEA 2B9WA 1FHVA 3GY1A 3ITJA 3UGVA 2C4CA 2XYOA 2NVKX 3ATQA 2H88A 4A5LA 4H83A 4M0XA 2RGHA 1GV4A 1DNCA 2GR3A 4G74A 3KPFA 4IL0A 1K0IA 1BKHA 2ZZ0A 1NPXA 2WPEA 3NFUA 4DYEA 5IQ1A 3SN0A 1GRTA 3ZVIA 4TM0A 4I58A 4H4YA 3SXIA 1FOHA 2XFPA 3SY4A 2W3SA 4H4UA 1EL7A 2XVFA 3EPTA 3UXKA 4J36A 3AD7B 3L1RA 2FBWA 1F8WA 5BOEA 3STPA 2FJDA 3LZWA 5DBJA 3HPFA 2OFJA 4GRTA 2XFOA 2XFNA 4GCMA 3DGBA 4KEMA 4IA5A 2JBVA 4ADWA 3DDMA 4O5QA 4Z1YA 1TYTA 3ADAB 3FCPA 1H7WA 2QA1A 3SN4A 3UJFA 2R46A 3NN6X 1GNDA 3NRZB 4EWJA 2X8GA 1CJ4A 1BWCA 4TVYA 1VDCA 3TOYA 2BK5A 3DERA 3GD6A 3N6HA 3Q9TA 3NK1X 2WQYA 3CXBA 2VZ2A 3BHFA 3NO1A 2C3DA 4TM3A 3B3RA 1TDNA 2AL2A 3IWAA 2P8CA 5ER0A 1H84A 3DA1A 3VFCA 1EBHA 3MZNA 3P9UA 4OCGA 1TE6A 2V60A 2OQHA 1MXTA 4U8LA 3AE4A 3QFAA 4IVMB 2OQYA 2WBAA 2EQ8A 5FJOA 1O94A 4Y4LA 5FS8A 1FFVC 1IUWA 2GR2A 1E6EA 1ZKQA 3I6TA 2VVLA 1H83A 3BI4A 2BK4A 4H2HA 1TRBA 4FX9A 2GRTA 2WDQA 2XVHA 4ZCCA 3AE8A 1GRAA 3UKPA 4FI4A 3AE6A 4H4QA 3P0WA 3ABVA 1NDAA 3SQPA 1KCZA 4BK2A 3RCYA 2HXUA 3IJIA 3TW9A 2WS3A 1LVLA 1CHUA 4UDQA 5KOXA 4NTEA 5EBKA 1M64A 3GD3A 1IYXA 3TJIA 2WOWA 3SZFA 1F8SA 3UTGA 1NG4A 4ZN0A 1IUVA 3DJDA 3GRSA 3MUCA 4LA1A 2V5ZA 1M6IA 3IJLA 1LPFA 2RGOA 1VQZA 4G73A 5JRBA 2Q0LA 3PO7A 1CJ2A 4DXKA 4IV9A 1FECA 4MMWA 1NG3A 4Y4MA 1MOKA 1P2EA 2C76A 3OZYA 4XWRA 5KVHA 1MDRA 2YG3A 3JZUA 3KPKA 2WESA 4XWZA 2FJBA 3NNEA 3P4RA 4GYPC 4J34A 4A9WA 3DIPA 3EEZA 3CN8A 3LB8A 1BZLA 6ENLA 1LQTA 4CCQA 7ENLA 2C65A 4JNQA 2CFYA 3OP2A 1QJDA 3CPIG 4B66A 4YKGA 2PU1A 3I6EA 3URHA 4REKA 2NQLA 2GMJA 1GPEA 3UTHA 4X9MA 4U8MA 1BGNA 1IUUA 1JRYA 3DG7A 3IJQA 4OPCA 4M52A 1WYGA 3DGHA 2E1MA 3OPSA 3NYCA 1BQGA 3ZLFA 5EB4A 3N6JA 3UCCA 3PS9A 3V5FA 1CC2A 4AP1A 4CY8A 4GF7A 2GV8A 3ICTA 2MNRA 4UP3A 4Z44A 1PXBA 3T0KA 1JPDX 3R25A 2A8XA 2PP1A 4H4SA 1MO9A 1F6MA 3DEQA 1BKWA 2ONEA 4GYPA 2YG5A 1N62C 4UDPA 1ONFA 3CXOA 4K8DA 3H4KA 1NEKA 1E1KA 3SGLA 4GIRA 2FJEA 4BK3A 3S5SA 1LQUA 1SEZA 1W6TA 3SSZA 2WP5A 3AE9A 3QSMA 1EBGA 1JRXA 4APNA 3KD9A 3BI5A 2OPJA 3ZVHA 4H4ZA 1LV0A 1JCTA 3GYXA 1NAAA 1XHCA 3DK9A 3EUB3 5FJRA 4IL2A 2HNEA 1TKKA 4KX6A 5FMHA 1FIQB 1PXAA 2B7RA 2GQWA 1YQZA 2A89A 4FP1A 1E1NA 4YSYA 4I59A 2PA6A 4GMEA 4YWOA 5HXIA 3UJ2A 4A35A 4YSHA 3LXDA 5FS6A 3CGCA 5FS9A 2QJNA 4K5SA 2WPFA 3A7AA 4IA6A 4RG4A 2WP9A 4NTCA 4N9XA 2BS4A 3NT6A 1P43A 2PTZA 3CPHG 4MGGA 3K30A 3NYEA 1CF3A 2YG6A 3EANA 1EC9A 2XGZA 3AM9A 1CBOA 3A7UA 4H2RA 1D7LA 2FKPA 4G6HA 4HA6A 3LADA 3LZXA 4GUVA 1PBCA 1Q1RA 2GB0A 3D8XA 3T6CA 3TJ4A 1E1MA 4A6NB 2Y6RA 2XLRA 2PS2A 3CGEA 3WE0A 1LJ1A 2R4EA 5J7XA 2RDXA 3E1TA 1GRBA 4JN8A 2P88A 4AT0A 1KKOA 4HNCA 2XVJA 1FCDA 3GO2A 5KMQA 1N61C 3RO6A 1DJQA 4X9NA 2XH0A 3CPJG 1S7MA 4USQA 1SJDA 2EQ9A 1H6VA 1K0LA 1YQ4A 4G6GA 3C4AA 3THUA 2PSNA 1ZDLA 5LV9A 3GDNA 2QQ6A 4U8IA 1B8SA 1BGJA 1DJNA 1NHQA 2BACA 4GAPA 3VC5A 3CGDA 1X2HA 2GL5A 2QCUA 1L0VA 1QLBA 1CL0A 2ARDA 1NHSA 4II2A 4CRTA 3TQPA 2XFUA 3UJRA 4GFIA 2GQFA 1OJTA 5KMPA 2JAEA 1OJAA 3T9PA 1OJDA 3AEAA 3T31A 2JB2A 2WU2A 1RSGA 4IVOB 2AL2B 3AE7A 5BOFA 4D04A 3F8RA 5C2TA 4U2TA 4HCHA 1NHPA 3HYVA 3NRNA 3OZ2A 3P4SA 5KXJA 5FJPA 2XVEA 1XANA 4J3ZA 3C96A 1VDVA 4G8TA 1H2IA 3R07C 4U8NA 1N4VA 2R4JA 3RP7A 2GAHB 4NZHA 2QGYA 4A6NA 4HN8A 3M0OA 4OPDA 3NVYB 3NVWB 5J60A 1E1LA 3GDPA 3NH3X 4Z2UA 3QLDA 2PHHA 2B7SA 5KNLA 3LJPA 3D1CA 2YM2A 5KRQA 1D7YA 5JCMA 2YVFA 4BK1A 3V3NA 4EQRA 1KSSA 2XLUA 1Q1WA 2AL1A 2BCGG 1D5TA 3NS1B 3REDA 1EBDA 3P93A 2Q6UA 4C77A 3SJNA 2PGEA 3D46A 2WDRA 3NG7X 3VA8A 3KLJA 1XDIA 1CJ3A 1N4UA 1E9IA 3AXBA 4A65A 5JCNA 3DH9A 4H7UA 1YQ3A 2C72A 2QJJA 1H81A 2GR0A 2CHRA 1Q9IA 2W54A 2XCGA 3F8PA 3VR8A 2YLWA 3V4BA 2J3NA 3H8AA 1YKJA 4Y4NA 3GYJA 4H4TA 4YSZA 3RGTA 5KWFA 3UOXA 2BRYA 1L9CA 1PBBA 1L9EA 2A87A 3GWDA 4OPLA 2OA1A 1PDHA 2OLAA 1TDOA 4OPGA 3TTEA 1CC4A 3CTYA 1L8PA 1JROA 4GISA 4YXDA 4LU6A 5BULA 2X8CA 3K1GA 2YVJA 2XVIA 4MJWA 3VDGA 4FK1C 4H2PA 2GGIA 4UDRA 4KPRA 3K7TA 2EQ6A 3NGCX 2P8BA 3AYLA 1T3QC 2V61A 2BK3A 3AYIA 3R11A 2JK6A 1RYIA 1F3PA 4ROPA 1FEAA 2E3TA 3P4PA 4U8KA 3DFYA 1AOGA 2BC1A 3P1WA 3BOXA 1UKVG 2VVMA 4DNAA 4RG3A 1N1PA 3R9UA 3CT2A 3OC4A 3CB3A 4O5UA 2C70A 2VRMA 2OZ8A 3NZGA 3RR1A 1JU2A 1NU5A 4EMWA 4JQ9A 3K7QX 5KMRA 3UKLA 1KDGA 3I4KA 3RP8A 3IC9A 4U8JA 2WP6A 3AD8B 4OVIA 3MKCA 3EF6A 1IUTA 4X4JA 4IZGA 1PJ6A 3ZVHB 5M10A 3N4EA 2C66A 2E5AA 2O56A 3N4FA 2PP0A 3AEDA 3CNPA 4FK1A 2X8HA 2I5QA 1XS2A 1EC8A 1EL9A 3QJ4A 3UTFA 2IVEA 4ICYA 1ZMDA 3T8QA 3VR9A 3FG2P 3M12A 1R0MA 4H4PA 1KF6A 4ZCWA 3GMCA 1NELA 5HYMA 2PMQA 2GMHA 2H89A 2AKMA 2XH4A 3BJSA 3PFRA 1B5QA 4A7AA 4CCRA 1FFUC 4EQWA 4CBQA 4ZOHB 3PVCA 1DXLA 3ISHA 4JY3A 1H86A 2NPXA 3MY9A 1E7PA 2GF3A 3TWBA 1SB3B 3T2KA 4GGHA 2BYBA 4GAVA 4K8GA 2GAGB 4K5RA 2YR5A 2YQUA 3AE3A 3PG6A 1PS9A 2C73A 3NXLA 1OJCA 3ETRB 2R0PA 2OKTA 1NENA 3AEGA 3T14A 3RRAA 4H4XA 4E4UA 1MUCA 1TDFA 1GSNA 1N60C 3KKJA 2VVLG 1N4WA 5L46A 3AEEA 5KOWA 2XDOA 4WCTA 3QKEA 2PPGA 2WEUA 1ZMCA 1WUFA 3NK2X 3K7MX 4MKSA 4GR1A 4JN7A 3G5RA 4H2NA 2YR4A 3KU9A 2CULA 3DMEA 2JB1A 3NTAA 4EMJA 3LOVA 3FIMB 3H7VA 2PCEA 3SR6B 3G5SA 4BJZA 4NEWA 4PABA 3DG6A 4KT2A 4F4RA 1ZK7A 1DODA 4BURA 4EM3A 2YLTA 2XH2A 3UXLA 2W3RA 3B6DA 3SM8A 4ECHA 1PJ7A 4YTPA 3FV9A 1GETA 3HRDC 3GMBA 3UKQA 4E0VA 2POZA 3P4QA 3NKSA 2P0IA 4YKFA 3UOVA 3H70A 3HYWA 2XH7A 3NK0X 2WDVA 3CNJA 2JB3A 2BCPA 4E6MA 1B4VA 5FJUA 1JRPA 3AB1A 3RP6A 3AE1A 1V97A 1VRQB 3H12A 3VRDB 5EOWA 2C3CA 2B9YA 1O5WA 2OO6A 3ZLGA 4Z24A 2XLSA 2X3NA 3D9XA 4C3YA 5GSNA 1KSUA 3KA7A 3ZDNA 1JEHA 2V6OA 1L9DA 1JDFA 1ZP0A 3CAWA 2WOVA 3OZMA 5M0ZA 2WOIA 2VQ7A 4A6GA 4K2SA 2DKHA 1GRFA 3KUMA 4G9KA 3EKGA 3CYJA 3CNTA 3T2YA 1GRGA 3NVVB 4K2XA 1STZA 1H7XA 4U8OA 3FXGA 3MQTA 2YR6A 3RHAA 2W0HA 5BVAA 4H4WA 2YAUA 3DFHA 4J1OA 2YLRA 4ZA0A 1QO8A 3M13A 3AEFA 1B37A 1MRAA 2ZADA 3Q45A 2BXSA 1KNRA 4EMIA 3BNUA 1ZOYA 3U4FA 4H4VA 1RVKA 5G5GB 2QVHA 3GSIA 3UCLA 3CNSA 1TZZA 3I3LA 2OVLA 4B67A 2OG9A 4YT0A 1GEUA 2YG7A 3NIXA 4E4FA 1VG0A 1GRHA 3F8DA 1GT8A 3ZYXA 2OLNA 2YLZA 1PBDA 5IQ4A 4J56A 4CNJA 3GC2A 2FJAA 2YG4A 4YSXA 2DKIA 3QTPA 4BJYA 2AR8A 3GYIA 5G5HB 3IF9A 4ZCDA 2O9ZA 5CQFA 2BA9A 4HCDA 2PTYA 5J04A 1GALA 4II3A 3CNDA 3CGBA 3QSSA 1GXFA 1K0JA 3FYYA 1NHRA 3NLCA 4NWZA 3VCNA 3B97A 1SJBA 3G5QA 4OPIA 3SN1A 2QDDA 2ZC8A 3V76A 2VRLA 4TLXA 2BABA 3S5WA 3O0HA 3OW1A 2EQ7A 3C4NA 4IP5A 5IPYA 1PHHA 3FVDA 3R10A 3VCCA 1IUXA 3GWFA 2PU0A 1GREA 2TPRA 1JRZA 3UP4A 4J57A 5EB5A 2MUCA 1GERA 3DESA 5HY5A 2OZTA 3VQRA 3R0KA 4Z26A 4NTDA 3S47A 4GDEA 4B68A 4EIQA 1RP0A 3DJEA 3VRBA 3PWGA 1YEYA 2I0ZA 2AKZA 3NVZB 4GDPA 2Z5YA 3SFDA 4DWDA 2Q0KA 1ELIA 5BRTA 4JHMA 1H82A 3EAOA 4USRA 1F8RA 2PYXA 3FMWA 1PBFA 2C75A 3SZWA 3TWAA 5FS7A
chains in the Genus database with same CATH topology
4K22A 2X50A 5FMHA 2C64A 2VQBA 3S61A 1PXAA 1TDKA 2B7RA 5C3JA 3NYFA 2IVEA 4ICYA 2GQWA 1ZMDA 1ZX9A 1YQZA 4Y4NA 3VR9A 2A89A 4B69A 4TM1A 1E1NA 3FG2P 4YSYA 4RSLA 3M12A 1LTXR 4I59A 1GTHA 4AP3A 4YWOA 1D4DA 1YY5A 5HXIA 4H4PA 1KF6A 3GMCA 4YSHA 3LXDA 4Z2RA 3T37A 4EIPA 5FS6A 3IHMA 3CGCA 1GTEA 5FS9A 2BS3A 4K5SA 5HYMA 2IIDA 2V3BA 2WPFA 2GMHA 4IA6A 4RG4A 4B63A 2H89A 2B9WA 2WP9A 4NTCA 4OPUA 4N9XA 2BS4A 3NT6A 3ITJA 1B5QA 4A7AA 4CCRA 1DOEA 2C4CA 3CPHG 2XYOA 3KVEA 2IVDA 2NVKX 3ATQA 1Y56B 2H88A 3K30A 1CF3A 1JNRA 2YG6A 3EANA 3NYEA 4A5LA 4EQWA 4CBQA 3PVCA 2RGHA 1CBOA 1DXLA 3ISHA 4JY3A 2OALA 1GV4A 1H86A 1DNCA 2NPXA 1E7PA 2Q7VA 2GR3A 3ALMA 4G74A 3AYJA 4H2RA 3KPFA 2GF3A 1D7LA 1TYPA 3T2KA 4G6HA 4HA6A 4U2SA 3LADA 1K0IA 2ZZ0A 3LZXA 1O95A 2BYBA 4GUVA 1PBCA 4C3XA 4GAVA 1Q1RA 1NPXA 2WPEA 2GB0A 3D8XA 3RNMA 3BNMA 4XXGA 1S2YA 5IQ1A 1VQWA 4J33A 2GAGB 1GRTA 4AOSA 4K5RA 3NHOX 4TM0A 3T2ZA 2YR5A 2YQUA 3AE3A 3PG6A 1E1MA 3CIRA 4I58A 4A6NB 2Y6RA 1PS9A 3L5OA 4H4YA 2C73A 2XLRA 3CGEA 3SXIA 3WE0A 1LJ1A 1FOHA 4EQXA 1OJCA 2R4EA 2XFPA 4H4UA 2R0PA 3AEBA 5J7XA 3SY4A 2R0GA 3UKFA 2X99A 1EL7A 1NENA 3II4A 3UKKA 3E1TA 2XVFA 1GRBA 1VG9A 3EPTA 3AEGA 4JDRA 3QVPA 3T14A 4AT0A 4J36A 4H4XA 3AD7B 2CDUA 2XVJA 3L1RA 1FCDA 4EQSA 2FBWA 5KMQA 1F8WA 3GD4A 1TDFA 1DJQA 1GSNA 4X9NA 3KKJA 4C5OA 2FJDA 3LZWA 5DBJA 4C74A 2GVCA 2VVLG 1N4WA 1S7MA 3CPJG 4USQA 5L46A 2R45A 3AEEA 3FBSA 3SFEA 4GRTA 5KOWA 2XFOA 2XDOA 4U8PA 2EQ9A 1H6VA 4WCTA 1K0LA 1YQ4A 4G6GA 3C4AA 2XFNA 2WEUA 4GCMA 1ZMCA 3NK2X 4IA5A 1ZDLA 2JBVA 5LV9A 1EL8A 3GDNA 3K7MX 2GR1A 2QA2A 2RABA 4ADWA 2ACZA 4GR1A 3G5RA 4U8IA 1B8SA 1BGJA 3UKHA 1DJNA 4H2NA 2YR4A 1CJCA 3KU9A 4B64A 1NHQA 2BACA 2CULA 4GAPA 3DMEA 2JB1A 3NTAA 4O5QA 1JNZA 1TYTA 3ADAB 4EMJA 4JY2A 3LOVA 4A79A 3FIMB 2ZZBA 4LIIA 2WETA 1H7WA 2QA1A 3QFBA 2R46A 4NNJA 3G5SA 3NN6X 4BJZA 1GNDA 4NEWA 3CGDA 4HB9A 4PABA 2X8GA 1PN0A 2QCUA 1CJ4A 1L0VA 1QLBA 1BWCA 1VDCA 1ZK7A 1CL0A 2BK5A 2ARDA 2YM1A 1DODA 1NHSA 4BURA 4PAAA 4II2A 3UTFA 3DJGX 4EM3A 4CRTA 3Q6JA 2XFUA 2YLTA 2GQFA 1OJTA 2YVGA 3Q9TA 3NK1X 5KMPA 3SZCA 2JAEA 5KVIA 2WQYA 4K7ZA 1OJAA 3B6DA 2VZ2A 3SM8A 1OJDA 3BHFA 3AEAA 3T31A 4ECHA 2JB2A 1PJ7A 2C3DA 2WU2A 1RSGA 4TM3A 3B3RA 4IVOB 4YTPA 1TDNA 3IWAA 4EM4A 3AE7A 5ER0A 1GETA 1H84A 3DA1A 3P9UA 4OCGA 1W4XA 3GMBA 3UKQA 4D04A 4E0VA 2V60A 4H4RA 3F8RA 2AAQA 5C2TA 3P4QA 1IJHA 1JOAA 1MXTA 3QVRA 4U2TA 4U8LA 2F5ZA 3NKSA 1XPQA 3QFAA 1Y56A 3AE4A 4IVMB 4YKFA 3UOVA 2WBAA 1NHPA 2EQ8A 3HYVA 5CKUA 3NRNA 3HYWA 3OZ2A 3NK0X 2QAEA 2WDVA 1D4CA 3CNJA 2JB3A 3P4SA 1CC6A 1O94A 2BCPA 3AWIA 5KXJA 1B4VA 2XVEA 3IHGA 5FS8A 3AB1A 4Y4LA 3RP6A 3AE1A 2OAMA 1IUWA 1VRQB 1FEBA 1XANA 3VRDB 2BC0A 2GR2A 1E6EA 5EOWA 1ZKQA 2C3CA 3C96A 1KN0A 2B9YA 2B76A 2VVLA 1H83A 3BI4A 2E5VA 3SZ0A 1O5WA 2BK4A 2BRAA 1TRBA 4Z24A 4FX9A 1H2IA 2GRTA 1COYA 2WDQA 2XVHA 4U8NA 1N4VA 2R4JA 2XLSA 2X3NA 3D9XA 3AE8A 4ZCCA 3RP7A 4C3YA 1GRAA 2GAHB 5GSNA 1KSUA 3UKPA 2VOUA 2Y6QA 4NZHA 3KA7A 3AE6A 4A6NA 3AD9B 1KNPA 4H4QA 3ZDNA 1JEHA 2V6OA 1L9DA 3UTEA 3ABVA 1ZP0A 1IUSA 1NDAA 2E4GA 3ALJA 4J2WA 3SQPA 2WOVA 3M0OA 4OPDA 5M0ZA 4BK2A 2WOIA 5U63A 1GESA 5J60A 1E1LA 1LVLA 2WS3A 5U1OA 1CHUA 4UDQA 5KOXA 4NTEA 2VQ7A 1BF3A 2AQJA 3GDPA 2DKHA 3NH3X 5EBKA 3BHKA 1GRFA 3L8KA 4Z2UA 1M64A 3GD3A 4BV6A 2XLTA 2GH5A 2PHHA 2WOWA 4G9KA 3SZFA 3CNTA 1F8SA 3T2YA 1GRGA 2B7SA 4H2QA 5KNLA 3LJPA 4WX1A 3UTGA 3D1CA 4K2XA 1NG4A 4ZN0A 2YM2A 1H7XA 1IUVA 3DJDA 5KRQA 1D7YA 3GRSA 4LA1A 4U8OA 5JCMA 2V5ZA 2YVFA 1M6IA 1ZOVA 4BK1A 3RHAA 2YR6A 5BVAA 2W0HA 4H4WA 3V3NA 2YAUA 4EQRA 2B9XA 2C7GA 2WHDA 2YLRA 1LPFA 1HYUA 2TMDA 1KSSA 1QO8A 2XLUA 3M13A 2RGOA 3AEFA 1Q1WA 4G73A 1B37A 5JRBA 2Q0LA 2BXSA 2RGJA 1KNRA 2BCGG 2XLPA 3UOZA 1D5TA 4EMIA 3PO7A 1CJ2A 1PJ5A 4P9SA 3BNUA 1ZOYA 4IV9A 1FECA 1NG3A 4Y4MA 3GRTA 4H4VA 4B1BA 1MOKA 1D4EA 2YWLA 3REDA 1OJ9A 5TR3A 1P2EA 2C76A 1EBDA 3DK4A 3AE2A 2Q6UA 3GSIA 3HYXA 4YTNA 2ZZCA 3UCLA 4C77A 3CNSA 1EL5A 1FL2A 4XWRA 5KVHA 3I3LA 1GOSA 2YG3A 4B67A 2WDRA 3KPKA 3NG7X 4YT0A 1GEUA 2WESA 3KLJA 2XFQA 1XDIA 4XWZA 1CJ3A 5JCKA 2YG7A 1V59A 1ZY8A 1N4UA 2FJBA 3NNEA 3AXBA 3P4RA 3NIXA 5GRTA 4A65A 5JCNA 1VG0A 1GRHA 3DH9A 4H7UA 3F8DA 1YQ3A 2C72A 1GT8A 3H8LA 4J34A 4A9WA 1H81A 2BS2A 3ZYXA 2APGA 2GR0A 2OLNA 2JKCA 3UOYA 4Z43A 3CN8A 2YLZA 3LB8A 1PBDA 5IQ4A 1BZLA 1Q9IA 4J56A 4CNJA 2FJAA 1LQTA 2R0CA 2XCGA 2YG4A 4CCQA 3F8PA 3VR8A 4YSXA 2DKIA 4JN9A 2C65A 2YLWA 2J3NA 1YKJA 2YLXA 2CFYA 3GYJA 2AR8A 3GYIA 1QJDA 4JNQA 4H4TA 3CPIG 4BJYA 4B66A 4DGKA 4YKGA 4YSZA 3UOXA 2BRYA 5KWFA 1L9CA 1PBBA 1L9EA 3IF9A 1DOCA 1PBEA 4ZCDA 4Z2TA 2A87A 2O9ZA 4AOXA 3GWDA 4OPLA 3URHA 2OA1A 1X31B 2BA9A 5CQFA 4J31A 5U25A 1S2QA 4REKA 4DSGA 1PDHA 2GMJA 1GALA 1GPEA 4II3A 3CNDA 3CGBA 1TDOA 3QSSA 3FPZA 3UTHA 1GXFA 1K0JA 4OPGA 4X9MA 1CC4A 1NHRA 3CTYA 3NLCA 4U8MA 4OPTA 1BGNA 4NWZA 1IUUA 1JRYA 1P2HA 2ZBWA 4YXDA 3ICRA 4B65A 4JNAA 4LU6A 5BULA 4OPCA 2GEWA 4M52A 2X8CA 3G5QA 4OPIA 2Z5XA 5KMSA 3DGHA 4DSHA 2YVJA 1PXCA 4AT2A 4H50A 2E1MA 2XVIA 4MJWA 3NYCA 3NTDA 3V76A 4FK1C 3DJJA 2VRLA 4TLXA 4H2PA 2BABA 2OLOA 3UKAA 4UDRA 2CVJA 4KPRA 3K7TA 5EB4A 3S5WA 3PS9A 3SYIA 3O0HA 2EQ6A 1CC2A 3NGCX 5JCIA 4AP1A 4CY8A 4GF7A 3AYLA 2V61A 3HZLA 2EQ7A 3C4NA 1E39A 2BK3A 3COXA 3AYIA 3JSKA 5IPYA 1PHHA 2YLSA 4U2LA 2GV8A 3ICTA 2JK6A 4UP3A 4Z44A 1PXBA 4TLZA 1RYIA 1F3PA 3T0KA 2HQMA 1FEAA 3AE5A 1IUXA 1Y0PA 3BI2A 3P4PA 4U8KA 3GWFA 2A8XA 2UZZA 1GREA 4H4SA 1AOGA 2BC1A 1MO9A 1F6MA 2TPRA 1BKWA 1REOA 3P1WA 4A99A 1UKVG 2BXRA 2VVMA 1JRZA 1Z6LA 3UP4A 2YG5A 4DNAA 4RG3A 4J57A 5EB5A 4Z25A 1K4QA 5HHFA 1GERA 1N1PA 3R9UA 5HY5A 4CNKA 4UDPA 1ONFA 3OC4A 3QSEA 4O5UA 2C70A 4K8DA 3H4KA 2VRMA 1NEKA 3VQRA 1E1KA 4FDCB 4Z26A 1JU2A 4NTDA 1TDEA 3SGLA 4EMWA 4GDEA 4B68A 4EIQA 4JQ9A 1RP0A 2FJEA 3DJEA 3VRBA 1S3BA 2C67A 5JCLA 3K7QX 3UP5A 4YTMA 4BK3A 5KMRA 1LQUA 3UKLA 1KDGA 4D03A 3ATRA 3RP8A 1SEZA 3V3OA 2I0ZA 1DOBA 4GDPA 3IC9A 3CMMA 2WP5A 3AE9A 4U8JA 2Z5YA 2WP6A 3SFDA 3AD8B 4OVIA 3DK8A 3DGZA 3QSMA 2Q0KA 1KFYA 1ELIA 5BRTA 3EF6A 1IUTA 4TM4A 4NEVA 3ICSA 1JRXA 4X4JA 4APNA 3KD9A 1S3EA 3BI5A 1PJ6A 1H82A 3EAOA 4H4ZA 1LV0A 4USRA 5M10A 1F8RA 2R9ZA 2C66A 2PYXA 3FMWA 3NN0X 3SX6A 5BUKA 3AEDA 3CNPA 2V3AA 1PBFA 3H8IA 2WPCA 3I6DA 4FK1A 4CY6A 2X8HA 3VRAA 3GYXA 1NAAA 1XHCA 3AECA 3ALLA 2WU5A 3DK9A 2C75A 3SZWA 1EL9A 3QJ4A 5FS7A 4KX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K22 A;  2X50 A;  5FMH A;  2C64 A;  2VQB A;  3S61 A;  1PXA A;  1TDK A;  2B7R A;  5C3J A;  3NYF A;  2IVE A;  4ICY A;  2GQW A;  1ZMD A;  1ZX9 A;  1YQZ A;  4Y4N A;  3VR9 A;  2A89 A;  4B69 A;  4TM1 A;  1E1N A;  3FG2 P;  4YSY A;  4RSL A;  3M12 A;  1LTX R;  4I59 A;  1GTH A;  4AP3 A;  4YWO A;  1D4D A;  1YY5 A;  5HXI A;  4H4P A;  1KF6 A;  3GMC A;  4YSH A;  3LXD A;  4Z2R A;  3T37 A;  4EIP A;  5FS6 A;  3IHM A;  3CGC A;  1GTE A;  5FS9 A;  2BS3 A;  4K5S A;  5HYM A;  2IID A;  2V3B A;  2WPF A;  2GMH A;  4IA6 A;  4RG4 A;  4B63 A;  2H89 A;  2B9W A;  2WP9 A;  4NTC A;  4OPU A;  4N9X A;  2BS4 A;  3NT6 A;  3ITJ A;  1B5Q A;  4A7A A;  4CCR A;  1DOE A;  3CPH G;  2XYO A;  3KVE A;  2IVD A;  2NVK X;  3ATQ A;  1Y56 B;  2H88 A;  3K30 A;  1CF3 A;  1JNR A;  2YG6 A;  3EAN A;  3NYE A;  4A5L A;  4EQW A;  4CBQ A;  3PVC A;  2RGH A;  1CBO A;  1DXL A;  3ISH A;  4JY3 A;  2OAL A;  1GV4 A;  1H86 A;  1DNC A;  2NPX A;  1E7P A;  2Q7V A;  2GR3 A;  3ALM A;  3AYJ A;  4H2R A;  3KPF A;  2GF3 A;  1D7L A;  1TYP A;  4HA6 A;  4U2S A;  3LAD A;  1K0I A;  2ZZ0 A;  3LZX A;  1O95 A;  2BYB A;  4GUV A;  1PBC A;  4C3X A;  1Q1R A;  1NPX A;  2WPE A;  2GB0 A;  3D8X A;  3RNM A;  3BNM A;  4XXG A;  1S2Y A;  5IQ1 A;  1VQW A;  4J33 A;  2GAG B;  1GRT A;  4AOS A;  4K5R A;  3NHO X;  4TM0 A;  2YR5 A;  2YQU A;  3AE3 A;  1E1M A;  3CIR A;  4I58 A;  4A6N B;  2Y6R A;  1PS9 A;  4H4Y A;  2C73 A;  2XLR A;  3CGE A;  3WE0 A;  1LJ1 A;  1FOH A;  4EQX A;  1OJC A;  2R4E A;  2XFP A;  4H4U A;  2R0P A;  3AEB A;  5J7X A;  2R0G A;  3UKF A;  2X99 A;  1EL7 A;  1NEN A;  3II4 A;  3UKK A;  3E1T A;  2XVF A;  1GRB A;  1VG9 A;  3EPT A;  3AEG A;  4JDR A;  3QVP A;  4AT0 A;  4J36 A;  4H4X A;  3AD7 B;  2CDU A;  2XVJ A;  3L1R A;  1FCD A;  4EQS A;  2FBW A;  1F8W A;  3GD4 A;  1TDF A;  1DJQ A;  1GSN A;  4X9N A;  3KKJ A;  4C5O A;  2FJD A;  3LZW A;  5DBJ A;  4C74 A;  2GVC A;  2VVL G;  1N4W A;  3CPJ G;  4USQ A;  5L46 A;  2R45 A;  3AEE A;  3FBS A;  3SFE A;  4GRT A;  5KOW A;  2XFO A;  2XDO A;  4U8P A;  2EQ9 A;  1H6V A;  4WCT A;  1K0L A;  1YQ4 A;  3C4A A;  2XFN A;  2WEU A;  4GCM A;  1ZMC A;  3NK2 X;  4IA5 A;  1ZDL A;  2JBV A;  5LV9 A;  1EL8 A;  3GDN A;  3K7M X;  2GR1 A;  2QA2 A;  2RAB A;  4ADW A;  2ACZ A;  4GR1 A;  3G5R A;  4U8I A;  1B8S A;  1BGJ A;  3UKH A;  1DJN A;  4H2N A;  2YR4 A;  1CJC A;  3KU9 A;  4B64 A;  1NHQ A;  2BAC A;  2CUL A;  3DME A;  2JB1 A;  3NTA A;  4O5Q A;  1JNZ A;  1TYT A;  3ADA B;  4EMJ A;  4JY2 A;  3LOV A;  4A79 A;  3FIM B;  2ZZB A;  4LII A;  2WET A;  1H7W A;  2QA1 A;  3QFB A;  2R46 A;  3G5S A;  3NN6 X;  4BJZ A;  1GND A;  4NEW A;  3CGD A;  4HB9 A;  4PAB A;  2X8G A;  1PN0 A;  2QCU A;  1CJ4 A;  1L0V A;  1QLB A;  1BWC A;  1VDC A;  1ZK7 A;  1CL0 A;  2BK5 A;  2ARD A;  2YM1 A;  1DOD A;  1NHS A;  4BUR A;  4PAA A;  3UTF A;  3DJG X;  4EM3 A;  4CRT A;  3Q6J A;  2XFU A;  2YLT A;  2GQF A;  1OJT A;  2YVG A;  3Q9T A;  3NK1 X;  2JAE A;  5KVI A;  2WQY A;  4K7Z A;  1OJA A;  3B6D A;  2VZ2 A;  3SM8 A;  1OJD A;  3BHF A;  3AEA A;  4ECH A;  2JB2 A;  1PJ7 A;  2C3D A;  2WU2 A;  1RSG A;  4TM3 A;  3B3R A;  4IVO B;  4YTP A;  1TDN A;  3IWA A;  4EM4 A;  3AE7 A;  5ER0 A;  1GET A;  1H84 A;  3DA1 A;  3P9U A;  4OCG A;  1W4X A;  3GMB A;  3UKQ A;  4D04 A;  4E0V A;  2V60 A;  4H4R A;  3F8R A;  2AAQ A;  5C2T A;  3P4Q A;  1IJH A;  1JOA A;  1MXT A;  3QVR A;  4U2T A;  4U8L A;  2F5Z A;  3NKS A;  1XPQ A;  3QFA A;  1Y56 A;  3AE4 A;  4IVM B;  4YKF A;  3UOV A;  2WBA A;  1NHP A;  2EQ8 A;  5CKU A;  3NRN A;  3OZ2 A;  3NK0 X;  2QAE A;  2WDV A;  1D4C A;  3CNJ A;  2JB3 A;  3P4S A;  1CC6 A;  1O94 A;  2BCP A;  3AWI A;  5KXJ A;  1B4V A;  2XVE A;  3IHG A;  5FS8 A;  3AB1 A;  4Y4L A;  3RP6 A;  3AE1 A;  2OAM A;  1IUW A;  1VRQ B;  1FEB A;  1XAN A;  3VRD B;  2BC0 A;  2GR2 A;  1E6E A;  5EOW A;  1ZKQ A;  2C3C A;  3C96 A;  2B9Y A;  2B76 A;  2VVL A;  1H83 A;  3BI4 A;  2E5V A;  1O5W A;  2BK4 A;  4Z24 A;  1TRB A;  4FX9 A;  2GRT A;  1COY A;  2WDQ A;  2XVH A;  4U8N A;  1N4V A;  2R4J A;  2XLS A;  2X3N A;  3AE8 A;  4ZCC A;  3RP7 A;  4C3Y A;  1GRA A;  2GAH B;  5GSN A;  1KSU A;  3UKP A;  2VOU A;  2Y6Q A;  4NZH A;  3KA7 A;  3AE6 A;  4A6N A;  3AD9 B;  1KNP A;  4H4Q A;  3ZDN A;  1JEH A;  2V6O A;  1L9D A;  3UTE A;  3ABV A;  1ZP0 A;  1IUS A;  1NDA A;  2E4G A;  3ALJ A;  4J2W A;  3SQP A;  2WOV A;  3M0O A;  4OPD A;  5M0Z A;  4BK2 A;  2WOI A;  5U63 A;  1GES A;  5J60 A;  1E1L A;  1LVL A;  2WS3 A;  5U1O A;  1CHU A;  4UDQ A;  5KOX A;  4NTE A;  2VQ7 A;  1BF3 A;  2AQJ A;  3GDP A;  2DKH A;  3NH3 X;  5EBK A;  3BHK A;  1GRF A;  3L8K A;  4Z2U A;  1M64 A;  3GD3 A;  4BV6 A;  2XLT A;  2GH5 A;  2PHH A;  2WOW A;  3CNT A;  1F8S A;  1GRG A;  2B7S A;  4H2Q A;  3LJP A;  4WX1 A;  3UTG A;  3D1C A;  4K2X A;  1NG4 A;  4ZN0 A;  2YM2 A;  1H7X A;  1IUV A;  3DJD A;  5KRQ A;  1D7Y A;  3GRS A;  4LA1 A;  4U8O A;  5JCM A;  2V5Z A;  2YVF A;  1M6I A;  1ZOV A;  4BK1 A;  3RHA A;  2YR6 A;  5BVA A;  2W0H A;  4H4W A;  3V3N A;  2YAU A;  4EQR A;  2B9X A;  2C7G A;  2WHD A;  2YLR A;  1LPF A;  1HYU A;  2TMD A;  1KSS A;  1QO8 A;  2XLU A;  3M13 A;  2RGO A;  3AEF A;  1Q1W A;  1B37 A;  2Q0L A;  2BXS A;  2RGJ A;  1KNR A;  2BCG G;  2XLP A;  3UOZ A;  1D5T A;  4EMI A;  3PO7 A;  1CJ2 A;  1PJ5 A;  4P9S A;  3BNU A;  1ZOY A;  4IV9 A;  1FEC A;  1NG3 A;  4Y4M A;  3GRT A;  4H4V A;  4B1B A;  1MOK A;  1D4E A;  2YWL A;  3RED A;  1OJ9 A;  5TR3 A;  1P2E A;  2C76 A;  1EBD A;  3DK4 A;  3AE2 A;  2Q6U A;  3GSI A;  4YTN A;  2ZZC A;  3UCL A;  4C77 A;  3CNS A;  1EL5 A;  1FL2 A;  4XWR A;  5KVH A;  3I3L A;  1GOS A;  2YG3 A;  4B67 A;  2WDR A;  3NG7 X;  4YT0 A;  1GEU A;  2WES A;  3KLJ A;  2XFQ A;  1XDI A;  4XWZ A;  1CJ3 A;  5JCK A;  2YG7 A;  1V59 A;  1ZY8 A;  1N4U A;  2FJB A;  3NNE A;  3AXB A;  3P4R A;  3NIX A;  5GRT A;  4A65 A;  5JCN A;  1VG0 A;  1GRH A;  3DH9 A;  4H7U A;  3F8D A;  1YQ3 A;  2C72 A;  1GT8 A;  3H8L A;  4J34 A;  4A9W A;  1H81 A;  2BS2 A;  3ZYX A;  2APG A;  2GR0 A;  2OLN A;  2JKC A;  3UOY A;  4Z43 A;  3CN8 A;  2YLZ A;  3LB8 A;  1PBD A;  5IQ4 A;  1BZL A;  1Q9I A;  4J56 A;  4CNJ A;  2FJA A;  1LQT A;  2R0C A;  2XCG A;  2YG4 A;  4CCQ A;  3F8P A;  3VR8 A;  4YSX A;  2DKI A;  4JN9 A;  2C65 A;  2YLW A;  2J3N A;  1YKJ A;  2YLX A;  2CFY A;  3GYJ A;  2AR8 A;  3GYI A;  1QJD A;  4JNQ A;  4H4T A;  3CPI G;  4BJY A;  4B66 A;  4DGK A;  4YKG A;  4YSZ A;  3UOX A;  5KWF A;  1L9C A;  1PBB A;  1L9E A;  3IF9 A;  1DOC A;  1PBE A;  4ZCD A;  4Z2T A;  2A87 A;  2O9Z A;  4AOX A;  3GWD A;  4OPL A;  3URH A;  2OA1 A;  1X31 B;  2BA9 A;  5CQF A;  4J31 A;  5U25 A;  1S2Q A;  4REK A;  4DSG A;  1PDH A;  2GMJ A;  1GAL A;  1GPE A;  3CND A;  3CGB A;  1TDO A;  3QSS A;  3FPZ A;  3UTH A;  1GXF A;  1K0J A;  4OPG A;  4X9M A;  1CC4 A;  1NHR A;  3CTY A;  3NLC A;  4U8M A;  4OPT A;  1BGN A;  1IUU A;  1JRY A;  1P2H A;  2ZBW A;  4YXD A;  3ICR A;  4B65 A;  4JNA A;  4LU6 A;  5BUL A;  4OPC A;  2GEW A;  4M52 A;  2X8C A;  3G5Q A;  4OPI A;  2Z5X A;  3DGH A;  4DSH A;  2YVJ A;  1PXC A;  4AT2 A;  4H50 A;  2E1M A;  2XVI A;  4MJW A;  3NYC A;  3NTD A;  3V76 A;  4FK1 C;  3DJJ A;  2VRL A;  4TLX A;  4H2P A;  2BAB A;  2OLO A;  3UKA A;  4UDR A;  2CVJ A;  4KPR A;  3K7T A;  5EB4 A;  3S5W A;  3PS9 A;  3O0H A;  2EQ6 A;  1CC2 A;  3NGC X;  5JCI A;  4AP1 A;  4CY8 A;  4GF7 A;  3AYL A;  2V61 A;  3HZL A;  2EQ7 A;  3C4N A;  1E39 A;  2BK3 A;  3COX A;  3AYI A;  3JSK A;  5IPY A;  1PHH A;  2YLS A;  4U2L A;  2GV8 A;  3ICT A;  2JK6 A;  4UP3 A;  4Z44 A;  1PXB A;  4TLZ A;  1RYI A;  1F3P A;  2HQM A;  1FEA A;  3AE5 A;  1IUX A;  1Y0P A;  3BI2 A;  3P4P A;  4U8K A;  3GWF A;  2A8X A;  2UZZ A;  1GRE A;  4H4S A;  1AOG A;  2BC1 A;  1MO9 A;  1F6M A;  2TPR A;  1BKW A;  1REO A;  3P1W A;  4A99 A;  1UKV G;  2BXR A;  2VVM A;  1JRZ A;  1Z6L A;  3UP4 A;  2YG5 A;  4DNA A;  4RG3 A;  4J57 A;  5EB5 A;  4Z25 A;  1K4Q A;  5HHF A;  1GER A;  1N1P A;  3R9U A;  5HY5 A;  4CNK A;  4UDP A;  1ONF A;  3OC4 A;  3QSE A;  4O5U A;  2C70 A;  4K8D A;  3H4K A;  2VRM A;  1NEK A;  3VQR A;  1E1K A;  4FDC B;  4Z26 A;  1JU2 A;  4NTD A;  1TDE A;  3SGL A;  4EMW A;  4GDE A;  4B68 A;  4EIQ A;  4JQ9 A;  1RP0 A;  2FJE A;  3DJE A;  3VRB A;  1S3B A;  2C67 A;  5JCL A;  3K7Q X;  3UP5 A;  4YTM A;  4BK3 A;  1LQU A;  3UKL A;  1KDG A;  4D03 A;  3ATR A;  3RP8 A;  1SEZ A;  3V3O A;  2I0Z A;  1DOB A;  4GDP A;  3IC9 A;  4U8J A;  2WP5 A;  3AE9 A;  2Z5Y A;  2WP6 A;  3SFD A;  3AD8 B;  4OVI A;  3DK8 A;  3DGZ A;  3QSM A;  2Q0K A;  1ELI A;  1KFY A;  5BRT A;  3EF6 A;  1IUT A;  4TM4 A;  4NEV A;  3ICS A;  1JRX A;  4X4J A;  4APN A;  3KD9 A;  1S3E A;  3BI5 A;  1PJ6 A;  1H82 A;  3EAO A;  4H4Z A;  1LV0 A;  4USR A;  5M10 A;  1F8R A;  2R9Z A;  2C66 A;  2PYX A;  3FMW A;  3NN0 X;  5BUK A;  3AED A;  3CNP A;  2V3A A;  1PBF A;  3H8I A;  2WPC A;  3I6D A;  4FK1 A;  4CY6 A;  2X8H A;  3VRA A;  1NAA A;  1XHC A;  3AEC A;  3ALL A;  2WU5 A;  3DK9 A;  2C75 A;  1EL9 A;  3QJ4 A;  5FS7 A;  4KX6 A; 
#chains in the Genus database with same CATH topology
 4K22 A;  2X50 A;  4K1W A;  2VQB A;  3NYF A;  4TM1 A;  1GTH A;  5FJT A;  4Z2R A;  3T37 A;  4EIP A;  5ENL A;  3IHM A;  2BS3 A;  2IID A;  2V3B A;  4DX3 A;  4B63 A;  3UCD A;  4OPU A;  1R6W A;  1DOE A;  2IVD A;  3KVE A;  4Z43 A;  1Y56 B;  1JNR A;  2FYM A;  2PGW A;  1FHU A;  3ZLH A;  2OAL A;  2Q7V A;  3ALM A;  3AYJ A;  1TYP A;  4U2S A;  3V5C A;  1O95 A;  4C3X A;  3RNM A;  3BNM A;  4XXG A;  1S2Y A;  1VQW A;  4J33 A;  4AOS A;  3NHO X;  3T2Z A;  2GDQ A;  3CIR A;  3L5O A;  3RIT A;  4EQX A;  3AEB A;  2R0G A;  3UKF A;  2X99 A;  4HPN A;  3II4 A;  3UKK A;  4HNL A;  1VG9 A;  4JDR A;  3QVP A;  1N63 C;  4ENL A;  2CDU A;  4YWS A;  3QPE A;  4EQS A;  3GD4 A;  2GGJ A;  4C5O A;  4C74 A;  2GVC A;  2R45 A;  3FBS A;  3SFE A;  3ES8 A;  4U8P A;  1XPY A;  4G7F A;  1RM6 B;  1EL8 A;  2GR1 A;  2QA2 A;  1WUE A;  2RAB A;  2ACZ A;  3UKH A;  1CJC A;  4B64 A;  1JNZ A;  4JY2 A;  4A79 A;  1ZXI C;  2ZZB A;  4LII A;  2WET A;  3QFB A;  4NNJ A;  4HB9 A;  1PN0 A;  3QN3 A;  2YM1 A;  3PK7 A;  4PAA A;  3DJG X;  3UJE A;  3Q6J A;  2YVG A;  2XSX A;  3SZC A;  5KVI A;  4K7Z A;  2HXT A;  3HW2 A;  2GGH A;  2PTW A;  4EM4 A;  1W4X A;  3UJS A;  3T4W A;  4H4R A;  3D47 A;  2AAQ A;  1IJH A;  1PDZ A;  1JOA A;  3QVR A;  2F5Z A;  1XPQ A;  1Y56 A;  5CKU A;  3ES7 A;  2QAE A;  1KD0 A;  1D4C A;  1CC6 A;  3AWI A;  3IHG A;  4HYR A;  4A3R A;  1SJA A;  2OAM A;  1FEB A;  1EC7 A;  2BC0 A;  4DN1 A;  1KN0 A;  2B76 A;  2E5V A;  3SZ0 A;  2BRA A;  1COY A;  3AMZ A;  1F9C A;  4H1Z A;  1PDY A;  2VOU A;  2Y6Q A;  2GGG A;  3AD9 B;  1KNP A;  2P3Z A;  3UTE A;  2QDE A;  1IUS A;  2E4G A;  3ALJ A;  4J2W A;  2HZG A;  5U63 A;  1GES A;  3CK5 A;  5U1O A;  3DG3 A;  1BF3 A;  2AQJ A;  3BHK A;  3L8K A;  4BV6 A;  2XLT A;  2GH5 A;  3PWI A;  5EU9 A;  4H2Q A;  4WX1 A;  3ENL A;  4KPL A;  4Z17 A;  1JPM A;  3Q4D A;  1ZOV A;  2POD A;  4KWS A;  2B9X A;  2C7G A;  2WHD A;  1HYU A;  2TMD A;  1KKR A;  2RGJ A;  2XLP A;  3UOZ A;  1PJ5 A;  4P9S A;  3GRT A;  4B1B A;  1D4E A;  2YWL A;  3HYX A;  5TR3 A;  1OJ9 A;  3AE2 A;  4YTN A;  3DK4 A;  2ZZC A;  1EL5 A;  1FL2 A;  4IHC A;  1MDL A;  4HCL A;  1GOS A;  4E8G A;  2XFQ A;  1P48 A;  5JCK A;  3R1Z A;  1V59 A;  1ZY8 A;  3OTR A;  3SQS A;  3JW7 A;  5GRT A;  3MSY A;  1ECQ A;  1N5W C;  3H8L A;  2BS2 A;  2APG A;  3P3B A;  2JKC A;  3UOY A;  4H19 A;  2R0C A;  3IK4 A;  4JN9 A;  2GGE A;  2YLX A;  3B9J B;  4DGK A;  5BUK A;  1DOC A;  1PBE A;  4Z2T A;  4AOX A;  4M6U A;  1X31 B;  2PP3 A;  4J31 A;  5U25 A;  1S2Q A;  4DSG A;  4GGB A;  3A7R A;  3FPZ A;  4OPT A;  2DW7 A;  1P2H A;  2ZBW A;  3ICR A;  4B65 A;  4JNA A;  2GEW A;  5KMS A;  2Z5X A;  4DSH A;  1MNS A;  1PXC A;  4AT2 A;  4H50 A;  3NTD A;  3DJJ A;  2OLO A;  3UKA A;  4X2P A;  2CVJ A;  3SYI A;  5JCI A;  3V3W A;  4IP4 A;  3HZL A;  3JSK A;  3TCS A;  1E39 A;  3COX A;  2YLS A;  4U2L A;  4DHG A;  4TLZ A;  2HQM A;  3AE5 A;  1X2G A;  1Y0P A;  3BI2 A;  2DW6 A;  2UZZ A;  1REO A;  4A99 A;  2BXR A;  2PTX A;  1FO4 A;  1Z6L A;  2QJM A;  1DTN A;  4Z25 A;  1K4Q A;  2GSH A;  5IDZ A;  5HHF A;  4CNK A;  2OX4 A;  3SBF A;  3QSE A;  3AN1 A;  3JVA A;  4FDC B;  1ELS A;  1ONE A;  1TDE A;  4TVW A;  4E5T A;  1S3B A;  2C67 A;  3BSM A;  3VC6 A;  5JCL A;  4YTM A;  3UP5 A;  4D03 A;  3ATR A;  3V3O A;  2W55 A;  1DOB A;  3CMM A;  3DK8 A;  3DGZ A;  1KFY A;  4TM4 A;  1SJC A;  4NEV A;  3ICS A;  3MWC A;  1S3E A;  2R9Z A;  3NN0 X;  1OEP A;  3SX6 A;  3FJ4 A;  2V3A A;  3H8I A;  2WPC A;  1N5X A;  3I6D A;  4CY6 A;  3VRA A;  2OZ3 A;  3AEC A;  3ALL A;  2WU5 A;  2C64 A;  3S61 A;  1TDK A;  5C3J A;  1ZX9 A;  4B69 A;  3U9I A;  4RSL A;  1LTX R;  4AP3 A;  3R0U A;  1D4D A;  4IT1 A;  1YY5 A;  1GTE A;  2B9W A;  1FHV A;  3GY1 A;  3ITJ A;  3UGV A;  2C4C A;  2XYO A;  2NVK X;  3ATQ A;  2H88 A;  4A5L A;  4H83 A;  4M0X A;  2RGH A;  1GV4 A;  1DNC A;  2GR3 A;  4G74 A;  3KPF A;  4IL0 A;  1K0I A;  1BKH A;  2ZZ0 A;  1NPX A;  2WPE A;  3NFU A;  4DYE A;  5IQ1 A;  3SN0 A;  1GRT A;  3ZVI A;  4TM0 A;  4I58 A;  4H4Y A;  3SXI A;  1FOH A;  2XFP A;  3SY4 A;  2W3S A;  4H4U A;  1EL7 A;  2XVF A;  3EPT A;  3UXK A;  4J36 A;  3AD7 B;  3L1R A;  2FBW A;  1F8W A;  5BOE A;  3STP A;  2FJD A;  3LZW A;  5DBJ A;  3HPF A;  2OFJ A;  4GRT A;  2XFO A;  2XFN A;  4GCM A;  3DGB A;  4KEM A;  4IA5 A;  2JBV A;  4ADW A;  3DDM A;  4O5Q A;  4Z1Y A;  1TYT A;  3ADA B;  3FCP A;  1H7W A;  2QA1 A;  3SN4 A;  3UJF A;  2R46 A;  3NN6 X;  1GND A;  3NRZ B;  4EWJ A;  2X8G A;  1CJ4 A;  1BWC A;  4TVY A;  1VDC A;  3TOY A;  2BK5 A;  3DER A;  3GD6 A;  3N6H A;  3Q9T A;  3NK1 X;  2WQY A;  3CXB A;  2VZ2 A;  3BHF A;  3NO1 A;  2C3D A;  4TM3 A;  3B3R A;  1TDN A;  2AL2 A;  3IWA A;  2P8C A;  5ER0 A;  1H84 A;  3DA1 A;  3VFC A;  1EBH A;  3MZN A;  3P9U A;  4OCG A;  1TE6 A;  2V60 A;  2OQH A;  1MXT A;  4U8L A;  3AE4 A;  3QFA A;  4IVM B;  2OQY A;  2WBA A;  2EQ8 A;  5FJO A;  1O94 A;  4Y4L A;  5FS8 A;  1FFV C;  1IUW A;  2GR2 A;  1E6E A;  1ZKQ A;  3I6T A;  2VVL A;  1H83 A;  3BI4 A;  2BK4 A;  4H2H A;  1TRB A;  4FX9 A;  2GRT A;  2WDQ A;  2XVH A;  4ZCC A;  3AE8 A;  1GRA A;  3UKP A;  4FI4 A;  3AE6 A;  4H4Q A;  3P0W A;  3ABV A;  1NDA A;  3SQP A;  1KCZ A;  4BK2 A;  3RCY A;  2HXU A;  3IJI A;  3TW9 A;  2WS3 A;  1LVL A;  1CHU A;  4UDQ A;  5KOX A;  4NTE A;  5EBK A;  1M64 A;  3GD3 A;  1IYX A;  3TJI A;  2WOW A;  3SZF A;  1F8S A;  3UTG A;  1NG4 A;  4ZN0 A;  1IUV A;  3DJD A;  3GRS A;  3MUC A;  4LA1 A;  2V5Z A;  1M6I A;  3IJL A;  1LPF A;  2RGO A;  1VQZ A;  4G73 A;  5JRB A;  2Q0L A;  3PO7 A;  1CJ2 A;  4DXK A;  4IV9 A;  1FEC A;  4MMW A;  1NG3 A;  4Y4M A;  1MOK A;  1P2E A;  2C76 A;  3OZY A;  4XWR A;  5KVH A;  1MDR A;  2YG3 A;  3JZU A;  3KPK A;  2WES A;  4XWZ A;  2FJB A;  3NNE A;  3P4R A;  4GYP C;  4J34 A;  4A9W A;  3DIP A;  3EEZ A;  3CN8 A;  3LB8 A;  1BZL A;  6ENL A;  1LQT A;  4CCQ A;  7ENL A;  2C65 A;  4JNQ A;  2CFY A;  3OP2 A;  1QJD A;  3CPI G;  4B66 A;  4YKG A;  2PU1 A;  3I6E A;  3URH A;  4REK A;  2NQL A;  2GMJ A;  1GPE A;  3UTH A;  4X9M A;  4U8M A;  1BGN A;  1IUU A;  1JRY A;  3DG7 A;  3IJQ A;  4OPC A;  4M52 A;  1WYG A;  3DGH A;  2E1M A;  3OPS A;  3NYC A;  1BQG A;  3ZLF A;  5EB4 A;  3N6J A;  3UCC A;  3PS9 A;  3V5F A;  1CC2 A;  4AP1 A;  4CY8 A;  4GF7 A;  2GV8 A;  3ICT A;  2MNR A;  4UP3 A;  4Z44 A;  1PXB A;  3T0K A;  1JPD X;  3R25 A;  2A8X A;  2PP1 A;  4H4S A;  1MO9 A;  1F6M A;  3DEQ A;  1BKW A;  2ONE A;  4GYP A;  2YG5 A;  1N62 C;  4UDP A;  1ONF A;  3CXO A;  4K8D A;  3H4K A;  1NEK A;  1E1K A;  3SGL A;  4GIR A;  2FJE A;  4BK3 A;  3S5S A;  1LQU A;  1SEZ A;  1W6T A;  3SSZ A;  2WP5 A;  3AE9 A;  3QSM A;  1EBG A;  1JRX A;  4APN A;  3KD9 A;  3BI5 A;  2OPJ A;  3ZVH A;  4H4Z A;  1LV0 A;  1JCT A;  3GYX A;  1NAA A;  1XHC A;  3DK9 A;  3EUB 3;  5FJR A;  4IL2 A;  2HNE A;  1TKK A;  4KX6 A;  5FMH A;  1FIQ B;  1PXA A;  2B7R A;  2GQW A;  1YQZ A;  2A89 A;  4FP1 A;  1E1N A;  4YSY A;  4I59 A;  2PA6 A;  4GME A;  4YWO A;  5HXI A;  3UJ2 A;  4A35 A;  4YSH A;  3LXD A;  5FS6 A;  3CGC A;  5FS9 A;  2QJN A;  4K5S A;  2WPF A;  3A7A A;  4IA6 A;  4RG4 A;  2WP9 A;  4NTC A;  4N9X A;  2BS4 A;  3NT6 A;  1P43 A;  2PTZ A;  3CPH G;  4MGG A;  3K30 A;  3NYE A;  1CF3 A;  2YG6 A;  3EAN A;  1EC9 A;  2XGZ A;  3AM9 A;  1CBO A;  3A7U A;  4H2R A;  1D7L A;  2FKP A;  4G6H A;  4HA6 A;  3LAD A;  3LZX A;  4GUV A;  1PBC A;  1Q1R A;  2GB0 A;  3D8X A;  3T6C A;  3TJ4 A;  1E1M A;  4A6N B;  2Y6R A;  2XLR A;  2PS2 A;  3CGE A;  3WE0 A;  1LJ1 A;  2R4E A;  5J7X A;  2RDX A;  3E1T A;  1GRB A;  4JN8 A;  2P88 A;  4AT0 A;  1KKO A;  4HNC A;  2XVJ A;  1FCD A;  3GO2 A;  5KMQ A;  1N61 C;  3RO6 A;  1DJQ A;  4X9N A;  2XH0 A;  3CPJ G;  1S7M A;  4USQ A;  1SJD A;  2EQ9 A;  1H6V A;  1K0L A;  1YQ4 A;  4G6G A;  3C4A A;  3THU A;  2PSN A;  1ZDL A;  5LV9 A;  3GDN A;  2QQ6 A;  4U8I A;  1B8S A;  1BGJ A;  1DJN A;  1NHQ A;  2BAC A;  4GAP A;  3VC5 A;  3CGD A;  1X2H A;  2GL5 A;  2QCU A;  1L0V A;  1QLB A;  1CL0 A;  2ARD A;  1NHS A;  4II2 A;  4CRT A;  3TQP A;  2XFU A;  3UJR A;  4GFI A;  2GQF A;  1OJT A;  5KMP A;  2JAE A;  1OJA A;  3T9P A;  1OJD A;  3AEA A;  3T31 A;  2JB2 A;  2WU2 A;  1RSG A;  4IVO B;  2AL2 B;  3AE7 A;  5BOF A;  4D04 A;  3F8R A;  5C2T A;  4U2T A;  4HCH A;  1NHP A;  3HYV A;  3NRN A;  3OZ2 A;  3P4S A;  5KXJ A;  5FJP A;  2XVE A;  1XAN A;  4J3Z A;  3C96 A;  1VDV A;  4G8T A;  1H2I A;  3R07 C;  4U8N A;  1N4V A;  2R4J A;  3RP7 A;  2GAH B;  4NZH A;  2QGY A;  4A6N A;  4HN8 A;  3M0O A;  4OPD A;  3NVY B;  3NVW B;  5J60 A;  1E1L A;  3GDP A;  3NH3 X;  4Z2U A;  3QLD A;  2PHH A;  2B7S A;  5KNL A;  3LJP A;  3D1C A;  2YM2 A;  5KRQ A;  1D7Y A;  5JCM A;  2YVF A;  4BK1 A;  3V3N A;  4EQR A;  1KSS A;  2XLU A;  1Q1W A;  2AL1 A;  2BCG G;  1D5T A;  3NS1 B;  3RED A;  1EBD A;  3P93 A;  2Q6U A;  4C77 A;  3SJN A;  2PGE A;  3D46 A;  2WDR A;  3NG7 X;  3VA8 A;  3KLJ A;  1XDI A;  1CJ3 A;  1N4U A;  1E9I A;  3AXB A;  4A65 A;  5JCN A;  3DH9 A;  4H7U A;  1YQ3 A;  2C72 A;  2QJJ A;  1H81 A;  2GR0 A;  2CHR A;  1Q9I A;  2W54 A;  2XCG A;  3F8P A;  3VR8 A;  2YLW A;  3V4B A;  2J3N A;  3H8A A;  1YKJ A;  4Y4N A;  3GYJ A;  4H4T A;  4YSZ A;  3RGT A;  5KWF A;  3UOX A;  2BRY A;  1L9C A;  1PBB A;  1L9E A;  2A87 A;  3GWD A;  4OPL A;  2OA1 A;  1PDH A;  2OLA A;  1TDO A;  4OPG A;  3TTE A;  1CC4 A;  3CTY A;  1L8P A;  1JRO A;  4GIS A;  4YXD A;  4LU6 A;  5BUL A;  2X8C A;  3K1G A;  2YVJ A;  2XVI A;  4MJW A;  3VDG A;  4FK1 C;  4H2P A;  2GGI A;  4UDR A;  4KPR A;  3K7T A;  2EQ6 A;  3NGC X;  2P8B A;  3AYL A;  1T3Q C;  2V61 A;  2BK3 A;  3AYI A;  3R11 A;  2JK6 A;  1RYI A;  1F3P A;  4ROP A;  1FEA A;  2E3T A;  3P4P A;  4U8K A;  3DFY A;  1AOG A;  2BC1 A;  3P1W A;  3BOX A;  1UKV G;  2VVM A;  4DNA A;  4RG3 A;  1N1P A;  3R9U A;  3CT2 A;  3OC4 A;  3CB3 A;  4O5U A;  2C70 A;  2VRM A;  2OZ8 A;  3NZG A;  3RR1 A;  1JU2 A;  1NU5 A;  4EMW A;  4JQ9 A;  3K7Q X;  5KMR A;  3UKL A;  1KDG A;  3I4K A;  3RP8 A;  3IC9 A;  4U8J A;  2WP6 A;  3AD8 B;  4OVI A;  3MKC A;  3EF6 A;  1IUT A;  4X4J A;  4IZG A;  1PJ6 A;  3ZVH B;  5M10 A;  3N4E A;  2C66 A;  2E5A A;  2O56 A;  3N4F A;  2PP0 A;  3AED A;  3CNP A;  4FK1 A;  2X8H A;  2I5Q A;  1XS2 A;  1EC8 A;  1EL9 A;  3QJ4 A;  3UTF A;  2IVE A;  4ICY A;  1ZMD A;  3T8Q A;  3VR9 A;  3FG2 P;  3M12 A;  1R0M A;  4H4P A;  1KF6 A;  4ZCW A;  3GMC A;  1NEL A;  5HYM A;  2PMQ A;  2GMH A;  2H89 A;  2AKM A;  2XH4 A;  3BJS A;  3PFR A;  1B5Q A;  4A7A A;  4CCR A;  1FFU C;  4EQW A;  4CBQ A;  4ZOH B;  3PVC A;  1DXL A;  3ISH A;  4JY3 A;  1H86 A;  2NPX A;  3MY9 A;  1E7P A;  2GF3 A;  3TWB A;  1SB3 B;  3T2K A;  4GGH A;  2BYB A;  4GAV A;  4K8G A;  2GAG B;  4K5R A;  2YR5 A;  2YQU A;  3AE3 A;  3PG6 A;  1PS9 A;  2C73 A;  3NXL A;  1OJC A;  3ETR B;  2R0P A;  2OKT A;  1NEN A;  3AEG A;  3T14 A;  3RRA A;  4H4X A;  4E4U A;  1MUC A;  1TDF A;  1GSN A;  1N60 C;  3KKJ A;  2VVL G;  1N4W A;  5L46 A;  3AEE A;  5KOW A;  2XDO A;  4WCT A;  3QKE A;  2PPG A;  2WEU A;  1ZMC A;  1WUF A;  3NK2 X;  3K7M X;  4MKS A;  4GR1 A;  4JN7 A;  3G5R A;  4H2N A;  2YR4 A;  3KU9 A;  2CUL A;  3DME A;  2JB1 A;  3NTA A;  4EMJ A;  3LOV A;  3FIM B;  3H7V A;  2PCE A;  3SR6 B;  3G5S A;  4BJZ A;  4NEW A;  4PAB A;  3DG6 A;  4KT2 A;  4F4R A;  1ZK7 A;  1DOD A;  4BUR A;  4EM3 A;  2YLT A;  2XH2 A;  3UXL A;  2W3R A;  3B6D A;  3SM8 A;  4ECH A;  1PJ7 A;  4YTP A;  3FV9 A;  1GET A;  3HRD C;  3GMB A;  3UKQ A;  4E0V A;  2POZ A;  3P4Q A;  3NKS A;  2P0I A;  4YKF A;  3UOV A;  3H70 A;  3HYW A;  2XH7 A;  3NK0 X;  2WDV A;  3CNJ A;  2JB3 A;  2BCP A;  4E6M A;  1B4V A;  5FJU A;  1JRP A;  3AB1 A;  3RP6 A;  3AE1 A;  1V97 A;  1VRQ B;  3H12 A;  3VRD B;  5EOW A;  2C3C A;  2B9Y A;  1O5W A;  2OO6 A;  3ZLG A;  4Z24 A;  2XLS A;  2X3N A;  3D9X A;  4C3Y A;  5GSN A;  1KSU A;  3KA7 A;  3ZDN A;  1JEH A;  2V6O A;  1L9D A;  1JDF A;  1ZP0 A;  3CAW A;  2WOV A;  3OZM A;  5M0Z A;  2WOI A;  2VQ7 A;  4A6G A;  4K2S A;  2DKH A;  1GRF A;  3KUM A;  4G9K A;  3EKG A;  3CYJ A;  3CNT A;  3T2Y A;  1GRG A;  3NVV B;  4K2X A;  1STZ A;  1H7X A;  4U8O A;  3FXG A;  3MQT A;  2YR6 A;  3RHA A;  2W0H A;  5BVA A;  4H4W A;  2YAU A;  3DFH A;  4J1O A;  2YLR A;  4ZA0 A;  1QO8 A;  3M13 A;  3AEF A;  1B37 A;  1MRA A;  2ZAD A;  3Q45 A;  2BXS A;  1KNR A;  4EMI A;  3BNU A;  1ZOY A;  3U4F A;  4H4V A;  1RVK A;  5G5G B;  2QVH A;  3GSI A;  3UCL A;  3CNS A;  1TZZ A;  3I3L A;  2OVL A;  4B67 A;  2OG9 A;  4YT0 A;  1GEU A;  2YG7 A;  3NIX A;  4E4F A;  1VG0 A;  1GRH A;  3F8D A;  1GT8 A;  3ZYX A;  2OLN A;  2YLZ A;  1PBD A;  5IQ4 A;  4J56 A;  4CNJ A;  3GC2 A;  2FJA A;  2YG4 A;  4YSX A;  2DKI A;  3QTP A;  4BJY A;  2AR8 A;  3GYI A;  5G5H B;  3IF9 A;  4ZCD A;  2O9Z A;  5CQF A;  2BA9 A;  4HCD A;  2PTY A;  5J04 A;  1GAL A;  4II3 A;  3CND A;  3CGB A;  3QSS A;  1GXF A;  1K0J A;  3FYY A;  1NHR A;  3NLC A;  4NWZ A;  3VCN A;  3B97 A;  1SJB A;  3G5Q A;  4OPI A;  3SN1 A;  2QDD A;  2ZC8 A;  3V76 A;  2VRL A;  4TLX A;  2BAB A;  3S5W A;  3O0H A;  3OW1 A;  2EQ7 A;  3C4N A;  4IP5 A;  5IPY A;  1PHH A;  3FVD A;  3R10 A;  3VCC A;  1IUX A;  3GWF A;  2PU0 A;  1GRE A;  2TPR A;  1JRZ A;  3UP4 A;  4J57 A;  5EB5 A;  2MUC A;  1GER A;  3DES A;  5HY5 A;  2OZT A;  3VQR A;  3R0K A;  4Z26 A;  4NTD A;  3S47 A;  4GDE A;  4B68 A;  4EIQ A;  1RP0 A;  3DJE A;  3VRB A;  3PWG A;  1YEY A;  2I0Z A;  2AKZ A;  3NVZ B;  4GDP A;  2Z5Y A;  3SFD A;  4DWD A;  2Q0K A;  1ELI A;  5BRT A;  4JHM A;  1H82 A;  3EAO A;  4USR A;  1F8R A;  2PYX A;  3FMW A;  1PBF A;  2C75 A;  3SZW A;  3TWA A;  5FS7 A; 
#chains in the Genus database with same CATH homology
 4K22 A;  2X50 A;  5FMH A;  2C64 A;  2VQB A;  3S61 A;  1PXA A;  1TDK A;  2B7R A;  5C3J A;  3NYF A;  2IVE A;  4ICY A;  2GQW A;  1ZMD A;  1ZX9 A;  1YQZ A;  4Y4N A;  3VR9 A;  2A89 A;  4B69 A;  4TM1 A;  1E1N A;  3FG2 P;  4YSY A;  4RSL A;  3M12 A;  1LTX R;  4I59 A;  1GTH A;  4AP3 A;  4YWO A;  1D4D A;  1YY5 A;  5HXI A;  4H4P A;  1KF6 A;  3GMC A;  4YSH A;  3LXD A;  4Z2R A;  3T37 A;  4EIP A;  5FS6 A;  3IHM A;  3CGC A;  1GTE A;  5FS9 A;  2BS3 A;  4K5S A;  5HYM A;  2IID A;  2V3B A;  2WPF A;  2GMH A;  4IA6 A;  4RG4 A;  4B63 A;  2H89 A;  2B9W A;  2WP9 A;  4NTC A;  4OPU A;  4N9X A;  2BS4 A;  3NT6 A;  3ITJ A;  1B5Q A;  4A7A A;  4CCR A;  1DOE A;  2C4C A;  3CPH G;  2XYO A;  3KVE A;  2IVD A;  2NVK X;  3ATQ A;  1Y56 B;  2H88 A;  3K30 A;  1CF3 A;  1JNR A;  2YG6 A;  3EAN A;  3NYE A;  4A5L A;  4EQW A;  4CBQ A;  3PVC A;  2RGH A;  1CBO A;  1DXL A;  3ISH A;  4JY3 A;  2OAL A;  1GV4 A;  1H86 A;  1DNC A;  2NPX A;  1E7P A;  2Q7V A;  2GR3 A;  3ALM A;  4G74 A;  3AYJ A;  4H2R A;  3KPF A;  2GF3 A;  1D7L A;  1TYP A;  3T2K A;  4G6H A;  4HA6 A;  4U2S A;  3LAD A;  1K0I A;  2ZZ0 A;  3LZX A;  1O95 A;  2BYB A;  4GUV A;  1PBC A;  4C3X A;  4GAV A;  1Q1R A;  1NPX A;  2WPE A;  2GB0 A;  3D8X A;  3RNM A;  3BNM A;  4XXG A;  1S2Y A;  5IQ1 A;  1VQW A;  4J33 A;  2GAG B;  1GRT A;  4AOS A;  4K5R A;  3NHO X;  4TM0 A;  3T2Z A;  2YR5 A;  2YQU A;  3AE3 A;  3PG6 A;  1E1M A;  3CIR A;  4I58 A;  4A6N B;  2Y6R A;  1PS9 A;  3L5O A;  4H4Y A;  2C73 A;  2XLR A;  3CGE A;  3SXI A;  3WE0 A;  1LJ1 A;  1FOH A;  4EQX A;  1OJC A;  2R4E A;  2XFP A;  4H4U A;  2R0P A;  3AEB A;  5J7X A;  3SY4 A;  2R0G A;  3UKF A;  2X99 A;  1EL7 A;  1NEN A;  3II4 A;  3UKK A;  3E1T A;  2XVF A;  1GRB A;  1VG9 A;  3EPT A;  3AEG A;  4JDR A;  3QVP A;  3T14 A;  4AT0 A;  4J36 A;  4H4X A;  3AD7 B;  2CDU A;  2XVJ A;  3L1R A;  1FCD A;  4EQS A;  2FBW A;  5KMQ A;  1F8W A;  3GD4 A;  1TDF A;  1DJQ A;  1GSN A;  4X9N A;  3KKJ A;  4C5O A;  2FJD A;  3LZW A;  5DBJ A;  4C74 A;  2GVC A;  2VVL G;  1N4W A;  1S7M A;  3CPJ G;  4USQ A;  5L46 A;  2R45 A;  3AEE A;  3FBS A;  3SFE A;  4GRT A;  5KOW A;  2XFO A;  2XDO A;  4U8P A;  2EQ9 A;  1H6V A;  4WCT A;  1K0L A;  1YQ4 A;  4G6G A;  3C4A A;  2XFN A;  2WEU A;  4GCM A;  1ZMC A;  3NK2 X;  4IA5 A;  1ZDL A;  2JBV A;  5LV9 A;  1EL8 A;  3GDN A;  3K7M X;  2GR1 A;  2QA2 A;  2RAB A;  4ADW A;  2ACZ A;  4GR1 A;  3G5R A;  4U8I A;  1B8S A;  1BGJ A;  3UKH A;  1DJN A;  4H2N A;  2YR4 A;  1CJC A;  3KU9 A;  4B64 A;  1NHQ A;  2BAC A;  2CUL A;  4GAP A;  3DME A;  2JB1 A;  3NTA A;  4O5Q A;  1JNZ A;  1TYT A;  3ADA B;  4EMJ A;  4JY2 A;  3LOV A;  4A79 A;  3FIM B;  2ZZB A;  4LII A;  2WET A;  1H7W A;  2QA1 A;  3QFB A;  2R46 A;  4NNJ A;  3G5S A;  3NN6 X;  4BJZ A;  1GND A;  4NEW A;  3CGD A;  4HB9 A;  4PAB A;  2X8G A;  1PN0 A;  2QCU A;  1CJ4 A;  1L0V A;  1QLB A;  1BWC A;  1VDC A;  1ZK7 A;  1CL0 A;  2BK5 A;  2ARD A;  2YM1 A;  1DOD A;  1NHS A;  4BUR A;  4PAA A;  4II2 A;  3UTF A;  3DJG X;  4EM3 A;  4CRT A;  3Q6J A;  2XFU A;  2YLT A;  2GQF A;  1OJT A;  2YVG A;  3Q9T A;  3NK1 X;  5KMP A;  3SZC A;  2JAE A;  5KVI A;  2WQY A;  4K7Z A;  1OJA A;  3B6D A;  2VZ2 A;  3SM8 A;  1OJD A;  3BHF A;  3AEA A;  3T31 A;  4ECH A;  2JB2 A;  1PJ7 A;  2C3D A;  2WU2 A;  1RSG A;  4TM3 A;  3B3R A;  4IVO B;  4YTP A;  1TDN A;  3IWA A;  4EM4 A;  3AE7 A;  5ER0 A;  1GET A;  1H84 A;  3DA1 A;  3P9U A;  4OCG A;  1W4X A;  3GMB A;  3UKQ A;  4D04 A;  4E0V A;  2V60 A;  4H4R A;  3F8R A;  2AAQ A;  5C2T A;  3P4Q A;  1IJH A;  1JOA A;  1MXT A;  3QVR A;  4U2T A;  4U8L A;  2F5Z A;  3NKS A;  1XPQ A;  3QFA A;  1Y56 A;  3AE4 A;  4IVM B;  4YKF A;  3UOV A;  2WBA A;  1NHP A;  2EQ8 A;  3HYV A;  5CKU A;  3NRN A;  3HYW A;  3OZ2 A;  3NK0 X;  2QAE A;  2WDV A;  1D4C A;  3CNJ A;  2JB3 A;  3P4S A;  1CC6 A;  1O94 A;  2BCP A;  3AWI A;  5KXJ A;  1B4V A;  2XVE A;  3IHG A;  5FS8 A;  3AB1 A;  4Y4L A;  3RP6 A;  3AE1 A;  2OAM A;  1IUW A;  1VRQ B;  1FEB A;  1XAN A;  3VRD B;  2BC0 A;  2GR2 A;  1E6E A;  5EOW A;  1ZKQ A;  2C3C A;  3C96 A;  1KN0 A;  2B9Y A;  2B76 A;  2VVL A;  1H83 A;  3BI4 A;  2E5V A;  3SZ0 A;  1O5W A;  2BK4 A;  2BRA A;  1TRB A;  4Z24 A;  4FX9 A;  1H2I A;  2GRT A;  1COY A;  2WDQ A;  2XVH A;  4U8N A;  1N4V A;  2R4J A;  2XLS A;  2X3N A;  3D9X A;  3AE8 A;  4ZCC A;  3RP7 A;  4C3Y A;  1GRA A;  2GAH B;  5GSN A;  1KSU A;  3UKP A;  2VOU A;  2Y6Q A;  4NZH A;  3KA7 A;  3AE6 A;  4A6N A;  3AD9 B;  1KNP A;  4H4Q A;  3ZDN A;  1JEH A;  2V6O A;  1L9D A;  3UTE A;  3ABV A;  1ZP0 A;  1IUS A;  1NDA A;  2E4G A;  3ALJ A;  4J2W A;  3SQP A;  2WOV A;  3M0O A;  4OPD A;  5M0Z A;  4BK2 A;  2WOI A;  5U63 A;  1GES A;  5J60 A;  1E1L A;  1LVL A;  2WS3 A;  5U1O A;  1CHU A;  4UDQ A;  5KOX A;  4NTE A;  2VQ7 A;  1BF3 A;  2AQJ A;  3GDP A;  2DKH A;  3NH3 X;  5EBK A;  3BHK A;  1GRF A;  3L8K A;  4Z2U A;  1M64 A;  3GD3 A;  4BV6 A;  2XLT A;  2GH5 A;  2PHH A;  2WOW A;  4G9K A;  3SZF A;  3CNT A;  1F8S A;  3T2Y A;  1GRG A;  2B7S A;  4H2Q A;  5KNL A;  3LJP A;  4WX1 A;  3UTG A;  3D1C A;  4K2X A;  1NG4 A;  4ZN0 A;  2YM2 A;  1H7X A;  1IUV A;  3DJD A;  5KRQ A;  1D7Y A;  3GRS A;  4LA1 A;  4U8O A;  5JCM A;  2V5Z A;  2YVF A;  1M6I A;  1ZOV A;  4BK1 A;  3RHA A;  2YR6 A;  5BVA A;  2W0H A;  4H4W A;  3V3N A;  2YAU A;  4EQR A;  2B9X A;  2C7G A;  2WHD A;  2YLR A;  1LPF A;  1HYU A;  2TMD A;  1KSS A;  1QO8 A;  2XLU A;  3M13 A;  2RGO A;  3AEF A;  1Q1W A;  4G73 A;  1B37 A;  5JRB A;  2Q0L A;  2BXS A;  2RGJ A;  1KNR A;  2BCG G;  2XLP A;  3UOZ A;  1D5T A;  4EMI A;  3PO7 A;  1CJ2 A;  1PJ5 A;  4P9S A;  3BNU A;  1ZOY A;  4IV9 A;  1FEC A;  1NG3 A;  4Y4M A;  3GRT A;  4H4V A;  4B1B A;  1MOK A;  1D4E A;  2YWL A;  3RED A;  1OJ9 A;  5TR3 A;  1P2E A;  2C76 A;  1EBD A;  3DK4 A;  3AE2 A;  2Q6U A;  3GSI A;  3HYX A;  4YTN A;  2ZZC A;  3UCL A;  4C77 A;  3CNS A;  1EL5 A;  1FL2 A;  4XWR A;  5KVH A;  3I3L A;  1GOS A;  2YG3 A;  4B67 A;  2WDR A;  3KPK A;  3NG7 X;  4YT0 A;  1GEU A;  2WES A;  3KLJ A;  2XFQ A;  1XDI A;  4XWZ A;  1CJ3 A;  5JCK A;  2YG7 A;  1V59 A;  1ZY8 A;  1N4U A;  2FJB A;  3NNE A;  3AXB A;  3P4R A;  3NIX A;  5GRT A;  4A65 A;  5JCN A;  1VG0 A;  1GRH A;  3DH9 A;  4H7U A;  3F8D A;  1YQ3 A;  2C72 A;  1GT8 A;  3H8L A;  4J34 A;  4A9W A;  1H81 A;  2BS2 A;  3ZYX A;  2APG A;  2GR0 A;  2OLN A;  2JKC A;  3UOY A;  4Z43 A;  3CN8 A;  2YLZ A;  3LB8 A;  1PBD A;  5IQ4 A;  1BZL A;  1Q9I A;  4J56 A;  4CNJ A;  2FJA A;  1LQT A;  2R0C A;  2XCG A;  2YG4 A;  4CCQ A;  3F8P A;  3VR8 A;  4YSX A;  2DKI A;  4JN9 A;  2C65 A;  2YLW A;  2J3N A;  1YKJ A;  2YLX A;  2CFY A;  3GYJ A;  2AR8 A;  3GYI A;  1QJD A;  4JNQ A;  4H4T A;  3CPI G;  4BJY A;  4B66 A;  4DGK A;  4YKG A;  4YSZ A;  3UOX A;  2BRY A;  5KWF A;  1L9C A;  1PBB A;  1L9E A;  3IF9 A;  1DOC A;  1PBE A;  4ZCD A;  4Z2T A;  2A87 A;  2O9Z A;  4AOX A;  3GWD A;  4OPL A;  3URH A;  2OA1 A;  1X31 B;  2BA9 A;  5CQF A;  4J31 A;  5U25 A;  1S2Q A;  4REK A;  4DSG A;  1PDH A;  2GMJ A;  1GAL A;  1GPE A;  4II3 A;  3CND A;  3CGB A;  1TDO A;  3QSS A;  3FPZ A;  3UTH A;  1GXF A;  1K0J A;  4OPG A;  4X9M A;  1CC4 A;  1NHR A;  3CTY A;  3NLC A;  4U8M A;  4OPT A;  1BGN A;  4NWZ A;  1IUU A;  1JRY A;  1P2H A;  2ZBW A;  4YXD A;  3ICR A;  4B65 A;  4JNA A;  4LU6 A;  5BUL A;  4OPC A;  2GEW A;  4M52 A;  2X8C A;  3G5Q A;  4OPI A;  2Z5X A;  5KMS A;  3DGH A;  4DSH A;  2YVJ A;  1PXC A;  4AT2 A;  4H50 A;  2E1M A;  2XVI A;  4MJW A;  3NYC A;  3NTD A;  3V76 A;  4FK1 C;  3DJJ A;  2VRL A;  4TLX A;  4H2P A;  2BAB A;  2OLO A;  3UKA A;  4UDR A;  2CVJ A;  4KPR A;  3K7T A;  5EB4 A;  3S5W A;  3PS9 A;  3SYI A;  3O0H A;  2EQ6 A;  1CC2 A;  3NGC X;  5JCI A;  4AP1 A;  4CY8 A;  4GF7 A;  3AYL A;  2V61 A;  3HZL A;  2EQ7 A;  3C4N A;  1E39 A;  2BK3 A;  3COX A;  3AYI A;  3JSK A;  5IPY A;  1PHH A;  2YLS A;  4U2L A;  2GV8 A;  3ICT A;  2JK6 A;  4UP3 A;  4Z44 A;  1PXB A;  4TLZ A;  1RYI A;  1F3P A;  3T0K A;  2HQM A;  1FEA A;  3AE5 A;  1IUX A;  1Y0P A;  3BI2 A;  3P4P A;  4U8K A;  3GWF A;  2A8X A;  2UZZ A;  1GRE A;  4H4S A;  1AOG A;  2BC1 A;  1MO9 A;  1F6M A;  2TPR A;  1BKW A;  1REO A;  3P1W A;  4A99 A;  1UKV G;  2BXR A;  2VVM A;  1JRZ A;  1Z6L A;  3UP4 A;  2YG5 A;  4DNA A;  4RG3 A;  4J57 A;  5EB5 A;  4Z25 A;  1K4Q A;  5HHF A;  1GER A;  1N1P A;  3R9U A;  5HY5 A;  4CNK A;  4UDP A;  1ONF A;  3OC4 A;  3QSE A;  4O5U A;  2C70 A;  4K8D A;  3H4K A;  2VRM A;  1NEK A;  3VQR A;  1E1K A;  4FDC B;  4Z26 A;  1JU2 A;  4NTD A;  1TDE A;  3SGL A;  4EMW A;  4GDE A;  4B68 A;  4EIQ A;  4JQ9 A;  1RP0 A;  2FJE A;  3DJE A;  3VRB A;  1S3B A;  2C67 A;  5JCL A;  3K7Q X;  3UP5 A;  4YTM A;  4BK3 A;  5KMR A;  1LQU A;  3UKL A;  1KDG A;  4D03 A;  3ATR A;  3RP8 A;  1SEZ A;  3V3O A;  2I0Z A;  1DOB A;  4GDP A;  3IC9 A;  3CMM A;  2WP5 A;  3AE9 A;  4U8J A;  2Z5Y A;  2WP6 A;  3SFD A;  3AD8 B;  4OVI A;  3DK8 A;  3DGZ A;  3QSM A;  2Q0K A;  1KFY A;  1ELI A;  5BRT A;  3EF6 A;  1IUT A;  4TM4 A;  4NEV A;  3ICS A;  1JRX A;  4X4J A;  4APN A;  3KD9 A;  1S3E A;  3BI5 A;  1PJ6 A;  1H82 A;  3EAO A;  4H4Z A;  1LV0 A;  4USR A;  5M10 A;  1F8R A;  2R9Z A;  2C66 A;  2PYX A;  3FMW A;  3NN0 X;  3SX6 A;  5BUK A;  3AED A;  3CNP A;  2V3A A;  1PBF A;  3H8I A;  2WPC A;  3I6D A;  4FK1 A;  4CY6 A;  2X8H A;  3VRA A;  3GYX A;  1NAA A;  1XHC A;  3AEC A;  3ALL A;  2WU5 A;  3DK9 A;  2C75 A;  3SZW A;  1EL9 A;  3QJ4 A;  5FS7 A;  4KX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...