3CGCA

Pyridine nucleotide complexes with bacillus anthracis coenzyme a-disulfide reductase: a structural analysis of dual nad(p)h specificity
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
444
structure length
444
Chain Sequence
MNYVIIGGDAAGMSAAMQIVRNDENANVVTLEKGEIYSYAQCGLPYVISGAIASTEKLIARNVKTFRDKYGIDAKVRHEVTKVDTEKKIVYAEHTKTKDVFEFSYDRLLIATGVRPVMPEWEGRDLQGVHLLKTIPDAERILKTLETNKVEDVTIIGGGAIGLEMAETFVELGKKVRMIERNDHIGTIYDGDMAEYIYKEADKHHIEILTNENVKAFKGNERVEAVETDKGTYKADLVLVSVGVKPNTDFLEGTNIRTNHKGAIEVNAYMQTNVQDVYAAGDCATHYHVIKEIHDHIPIGTTANKQGRLAGLNMLDKRRAFKGTLGTGIIKFMNLTLARTGLNEKEAKGLHIPYKTVKVDSTNMAGYYPNAKPLYLKLLYRSDTKQLLGGQVIGEEGVDKRIDVIAMALFNKMSIHDLEDVDLSYAPPYNSVWDPIQQAARRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Pyridine Nucleotide Complexes with Bacillus anthracis Coenzyme A-Disulfide Reductase: A Structural Analysis of Dual NAD(P)H Specificity.
pubmed doi rcsb
source organism Bacillus anthracis str.
molecule tags Oxidoreductase
molecule keywords Pyridine nucleotide-disulfide oxidoreductase, class I
total genus 151
structure length 444
sequence length 444
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3cgcA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3cgcA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3cgcA02
4J57A 3UTHA 5TR3A 3NN6X 3GMBA 5EB5A 4J34A 4A65A 5IQ4A 2H89A 2B7SA 2IIDA 2XFUA 2XLRA 2X99A 3CGEA 2QAEA 3DK8A 3VRDB 4B68A 3QSEA 2C3DA 2FBWA 2WP6A 2ZBWA 2WOVA 4H4TA 3F8PA 1FEAA 1PN0A 5GSNA 1IUVA 1F8SA 2C7GA 2E4GA 3UKFA 3B3RA 2YLRA 3AE7A 3FMWA 3NK2X 5EBKA 1REOA 4OPLA 4CBQA 3DJEA 1ZMCA 3H8IA 3QSMA 4XXGA 2B9YA 1KSUA 1VDCA 4TM0A 3AD9B 5JCNA 3GD3A 3AYJA 1GRGA 1E1MA 2Q0LA 3GMCA 2A89A 4BK2A 3DJGX 1GETA 3V3OA 3ICRA 2DKHA 3GYJA 2E1MA 1D7LA 1CHUA 1GTHA 1OJDA 2YR5A 3P4SA 5CKUA 4B1BA 3AWIA 2BK4A 4CNKA 4YTMA 1IUXA 2APGA 1ZK7A 2RGHA 3WE0A 1CJ4A 3D8XA 4B64A 4D04A 3PS9A 1N4VA 2C72A 3AEBA 4K5RA 4AT2A 3K30A 3CNSA 2BCPA 2GF3A 3AE6A 1H7WA 4OPIA 2BCGG 1NPXA 5LV9A 5HYMA 1TYTA 2C66A 2PYXA 4LU6A 5DBJA 3CPJG 3BHKA 2EQ8A 4FX9A 1CF3A 4OCGA 4PABA 1NHRA 1GRHA 4H4PA 2XFNA 3R9UA 2WU5A 3NH3X 2GQWA 2YVFA 4BK3A 2YLWA 5U25A 5IQ1A 2YLSA 2X8CA 4H4RA 2BK5A 3EF6A 1GRTA 2V61A 1S3EA 1GRBA 4K5SA 5KXJA 1L9CA 4I59A 2XVFA 3GRTA 3DA1A 1Q1RA 3BNUA 1GESA 2YG5A 1X31B 3BNMA 4J31A 4YSHA 2BXRA 4ZCDA 4K8DA 2XLSA 5C3JA 4NZHA 1VG9A 2CFYA 4U8IA 4Y4MA 4OPDA 4K7ZA 4ZN0A 1FEBA 1N1PA 2CULA 4GCMA 5GRTA 2AQJA 3NHOX 4H4ZA 1NAAA 3DJJA 4YTPA 3EANA 2C3CA 2ZZCA 2Y6RA 4ZCCA 5JCIA 5HHFA 5JCLA 4NEVA 1DOBA 1S3BA 2XFOA 3NK0X 4NTCA 4U8NA 1H7XA 4UDRA 2GR3A 3QVRA 1FOHA 1JU2A 1JOAA 4K22A 4KX6A 3AEAA 3NG7X 1ONFA 4Z2TA 1H83A 1PXBA 4EM4A 4A99A 2OAMA 1GREA 2ARDA 2BACA 5M10A 4DNAA 2R46A 3UOZA 1LTXR 4JN9A 1IUTA 4TLXA 1VRQB 4XWZA 3DJDA 5C2TA 3AEGA 3QVPA 2O9ZA 4M52A 1IUUA 1Y56A 1RSGA 3NN0X 3H4KA 2I0ZA 3CN8A 4YTNA 2ZZ0A 1CJ3A 2A8XA 1F3PA 1AOGA 1KFYA 3ITJA 1DOCA 3IC9A 2B9XA 4TM3A 3CNPA 4C5OA 5IPYA 1TDKA 3ATQA 1KF6A 1PBEA 1PJ7A 2XVHA 3AXBA 2Z5XA 1JRZA 2BABA 3KVEA 4EIQA 5ER0A 3L8KA 3UTGA 1F6MA 3AECA 3AB1A 2R0CA 4UDPA 4TLZA 1PJ5A 3M12A 2EQ7A 3ALJA 3VRBA 3SFEA 3FG2P 3GWDA 4HA6A 1GRAA 1OJTA 5FS6A 1LQUA 3AEDA 3NNEA 3P4PA 1BGNA 3REDA 2WEUA 3C4NA 4FK1A 2WP9A 4NEWA 2A87A 1W4XA 3UKPA 5BVAA 4YKFA 1H84A 4YKGA 3CNJA 4BURA 3GD4A 2GH5A 4J56A 1XPQA 3I3LA 2JKCA 3AYLA 2CDUA 4I58A 5KWFA 4YWOA 2TPRA 3IHGA 3VRAA 1BGJA 2WESA 3P4QA 4Z24A 1NG4A 4APNA 2CVJA 3ATRA 3UKHA 3KKJA 4H4VA 4H50A 2IVDA 3BI4A 2VVLA 2WBAA 4EM3A 3DK9A 1F8RA 1Q1WA 1GPEA 2BK3A 4OVIA 5CQFA 5BUKA 3AD7B 3S5WA 1K4QA 1TDNA 4AP3A 4O5UA 3T37A 4LA1A 2JB3A 1TRBA 2B76A 1EL8A 1H82A 2R9ZA 2JAEA 3DK4A 1DJQA 3P4RA 2VRMA 1Q9IA 1XDIA 3O0HA 1JRYA 3DGZA 1CC2A 4A6NA 1GTEA 4H4WA 1B4VA 2C70A 3AE8A 3ALLA 5HY5A 1E7PA 2V3BA 2XFPA 4EQRA 4Z44A 2BS4A 1H86A 2BXSA 1QLBA 1QJDA 1PXAA 2R4EA 2C65A 4NTEA 3UKQA 4U2LA 1NG3A 4CY6A 2XYOA 1ELIA 2R4JA 3EPTA 2GQFA 3CIRA 3CNDA 2GR1A 1PJ6A 2WDQA 1PBDA 2XDOA 1PBCA 1E1LA 2XFQA 3NTDA 3UOYA 5KOXA 4WCTA 3KU9A 2YVJA 3CPHG 1YQ4A 4GDPA 1D5TA 2TMDA 4EMWA 3AE2A 3V3NA 3GSIA 1PXCA 3AYIA 2F5ZA 2DKIA 2WDVA 3ADAB 3G5SA 4U8MA 4AOSA 4XWRA 2GAGB 1Y56B 1E6EA 1YQ3A 3LJPA 3CGCA 1L9EA 1RYIA 3F8RA 3NYFA 3IF9A 3AE5A 1D4DA 2WS3A 3QFAA 1IUWA 1D7YA 4JDRA 4EQXA 4CRTA 1SEZA 1CC6A 3ZYXA 2OA1A 2XCGA 5HXIA 2YWLA 4HB9A 3Q9TA 1BF3A 4YT0A 1E39A 4IV9A 4UDQA 1ZX9A 2YG4A 2B9WA 3UKKA 2XVIA 4EIPA 4IVOB 3PO7A 3VQRA 1GSNA 1CC4A 1B5QA 2GMHA 1D4EA 4H2RA 4Z25A 3G5QA 1CL0A 4H4YA 2X3NA 2GR2A 4EQWA 1N4UA 1M64A 4CCQA 4A79A 4YXDA 3UP5A 2C76A 2JB2A 1OJAA 1TDOA 4MJWA 2FJDA 2QA2A 3BHFA 5EOWA 2BYBA 2VQ7A 2XLPA 3ICSA 5L46A 3NRNA 2WU2A 2BA9A 4CY8A 1FL2A 4X4JA 3IHMA 3LADA 4B66A 3Q6JA 2NPXA 2R0PA 2GAHB 4H4QA 2VOUA 1MOKA 1EL7A 3QSSA 1V59A 4J2WA 5U1OA 4C77A 3GRSA 3HZLA 1NEKA 1E1KA 3LXDA 5U63A 4Y4NA 1NENA 4TM1A 4U8PA 1DJNA 1PS9A 3UP4A 4U2SA 4NTDA 4H4UA 3DGHA 5FS7A 3ICTA 4A6NB 4RG3A 2BC1A 1NHQA 1GNDA 3GDNA 4U8KA 2VZ2A 3OZ2A 2YG7A 3GDPA 3UCLA 4USQA 1GERA 1EL9A 1N4WA 3EAOA 4FDCB 2YLXA 2EQ9A 2UZZA 3NLCA 3II4A 3FPZA 1F8WA 1DODA 2GB0A 3K7TA 4LIIA 2WDRA 1TDFA 2RGOA 1CJCA 3FIMB 1K0LA 2FJEA 3UKAA 1DOEA 4J36A 4H2QA 4BK1A 2YVGA 2WETA 3LOVA 2V6OA 4AP1A 4C3YA 1ZP0A 1GRFA 3CGDA 3SGLA 4B67A 3RNMA 3S61A 2YR6A 2GVCA 3UOVA 2NVKX 2EQ6A 4BJZA 4H2PA 4A5LA 1OJ9A 3KPFA 2V5ZA 1JRXA 1JNRA 3CTYA 4WX1A 3AE4A 1CJ2A 1B8SA 4K2XA 4B69A 2WPEA 1K0JA 4IA6A 2IVEA 2X8HA 2XLUA 4AT0A 2WP5A 4YSXA 4OPTA 4ADWA 1KSSA 1GXFA 1KNRA 2PHHA 1L9DA 3E1TA 4H4SA 5KOWA 2YQUA 2AAQA 1P2HA 3ISHA 4C74A 4Z2RA 3NYEA 1Z6LA 3NYCA 3QJ4A 1HYUA 1KDGA 1BWCA 2WQYA 3D1CA 1JNZA 3AE9A 4B65A 2ZZBA 3NIXA 3NKSA 3DH9A 1YY5A 4X9NA 1O94A 1D4CA 4B63A 2WPFA 4GDEA 2BC0A 1ZDLA 2C75A 2GMJA 2Q0KA 4J33A 2GRTA 3NK1X 5FS8A 3NGCX 3ABVA 3JSKA 2RGJA 3UKLA 4CCRA 1M6IA 4RG4A 5KVIA 1B37A 2C67A 2VRLA 5BRTA 1EL5A 1ZOYA 3LZWA 4P9SA 1GEUA 1NDAA 3AE3A 3RP7A 2ACZA 2GV8A 2H88A 4IVMB 2QCUA 2YM1A 1XANA 2B7RA 3VR8A 4Z2UA 4UP3A 3UTEA 4EMIA 1TYPA 4U8OA 4ECHA 4YSZA 2HQMA 2X50A 2YLTA 4EMJA 3URHA 3LB8A 3BI5A 1LPFA 1ZOVA 2JB1A 2R45A 4Z26A 3DMEA 3CGBA 5FS9A 2Q7VA 3IWAA 4FK1C 4X9MA 4N9XA 2OALA 3GWFA 2V60A 4REKA 3OC4A 2E5VA 4D03A 1IJHA 3RHAA 2GEWA 3AD8B 4E0VA 5J60A 4U8JA 4PAAA 2YG6A 2RABA 1GV4A 1LV0A 2VVLG 2YLZA 1ZMDA 4JQ9A 1BKWA 4DGKA 4Z43A 3QFBA 3AEFA 1PBFA 3L1RA 2W0HA 4GRTA 4U2TA 1DNCA 1COYA 2BS2A 4CNJA 2XVEA 4H7UA 3AEEA 1PBBA 1S2YA 1H6VA 1YQZA 1VQWA 3COXA 3PVCA 4JY3A 1GT8A 4A7AA 5JCKA 3P9UA 3KD9A 3V76A 1ZKQA 1LJ1A 4YSYA 2YAUA 2YG3A 1JEHA 2J3NA 2R0GA 2Y6QA 4BV6A 4OPGA 1UKVG 4JY2A 1L0VA 1NHPA 2QA1A 2VVMA 2C64A 3SFDA 4KPRA 1LQTA 4H4XA 1S2QA 2JK6A 2OLNA 3UOXA 4H2NA 4OPUA 1LVLA 1QO8A 5JCMA 2GR0A 5J7XA 1O95A 3NT6A 2VQBA 4GUVA 5BULA 4DSHA 3K7QX 1GALA 3GYIA 4ICYA 1K0IA 1DXLA 5KVHA 3CPIG 3VR9A 4A9WA 4C3XA 1IUSA 2X8GA 1ZY8A 2Z5YA 2OLOA 2YM2A 5M0ZA 2FJAA 5FMHA 3G5RA 1TDEA 3K7MX 4GR1A 3FBSA 4EQSA 2FJBA 2V3AA 4U8LA 4DSGA 2WOWA 5KRQA 4JNQA 4RSLA 3RP8A 1P2EA 4USRA 3UTFA 3LZXA 1FECA 2C73A 1GOSA 4OPCA 4GF7A 4AOXA 2WPCA 4BJYA 1MXTA 2XLTA 2YR4A 2AR8A 3KA7A 1H81A 4O5QA 1FCDA 1VG0A 3NTAA 3B6DA 4Y4LA 3M13A 2WHDA 1CBOA 1OJCA 5EB4A 3C4AA 1NHSA 3CNTA 1E1NA 4IA5A 3C96A 1Y0PA 3ZDNA 3P1WA 1EBDA 2WOIA 1RP0A 1O5WA 3BI2A 4TM4A 3KLJA 1BZLA 1XHCA 3M0OA 1KNPA 3AE1A 1PHHA 3ALMA 4JNAA 3I6DA 1YKJA 1PDHA 3SM8A 1MO9A 2JBVA 3RP6A 2BS3A 3SQPA 3F8DA 2XVJA 3H8LA 2Q6UA
chains in the Genus database with same CATH superfamily
5TR3A 5EB5A 4J34A 4F4RA 3PWGA 3OTRA 4B68A 1JROA 4H4TA 5GSNA 2C7GA 3ZLGA 3FMWA 5EBKA 3DJEA 4GGBA 3H8IA 4G74A 3QSMA 1VDCA 5FJOA 2A89A 3V3OA 3ICRA 2DKHA 3P3BA 4B1BA 3P4SA 4E4UA 4JN8A 2PPGA 3AWIA 2BK4A 1FFUC 1ZK7A 3PS9A 1N4VA 4K5RA 4OPIA 1NPXA 2GGGA 3CPJG 3BHKA 4FX9A 1CF3A 1NHRA 4H4PA 2WU5A 2GQWA 1N5WC 2YLWA 5U25A 2YLSA 1MNSA 3CK5A 4I59A 1F9CA 3DERA 3DA1A 3T2YA 1GESA 4J31A 4NZHA 3JVAA 4Y4MA 4ZN0A 1N1PA 1JRPA 4H4ZA 3S5SA 2Y6RA 1JCTA 5JCLA 1S3BA 2XFOA 3NK0X 1H7XA 2GR3A 1FOHA 4FI4A 1JU2A 4Z2TA 1GREA 3TQPA 1IUTA 3DJDA 3QVPA 3GC2A 2O9ZA 2QDEA 4YTNA 1KFYA 1AOGA 5IPYA 2PS2A 3UJSA 1JRZA 1PDZA 3KVEA 3H12A 3L8KA 4HNLA 4UDPA 2QVHA 2EQ7A 4K1WA 3SFEA 2PMQA 4HA6A 2GGIA 5FS6A 1LQUA 3AEDA 2WEUA 2A87A 5BVAA 4YKFA 1X2HA 4BURA 3AM9A 3I3LA 2JKCA 2CDUA 2TPRA 2HNEA 3UXKA 3T14A 4H4VA 4M0XA 4H50A 3BI4A 3DEQA 2WBAA 3N6JA 1GPEA 4OVIA 3TCSA 4H19A 1K4QA 3FYYA 3SQSA 1TRBA 2QJMA 2JAEA 2R9ZA 3SZ0A 3FCPA 2OQYA 3P4RA 1JPDX 3O0HA 3FXGA 1CC2A 4A6NA 2V3BA 2QJJA 4EQRA 2BS4A 1QLBA 1E9IA 3UKQA 3UCDA 2R4JA 3DG6A 2GR1A 1PJ6A 2XDOA 1E1LA 3ES7A 1YQ4A 1D5TA 1MDLA 2WDVA 4IZGA 4XWRA 2GAGB 1Y56B 2QGYA 3CGCA 3QFAA 4G7FA 3RCYA 1SEZA 3MZNA 2E3TA 4UDQA 4E4FA 2P8BA 2NQLA 2PSNA 7ENLA 4IVOB 2FKPA 3T31A 4H4YA 2GR2A 1N4UA 1M64A 4A79A 3UP5A 1TKKA 1IYXA 4IL2A 2PCEA 3UGVA 2R0PA 1MOKA 1V59A 4YWSA 1V97A 4TM1A 2DW7A 1PS9A 3DGHA 3ICTA 2BC1A 3VCNA 2VZ2A 3OZ2A 4USQA 1EL9A 3NVWB 3SY4A 3EAOA 2YLXA 3NLCA 1F8WA 3K7TA 2I5QA 3CB3A 1DOEA 4J36A 3DIPA 4AP1A 3KPKA 3CGDA 4H2PA 3NS1B 3RITA 4IA6A 2XLUA 4OPTA 1KNRA 2PHHA 3E1TA 2XH2A 4C74A 1BWCA 4X9NA 4B63A 2WPFA 3SZFA 2GMJA 2Q0KA 3ABVA 3T2ZA 4CCRA 4IHCA 4P9SA 3K1GA 1GEUA 1NDAA 3RP7A 2ACZA 2ZADA 2YM1A 4EMIA 2X50A 3BI5A 5EU9A 3NO1A 4FK1C 3OC4A 2E5VA 3FV9A 4E0VA 4GISA 2PU1A 2YG6A 2RABA 3DG7A 2YLZA 1ZMDA 4HN8A 3TOYA 3AEFA 2BRYA 1DNCA 2BS2A 2XVEA 4H7UA 3A7RA 3AEEA 1PBBA 3QTPA 1S2YA 1YQZA 3V76A 5JCKA 3KD9A 2YAUA 2FYMA 1JEHA 2OKTA 1VQZA 4KPLA 2RDXA 1O95A 3NT6A 5BULA 4DSHA 3HRDC 3GYIA 4A9WA 1ZY8A 2YM2A 5FMHA 3K7MX 4GR1A 4EQSA 2FJBA 4JHMA 3I6TA 5KRQA 2ZC8A 3LZXA 2C73A 3SX6A 1MXTA 1SB3B 3NTAA 4Y4LA 3NRZB 1CBOA 1NHSA 3C96A 3ZDNA 3P1WA 3RO6A 3VA8A 2HZGA 3SQPA 3H8LA 2Q6UA 3UTHA 1W6TA 2XLRA 3DK8A 3QSEA 2WP6A 2WOVA 3F8PA 3BSMA 1IUVA 3UKFA 2PGWA 2E4GA 3SXIA 1ELSA 1REOA 4CBQA 4GAPA 4NNJA 4XXGA 2B9YA 3AN1A 4TM0A 3AD9B 5JCNA 3PG6A 3AYJA 1E1MA 3GMCA 3DJGX 2E1MA 1BKHA 1OJDA 1IUXA 2APGA 2BRAA 1CJ4A 4B64A 3D47A 2BCPA 3AE6A 1H7WA 2BCGG 5LV9A 2PYXA 1FHUA 3SN1A 2XFNA 3ZLFA 4DN1A 3VDGA 5IQ1A 2V61A 1S3EA 3STPA 1EC8A 2YG5A 4ZCDA 4K8DA 3DG3A 5C3JA 3PFRA 4OPDA 2PTXA 1NAAA 4KT2A 4ZCCA 5HHFA 4DHGA 3TWBA 4E8GA 3ZVHA 4K22A 3AEAA 3NG7X 3UXLA 2OAMA 3CMMA 4IP4A 2PU0A 4TLXA 2MUCA 3AEGA 1OEPA 1Y56A 3NN0X 1RSGA 3MUCA 2ZZ0A 4GYPA 2XSXA 3ITJA 3ATQA 1DTNA 1KKRA 3VCCA 1X2GA 4IL0A 3AECA 3AB1A 1PJ5A 3M12A 3VRBA 3FG2P 1GRAA 3S47A 3C4NA 4NEWA 1H84A 3SJNA 1RVKA 2GH5A 4EWJA 3AYLA 4I58A 1EC9A 1KN0A 1BGJA 2WESA 1WUEA 3UKHA 3OZMA 2VVLA 2BK3A 5CQFA 5BUKA 3AD7B 4AP3A 3IJIA 4LA1A 2P88A 1XDIA 1JRYA 3DGZA 2OFJA 5HY5A 2C70A 3ALLA 1E7PA 2XFPA 4Z44A 3T9PA 1H86A 1PXAA 1NG3A 2XYOA 1ELIA 3EPTA 2GQFA 3CIRA 3CNDA 2WDQA 3NTDA 1N60C 4EMWA 1TZZA 3V3NA 2DKIA 3ADAB 1E6EA 1L9EA 1BQGA 1IUWA 1D7YA 3R11A 4JDRA 4EQXA 4CRTA 3ZYXA 2XCGA 3UJFA 5HXIA 1BF3A 4YT0A 4IV9A 2B9WA 2GMHA 3FVDA 5J04A 4Z25A 1CL0A 2X3NA 4EQWA 4GYPC 4YXDA 4NWZA 4A35A 2C76A 2JB2A 1OJAA 4GAVA 1TDOA 5EOWA 1R6WA 2AKMA 2VQ7A 2XLPA 3ICSA 2WU2A 2BA9A 4X4JA 3LADA 4B66A 3Q6JA 4H4QA 4C77A 2DW6A 1NEKA 3LXDA 4Y4NA 6ENLA 4U8PA 1DJNA 3UP4A 4NTDA 4HPNA 3VC6A 4H4UA 1YEYA 5FS7A 1NHQA 3GDNA 4U8KA 3B9JB 3GDPA 3UCLA 1GERA 2UZZA 3II4A 1TDFA 2RGOA 2PTYA 3IK4A 4BK1A 2YVGA 3LOVA 2V6OA 4C3YA 1GRFA 3RNMA 3V4BA 2YR6A 2NVKX 3QN3A 4A5LA 1OJ9A 3DFYA 1JNRA 3CTYA 3AE4A 4B69A 4ADWA 1KSSA 1GXFA 5KOWA 3OPSA 1P2HA 3QJ4A 1Z6LA 3T4WA 2WQYA 1JNZA 3AE9A 4B65A 2ZZBA 3NIXA 3NKSA 1D4CA 3I4KA 2BC0A 2C75A 4J33A 5FS8A 2OZ8A 4J1OA 3JSKA 1M6IA 4RG4A 5KVIA 4Z17A 2C67A 3LZWA 3EUB3 1JDFA 3V5CA 2H88A 3V3WA 3VR8A 4UP3A 2YLTA 4EMJA 3LB8A 1FO4A 1LPFA 3U9IA 3FJ4A 2R45A 4Z26A 3HPFA 4X9MA 3GWFA 2V60A 4REKA 2PP1A 5J60A 4PAAA 1LV0A 1BKWA 3L1RA 1WUFA 2HXUA 4CNJA 3CAWA 3R10A 3UJEA 5BOFA 4A7AA 4DWDA 3P9UA 2YG3A 4FP1A 1UKVG 2QA1A 3U4FA 4KPRA 4H4XA 1S2QA 2JK6A 4OPUA 1LVLA 1GALA 1K0IA 4K2SA 5M0ZA 4II3A 3G5RA 4DSGA 2WOWA 1T3QC 1GOSA 2WPCA 4BJYA 1VG0A 4HCHA 3M13A 3MWCA 5EB4A 4IA5A 1Y0PA 2WOIA 1EC7A 3BI2A 3GYXA 1KNPA 3AE1A 3I6DA 2JBVA 2XH0A 3QKEA 3R1ZA 3Q45A 4J57A 4J3ZA 3GMBA 3TJIA 4A65A 3T6CA 2H89A 5IQ4A 2B7SA 3OW1A 2XFUA 1FFVC 2FBWA 2PTZA 2ZBWA 4JN7A 1PN0A 3N4FA 1F8SA 3B3RA 4HYRA 3NK2X 3TTEA 4GGHA 1GRGA 2Q0LA 2AKZA 4BK2A 3TWAA 1CHUA 5CKUA 4YTMA 2RGHA 4D04A 3D8XA 3AEBA 4AT2A 3K30A 2P8CA 3CNSA 2GF3A 5HYMA 1TYTA 4LU6A 2GGEA 5DBJA 2EQ8A 4OCGA 3R9UA 4BK3A 3NH3X 4DX3A 5KXJA 4G9KA 3GRTA 3BNUA 1MUCA 3BNMA 4H1ZA 3SZWA 2XLSA 2OG9A 2CFYA 4U8IA 4K7ZA 5GRTA 3EANA 2C3CA 2ZZCA 5JCIA 4IP5A 2QDDA 4NTCA 4U8NA 4UDRA 1PDYA 1JOAA 4MMWA 2R46A 4JN9A 3A7UA 1IUUA 1CJ3A 2A8XA 1DOCA 4TVYA 3IC9A 4C5OA 1TDKA 1PBEA 3AXBA 2PGEA 2C4CA 4EIQA 1F6MA 2R0CA 3GWDA 4DXKA 1OJTA 2MNRA 3P4PA 3NNEA 1BGNA 2QJNA 4E6MA 1W4XA 1NELA 4YKGA 3H70A 3CNJA 3GD4A 4J56A 1XPQA 3EKGA 1SJAA 3ZVIA 5KWFA 4YWOA 4APNA 3KKJA 4EM3A 1F8RA 3SN4A 1EBHA 3S5WA 1TDNA 3T37A 3RR1A 1EL8A 3EEZA 4H4WA 1B4VA 1QJDA 2R4EA 4NTEA 2C65A 4U2LA 2QQ6A 3P0WA 2E5AA 1PBCA 3UOYA 5KOXA 4WCTA 2YVJA 3CPHG 2TMDA 1N62C 3AE2A 3P93A 2F5ZA 4AOSA 1YQ3A 3F8RA 3NYFA 3IF9A 2PTWA 3UCCA 1D4DA 3T2KA 4MKSA 1CC6A 4G8TA 3V5FA 2OA1A 1E39A 3GD6A 1RM6B 1JPMA 2XVIA 3B97A 3PO7A 3VQRA 1B5QA 1D4EA 4H2RA 1TE6A 5KMSA 2CHRA 4CCQA 1P43A 3GY1A 2FJDA 2QA2A 2BYBA 5L46A 3NRNA 2OX4A 1FL2A 1ZXIC 4DYEA 2GAHB 2VOUA 1EL7A 3QSSA 2AL1A 5U1OA 3HZLA 3R07C 1E1KA 1NENA 4U2SA 4A6NB 4RG3A 3JW7A 1KD0A 1GNDA 3R25A 3RRAA 2YG7A 1N4WA 4FDCB 2GB0A 1EBGA 4LIIA 2WDRA 4M6UA 3FIMB 1CJCA 1K0LA 4G6HA 2FJEA 3UKAA 3NXLA 3SGLA 4G73A 3UOVA 4BJZA 4WX1A 3SR6B 1CJ2A 3Q4DA 1B8SA 1K0JA 4AT0A 4YSXA 2WP5A 4H4SA 3NYCA 3MQTA 1KDGA 3D46A 4X2PA 3DH9A 4GDEA 3HYXA 3CYJA 1B37A 3ETRB 1ZOYA 3AE3A 2GV8A 4IVMB 2B7RA 3UTEA 4ECHA 1VDVA 2HQMA 3URHA 2JB1A 3DMEA 3HW2A 4ROPA 3CGBA 5FS9A 4ENLA 2OALA 1IJHA 4U8JA 3AMZA 1GV4A 2VVLG 4DGKA 1PBFA 3OP2A 2W0HA 4U2TA 3DGBA 1FIQB 3IJQA 4G6GA 1VQWA 3COXA 3PVCA 1GT8A 3RGTA 1ZKQA 1LJ1A 4YSYA 1N5XA 2Y6QA 2R0GA 5FJTA 4IT1A 2W54A 1L0VA 3SFDA 4HCLA 2C64A 3UOXA 1QO8A 2GR0A 4GUVA 3K7QX 3NVVB 1DXLA 3CPIG 3SSZA 4C3XA 1IUSA 2Z5YA 3N6HA 1TDEA 3FBSA 2V3AA 3RP8A 1P2EA 3UTFA 4AOXA 5G5HB 1H81A 3OZYA 3B6DA 4H2HA 1NU5A 2WHDA 2OQHA 1STZA 3C4AA 1E1NA 1H2IA 1EBDA 2OPJA 1O5WA 4TM4A 3ALMA 4JNAA 1XS2A 1YKJA 2GSHA 3SM8A 3RP6A 3F8DA 2XVJA 1MDRA 3NN6X 4K8GA 2IIDA 3JZUA 2X99A 3SN0A 3CGEA 2QAEA 3VRDB 2C3DA 1FEAA 2YLRA 3AE7A 4OPLA 4Z1YA 3H7VA 1ZMCA 1KSUA 4KEMA 3GD3A 1GETA 1KKOA 3TW9A 3GYJA 1D7LA 1GTHA 2YR5A 3PK7A 4CNKA 4TVWA 3WE0A 1P48A 2C72A 3DFHA 2C66A 1XPYA 4PABA 3D9XA 1GRHA 2YVFA 2X8CA 4H4RA 2BK5A 3EF6A 1GRTA 4K5SA 1GRBA 1L9CA 2XVFA 2OZTA 1Q1RA 3NFUA 1X31B 3T8QA 2BXRA 4YSHA 1VG9A 1FEBA 3MKCA 2CULA 4GCMA 2AQJA 3NHOX 3DJJA 4YTPA 3CXOA 3THUA 4NEVA 1DOBA 3QVRA 3MY9A 4H83A 4KX6A 1ONFA 1H83A 1PXBA 4A99A 4EM4A 5M10A 2ARDA 2BACA 4DNAA 3UOZA 1LTXR 1VRQB 4XWZA 5C2TA 3ES8A 4M52A 4MGGA 3H4KA 2I0ZA 3CN8A 1F3PA 2B9XA 4TM3A 3CNPA 1KF6A 4GMEA 1PJ7A 2XVHA 2Z5XA 2BABA 5ER0A 2AL2B 3UTGA 5KMQA 3H8AA 4TLZA 3N4EA 3ALJA 3DESA 3REDA 4FK1A 2WP9A 4GIRA 3UKPA 2ONEA 2O56A 3IHGA 3VRAA 3P4QA 4Z24A 1NG4A 1WYGA 2CVJA 3ATRA 2AL2A 3QLDA 2IVDA 3ZLHA 2OVLA 3DK9A 1Q1WA 2XH7A 4O5UA 5KMPA 2GGJA 2JB3A 2B76A 5KNLA 2GDQA 1H82A 3DK4A 1DJQA 2VRMA 1Q9IA 5FJRA 3GO2A 2HXTA 1GTEA 3AE8A 3L5OA 2BXSA 2OZ3A 4CY6A 4A3RA 5ENLA 1PBDA 2XFQA 3KU9A 4GDPA 4ZA0A 3GSIA 3DDMA 1PXCA 3AYIA 3G5SA 4U8MA 3CXBA 3LJPA 1RYIA 3AE5A 2XGZA 2WS3A 5IDZA 2YWLA 1N61C 3ZVHB 4HB9A 3Q9TA 1ZX9A 2YG4A 3UKKA 1ONEA 2PODA 4EIPA 5G5GB 1R0MA 1GSNA 1CC4A 3G5QA 4MJWA 3BHFA 3SYIA 4CY8A 3IHMA 2NPXA 4E5TA 4J2WA 3GRSA 3NVYB 5U63A 3BJSA 1KCZA 3MSYA 1N63C 2OO6A 2EQ9A 3FPZA 1DODA 4ZOHB 3PWIA 4H2QA 2WETA 5FJUA 2W3RA 5JRBA 1ZP0A 1SJDA 4B67A 3S61A 2GVCA 3HYWA 1SJBA 2EQ6A 3KPFA 1ECQA 2V5ZA 5BOEA 1JRXA 4K2XA 1L8PA 2WPEA 4ZCWA 2IVEA 2X8HA 3BOXA 1L9DA 2YQUA 2AAQA 3ISHA 4Z2RA 3NYEA 1HYUA 3D1CA 5FJPA 1YY5A 1O94A 3IJLA 1ZDLA 3CT2A 2GRTA 3NK1X 3NGCX 2RGJA 3UKLA 2P3ZA 3HYVA 2VRLA 5BRTA 1EL5A 2QCUA 1XANA 3A7AA 4Z2UA 1TYPA 4U8OA 4YSZA 2W55A 3R0UA 3NVZB 1ZOVA 3UJ2A 2Q7VA 3IWAA 4N9XA 2POZA 4D03A 3RHAA 2GEWA 3AD8B 3T0KA 4A6GA 4JQ9A 4Z43A 3QFBA 3SZCA 4GRTA 1COYA 1H6VA 2GL5A 1SJCA 4HNCA 4JY3A 5KMRA 4II2A 2J3NA 3I6EA 1FHVA 4BV6A 4OPGA 4JY2A 4HCDA 1NHPA 2VVMA 3VC5A 1LQTA 2OLNA 3ENLA 4H2NA 5J7XA 5JCMA 3NZGA 2VQBA 1MRAA 4ICYA 2PA6A 3QPEA 3VFCA 5KVHA 3VR9A 4GFIA 2GGHA 2X8GA 2OLOA 2FJAA 3R0KA 4U8LA 2OLAA 3KUMA 4JNQA 4RSLA 4USRA 1FECA 4OPCA 4GF7A 2XLTA 2YR4A 2AR8A 3KA7A 4O5QA 1FCDA 3SBFA 3TJ4A 1S7MA 2PP3A 1OJCA 3CNTA 1RP0A 3KLJA 1BZLA 1XHCA 3M0OA 1PHHA 2XH4A 1PDHA 1MO9A 2W3SA 2BS3A 4KWSA 2P0IA 2PP0A 3UJRA
chains in the Genus database with same CATH topology
4J57A 3UTHA 5TR3A 3NN6X 3GMBA 5EB5A 4J34A 4A65A 5IQ4A 2H89A 2B7SA 2IIDA 2XFUA 2XLRA 2X99A 3CGEA 2QAEA 3DK8A 3VRDB 4B68A 3QSEA 2C3DA 2FBWA 2WP6A 2ZBWA 2WOVA 4H4TA 3F8PA 1FEAA 1PN0A 5GSNA 1IUVA 1F8SA 2C7GA 2E4GA 3UKFA 3SXIA 3B3RA 2YLRA 3AE7A 3FMWA 3NK2X 5EBKA 1REOA 4OPLA 4CBQA 4GAPA 4NNJA 3DJEA 1ZMCA 3H8IA 3QSMA 4G74A 4XXGA 2B9YA 1KSUA 1VDCA 4TM0A 3AD9B 5JCNA 3PG6A 3GD3A 3AYJA 1GRGA 1E1MA 2Q0LA 3GMCA 2A89A 4BK2A 3DJGX 1GETA 3V3OA 3ICRA 2DKHA 3GYJA 2E1MA 1D7LA 1CHUA 1GTHA 1OJDA 2YR5A 3P4SA 5CKUA 4B1BA 3AWIA 2BK4A 4CNKA 4YTMA 1IUXA 2APGA 2BRAA 1ZK7A 2RGHA 3WE0A 1CJ4A 3D8XA 4B64A 4D04A 3PS9A 1N4VA 2C72A 3AEBA 4K5RA 4AT2A 3K30A 3CNSA 2BCPA 2GF3A 3AE6A 1H7WA 4OPIA 2BCGG 1NPXA 5LV9A 5HYMA 1TYTA 2C66A 2PYXA 4LU6A 5DBJA 3CPJG 3BHKA 2EQ8A 4FX9A 1CF3A 4OCGA 4PABA 1NHRA 1GRHA 3D9XA 4H4PA 2XFNA 2WU5A 3NH3X 2GQWA 2YVFA 3R9UA 4BK3A 2YLWA 5U25A 5IQ1A 2YLSA 2X8CA 4H4RA 2BK5A 3EF6A 1GRTA 2V61A 1S3EA 1GRBA 4K5SA 4G9KA 1L9CA 4I59A 2XVFA 5KXJA 3GRTA 3DA1A 1Q1RA 3BNUA 3T2YA 1GESA 2YG5A 1X31B 3BNMA 4J31A 4YSHA 2BXRA 4ZCDA 3SZWA 4K8DA 2XLSA 5C3JA 4NZHA 1VG9A 2CFYA 4U8IA 4Y4MA 4OPDA 4K7ZA 4ZN0A 1FEBA 1N1PA 2CULA 4GCMA 5GRTA 2AQJA 3NHOX 4H4ZA 1NAAA 3DJJA 4YTPA 3EANA 2C3CA 2ZZCA 2Y6RA 4ZCCA 5JCIA 5HHFA 5JCLA 4NEVA 1DOBA 1S3BA 2XFOA 3NK0X 4NTCA 4U8NA 1H7XA 4UDRA 2GR3A 3QVRA 1FOHA 1JU2A 1JOAA 4K22A 4KX6A 3AEAA 3NG7X 1ONFA 4Z2TA 1H83A 1PXBA 4EM4A 4A99A 2OAMA 1GREA 2ARDA 2BACA 3CMMA 4DNAA 5M10A 2R46A 3UOZA 1LTXR 4JN9A 1IUTA 4TLXA 1VRQB 4XWZA 3DJDA 5C2TA 3AEGA 3QVPA 2O9ZA 4M52A 1IUUA 1Y56A 1RSGA 3NN0X 3H4KA 2I0ZA 3CN8A 4YTNA 2ZZ0A 1CJ3A 2A8XA 1F3PA 1AOGA 1KFYA 3ITJA 1DOCA 3IC9A 2B9XA 4TM3A 3CNPA 4C5OA 5IPYA 1TDKA 3ATQA 1KF6A 1PBEA 1PJ7A 2XVHA 3AXBA 2Z5XA 1JRZA 2BABA 2C4CA 3KVEA 4EIQA 5ER0A 3L8KA 3UTGA 5KMQA 1F6MA 3AECA 3AB1A 2R0CA 4UDPA 4TLZA 1PJ5A 3M12A 2EQ7A 3ALJA 3VRBA 3SFEA 3FG2P 3GWDA 4HA6A 1GRAA 1OJTA 5FS6A 1LQUA 3AEDA 3NNEA 3P4PA 1BGNA 3REDA 2WEUA 3C4NA 4FK1A 2WP9A 4NEWA 2A87A 1W4XA 3UKPA 5BVAA 4YKFA 1H84A 4YKGA 3CNJA 4BURA 3GD4A 2GH5A 4J56A 1XPQA 3I3LA 2JKCA 3AYLA 2CDUA 4I58A 5KWFA 4YWOA 2TPRA 3IHGA 3VRAA 1KN0A 1BGJA 2WESA 3P4QA 4Z24A 1NG4A 4APNA 3T14A 2CVJA 3ATRA 3UKHA 3KKJA 4H4VA 4H50A 2IVDA 3BI4A 2VVLA 2WBAA 4EM3A 3DK9A 1F8RA 1Q1WA 1GPEA 2BK3A 4OVIA 5CQFA 5BUKA 3AD7B 3S5WA 1K4QA 1TDNA 4AP3A 4O5UA 3T37A 5KMPA 4LA1A 2JB3A 1TRBA 2B76A 1EL8A 5KNLA 1H82A 2R9ZA 2JAEA 3SZ0A 3DK4A 1DJQA 3P4RA 2VRMA 1Q9IA 1XDIA 3O0HA 1JRYA 3DGZA 1CC2A 4A6NA 1GTEA 4H4WA 1B4VA 2C70A 3AE8A 3ALLA 5HY5A 2V3BA 1E7PA 2XFPA 4EQRA 4Z44A 2BS4A 1H86A 3L5OA 2BXSA 1QLBA 1QJDA 1PXAA 2R4EA 2C65A 4NTEA 3UKQA 4U2LA 1NG3A 4CY6A 2XYOA 1ELIA 2R4JA 3EPTA 2GQFA 3CIRA 3CNDA 2GR1A 1PJ6A 2WDQA 1PBDA 2XDOA 1PBCA 1E1LA 2XFQA 3NTDA 3UOYA 5KOXA 4WCTA 3KU9A 2YVJA 3CPHG 1YQ4A 4GDPA 1D5TA 2TMDA 4EMWA 3AE2A 3V3NA 3GSIA 1PXCA 3AYIA 2F5ZA 2DKIA 2WDVA 3ADAB 3G5SA 4U8MA 4AOSA 4XWRA 2GAGB 1Y56B 1E6EA 1YQ3A 3LJPA 3CGCA 1L9EA 1RYIA 3F8RA 3NYFA 3IF9A 3AE5A 1D4DA 2WS3A 3QFAA 3T2KA 1IUWA 1D7YA 4JDRA 4EQXA 4CRTA 1SEZA 1CC6A 3ZYXA 2OA1A 2XCGA 5HXIA 2YWLA 4HB9A 3Q9TA 1BF3A 4YT0A 1E39A 4IV9A 4UDQA 1ZX9A 2YG4A 2B9WA 3UKKA 2XVIA 4EIPA 4IVOB 3PO7A 3VQRA 1GSNA 1CC4A 1B5QA 2GMHA 1D4EA 4H2RA 4Z25A 3G5QA 1CL0A 3T31A 4H4YA 5KMSA 2X3NA 2GR2A 4EQWA 1N4UA 1M64A 4CCQA 4A79A 4YXDA 4NWZA 3UP5A 2C76A 2JB2A 1OJAA 4GAVA 1TDOA 4MJWA 2FJDA 2QA2A 3BHFA 5EOWA 2BYBA 2VQ7A 2XLPA 3ICSA 5L46A 3NRNA 3SYIA 2WU2A 2BA9A 4CY8A 1FL2A 4X4JA 3IHMA 3LADA 4B66A 3Q6JA 2NPXA 2R0PA 2GAHB 4H4QA 2VOUA 1MOKA 1EL7A 3QSSA 1V59A 4J2WA 5U1OA 4C77A 3GRSA 3HZLA 1NEKA 1E1KA 3LXDA 5U63A 4Y4NA 1NENA 4TM1A 4U8PA 1DJNA 1PS9A 3UP4A 4U2SA 4NTDA 4H4UA 3DGHA 5FS7A 3ICTA 4A6NB 4RG3A 2BC1A 1NHQA 1GNDA 3GDNA 4U8KA 2VZ2A 3OZ2A 2YG7A 3GDPA 3UCLA 4USQA 1GERA 1EL9A 1N4WA 3SY4A 3EAOA 4FDCB 2YLXA 2EQ9A 2UZZA 3NLCA 3II4A 3FPZA 1F8WA 1DODA 2GB0A 3K7TA 4LIIA 2WDRA 1TDFA 2RGOA 1CJCA 3FIMB 1K0LA 4G6HA 2FJEA 3UKAA 1DOEA 4J36A 4H2QA 4BK1A 2YVGA 2WETA 3LOVA 2V6OA 4AP1A 4C3YA 5JRBA 3KPKA 1ZP0A 1GRFA 3CGDA 3SGLA 4G73A 4B67A 3RNMA 3S61A 2YR6A 2GVCA 3UOVA 2NVKX 2EQ6A 3HYWA 4BJZA 4H2PA 4A5LA 1OJ9A 3KPFA 2V5ZA 1JRXA 1JNRA 3CTYA 4WX1A 3AE4A 1CJ2A 1B8SA 4K2XA 4B69A 2WPEA 1K0JA 4IA6A 2IVEA 2X8HA 2XLUA 4AT0A 2WP5A 4YSXA 4OPTA 4ADWA 1KSSA 1GXFA 1KNRA 2PHHA 1L9DA 3E1TA 4H4SA 5KOWA 2YQUA 2AAQA 1P2HA 3ISHA 4C74A 4Z2RA 3NYEA 1Z6LA 3NYCA 3QJ4A 1HYUA 1KDGA 1BWCA 2WQYA 3D1CA 1JNZA 3AE9A 4B65A 2ZZBA 3NIXA 3NKSA 3DH9A 1YY5A 4X9NA 1O94A 1D4CA 4B63A 2WPFA 4GDEA 3SZFA 2BC0A 1ZDLA 2C75A 2GMJA 2Q0KA 4J33A 2GRTA 3NK1X 5FS8A 3HYXA 3NGCX 3ABVA 3JSKA 2RGJA 3UKLA 3T2ZA 4CCRA 1M6IA 4RG4A 5KVIA 3HYVA 1B37A 2C67A 2VRLA 5BRTA 1EL5A 1ZOYA 3LZWA 4P9SA 1GEUA 1NDAA 3AE3A 3RP7A 2ACZA 2GV8A 2H88A 4IVMB 2QCUA 2YM1A 1XANA 2B7RA 3VR8A 4Z2UA 4UP3A 3UTEA 4EMIA 1TYPA 4U8OA 4ECHA 4YSZA 2HQMA 2X50A 2YLTA 4EMJA 3URHA 3LB8A 3BI5A 1LPFA 1ZOVA 2JB1A 2R45A 4Z26A 3DMEA 3CGBA 5FS9A 2Q7VA 3IWAA 4FK1C 4X9MA 4N9XA 2OALA 3GWFA 2V60A 4REKA 3OC4A 2E5VA 4D03A 1IJHA 3RHAA 2GEWA 3AD8B 4E0VA 3T0KA 5J60A 4U8JA 4PAAA 2YG6A 2RABA 1GV4A 1LV0A 2VVLG 2YLZA 1ZMDA 4JQ9A 1BKWA 4DGKA 4Z43A 3QFBA 3AEFA 1PBFA 3SZCA 3L1RA 2W0HA 4GRTA 4U2TA 2BRYA 1DNCA 1COYA 2BS2A 4CNJA 2XVEA 4H7UA 3AEEA 1PBBA 1S2YA 1H6VA 1YQZA 4G6GA 1VQWA 3COXA 3PVCA 4JY3A 5KMRA 1GT8A 4II2A 4A7AA 5JCKA 3P9UA 3KD9A 3V76A 1ZKQA 1LJ1A 4YSYA 2YAUA 2YG3A 1JEHA 2J3NA 2R0GA 2Y6QA 4BV6A 4OPGA 1UKVG 4JY2A 1L0VA 1NHPA 2QA1A 2VVMA 2C64A 3SFDA 4KPRA 1LQTA 4H4XA 1S2QA 2JK6A 2OLNA 3UOXA 4H2NA 4OPUA 1LVLA 1QO8A 5JCMA 2GR0A 5J7XA 1O95A 3NT6A 2VQBA 4GUVA 5BULA 4DSHA 3K7QX 1GALA 3GYIA 4ICYA 1K0IA 1DXLA 5KVHA 3CPIG 3VR9A 4A9WA 4C3XA 1IUSA 2X8GA 1ZY8A 2Z5YA 2OLOA 2YM2A 5M0ZA 2FJAA 5FMHA 4II3A 3G5RA 1TDEA 3K7MX 4GR1A 3FBSA 4EQSA 2FJBA 2V3AA 4U8LA 4DSGA 2WOWA 5KRQA 4JNQA 4RSLA 3RP8A 1P2EA 4USRA 3UTFA 3LZXA 1FECA 2C73A 1GOSA 4OPCA 3SX6A 4GF7A 4AOXA 2WPCA 4BJYA 1MXTA 2XLTA 2YR4A 2AR8A 3KA7A 1H81A 4O5QA 1FCDA 1VG0A 3NTAA 1S7MA 3B6DA 4Y4LA 3M13A 2WHDA 1CBOA 1OJCA 5EB4A 3C4AA 1NHSA 3CNTA 1E1NA 1H2IA 4IA5A 3C96A 1Y0PA 3ZDNA 3P1WA 1EBDA 2WOIA 1RP0A 1O5WA 3BI2A 4TM4A 3KLJA 1BZLA 1XHCA 3GYXA 3M0OA 1KNPA 3AE1A 1PHHA 3ALMA 4JNAA 3I6DA 1YKJA 1PDHA 3SM8A 1MO9A 2JBVA 3RP6A 2BS3A 3SQPA 3F8DA 2XVJA 3H8LA 2Q6UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J57 A;  3UTH A;  5TR3 A;  3NN6 X;  3GMB A;  5EB5 A;  4J34 A;  4A65 A;  5IQ4 A;  2H89 A;  2B7S A;  2IID A;  2XFU A;  2XLR A;  2X99 A;  3CGE A;  2QAE A;  3DK8 A;  3VRD B;  4B68 A;  3QSE A;  2C3D A;  2FBW A;  2WP6 A;  2ZBW A;  2WOV A;  4H4T A;  3F8P A;  1FEA A;  1PN0 A;  5GSN A;  1IUV A;  1F8S A;  2C7G A;  2E4G A;  3UKF A;  3B3R A;  2YLR A;  3AE7 A;  3FMW A;  3NK2 X;  5EBK A;  1REO A;  4OPL A;  4CBQ A;  3DJE A;  1ZMC A;  3H8I A;  3QSM A;  4XXG A;  2B9Y A;  1KSU A;  1VDC A;  4TM0 A;  3AD9 B;  5JCN A;  3GD3 A;  3AYJ A;  1GRG A;  1E1M A;  2Q0L A;  3GMC A;  2A89 A;  4BK2 A;  3DJG X;  1GET A;  3V3O A;  3ICR A;  2DKH A;  3GYJ A;  2E1M A;  1D7L A;  1CHU A;  1GTH A;  1OJD A;  2YR5 A;  3P4S A;  5CKU A;  4B1B A;  3AWI A;  2BK4 A;  4CNK A;  4YTM A;  1IUX A;  2APG A;  1ZK7 A;  2RGH A;  3WE0 A;  1CJ4 A;  3D8X A;  4B64 A;  4D04 A;  3PS9 A;  1N4V A;  2C72 A;  3AEB A;  4K5R A;  4AT2 A;  3K30 A;  3CNS A;  2BCP A;  2GF3 A;  3AE6 A;  1H7W A;  4OPI A;  2BCG G;  1NPX A;  5LV9 A;  5HYM A;  1TYT A;  2C66 A;  2PYX A;  4LU6 A;  5DBJ A;  3CPJ G;  3BHK A;  2EQ8 A;  4FX9 A;  1CF3 A;  4OCG A;  4PAB A;  1NHR A;  1GRH A;  4H4P A;  2XFN A;  3R9U A;  2WU5 A;  3NH3 X;  2GQW A;  2YVF A;  4BK3 A;  2YLW A;  5U25 A;  5IQ1 A;  2YLS A;  2X8C A;  4H4R A;  2BK5 A;  3EF6 A;  1GRT A;  2V61 A;  1S3E A;  1GRB A;  4K5S A;  5KXJ A;  1L9C A;  4I59 A;  2XVF A;  3GRT A;  3DA1 A;  1Q1R A;  3BNU A;  1GES A;  2YG5 A;  1X31 B;  3BNM A;  4J31 A;  4YSH A;  2BXR A;  4ZCD A;  4K8D A;  2XLS A;  5C3J A;  4NZH A;  1VG9 A;  2CFY A;  4U8I A;  4Y4M A;  4OPD A;  4K7Z A;  4ZN0 A;  1FEB A;  1N1P A;  2CUL A;  4GCM A;  5GRT A;  2AQJ A;  3NHO X;  4H4Z A;  1NAA A;  3DJJ A;  4YTP A;  3EAN A;  2C3C A;  2ZZC A;  2Y6R A;  4ZCC A;  5JCI A;  5HHF A;  5JCL A;  4NEV A;  1DOB A;  1S3B A;  2XFO A;  3NK0 X;  4NTC A;  4U8N A;  1H7X A;  4UDR A;  2GR3 A;  3QVR A;  1FOH A;  1JU2 A;  1JOA A;  4K22 A;  4KX6 A;  3AEA A;  3NG7 X;  1ONF A;  4Z2T A;  1H83 A;  1PXB A;  4EM4 A;  4A99 A;  2OAM A;  1GRE A;  2ARD A;  2BAC A;  5M10 A;  4DNA A;  2R46 A;  3UOZ A;  1LTX R;  4JN9 A;  1IUT A;  4TLX A;  1VRQ B;  4XWZ A;  3DJD A;  5C2T A;  3AEG A;  3QVP A;  2O9Z A;  4M52 A;  1IUU A;  1Y56 A;  1RSG A;  3NN0 X;  3H4K A;  2I0Z A;  3CN8 A;  4YTN A;  2ZZ0 A;  1CJ3 A;  2A8X A;  1F3P A;  1AOG A;  1KFY A;  3ITJ A;  1DOC A;  3IC9 A;  2B9X A;  4TM3 A;  3CNP A;  4C5O A;  5IPY A;  1TDK A;  3ATQ A;  1KF6 A;  1PBE A;  1PJ7 A;  2XVH A;  3AXB A;  2Z5X A;  1JRZ A;  2BAB A;  3KVE A;  4EIQ A;  5ER0 A;  3L8K A;  3UTG A;  1F6M A;  3AEC A;  3AB1 A;  2R0C A;  4UDP A;  4TLZ A;  1PJ5 A;  3M12 A;  2EQ7 A;  3ALJ A;  3VRB A;  3SFE A;  3FG2 P;  3GWD A;  4HA6 A;  1GRA A;  1OJT A;  5FS6 A;  1LQU A;  3AED A;  3NNE A;  3P4P A;  1BGN A;  3RED A;  2WEU A;  3C4N A;  4FK1 A;  2WP9 A;  4NEW A;  2A87 A;  1W4X A;  3UKP A;  5BVA A;  4YKF A;  1H84 A;  4YKG A;  3CNJ A;  4BUR A;  3GD4 A;  2GH5 A;  4J56 A;  1XPQ A;  3I3L A;  2JKC A;  3AYL A;  2CDU A;  4I58 A;  5KWF A;  4YWO A;  2TPR A;  3IHG A;  3VRA A;  1BGJ A;  2WES A;  3P4Q A;  4Z24 A;  1NG4 A;  4APN A;  2CVJ A;  3ATR A;  3UKH A;  3KKJ A;  4H4V A;  4H50 A;  2IVD A;  3BI4 A;  2VVL A;  2WBA A;  4EM3 A;  3DK9 A;  1F8R A;  1Q1W A;  1GPE A;  2BK3 A;  4OVI A;  5CQF A;  5BUK A;  3AD7 B;  3S5W A;  1K4Q A;  1TDN A;  4AP3 A;  4O5U A;  3T37 A;  4LA1 A;  2JB3 A;  1TRB A;  2B76 A;  1EL8 A;  1H82 A;  2R9Z A;  2JAE A;  3DK4 A;  1DJQ A;  3P4R A;  2VRM A;  1Q9I A;  1XDI A;  3O0H A;  1JRY A;  3DGZ A;  1CC2 A;  4A6N A;  1GTE A;  4H4W A;  1B4V A;  2C70 A;  3AE8 A;  3ALL A;  5HY5 A;  1E7P A;  2V3B A;  2XFP A;  4EQR A;  4Z44 A;  2BS4 A;  1H86 A;  2BXS A;  1QLB A;  1QJD A;  1PXA A;  2R4E A;  2C65 A;  4NTE A;  3UKQ A;  4U2L A;  1NG3 A;  4CY6 A;  2XYO A;  1ELI A;  2R4J A;  3EPT A;  2GQF A;  3CIR A;  3CND A;  2GR1 A;  1PJ6 A;  2WDQ A;  1PBD A;  2XDO A;  1PBC A;  1E1L A;  2XFQ A;  3NTD A;  3UOY A;  5KOX A;  4WCT A;  3KU9 A;  2YVJ A;  3CPH G;  1YQ4 A;  4GDP A;  1D5T A;  2TMD A;  4EMW A;  3AE2 A;  3V3N A;  3GSI A;  1PXC A;  3AYI A;  2F5Z A;  2DKI A;  2WDV A;  3ADA B;  3G5S A;  4U8M A;  4AOS A;  4XWR A;  2GAG B;  1Y56 B;  1E6E A;  1YQ3 A;  3LJP A;  3CGC A;  1L9E A;  1RYI A;  3F8R A;  3NYF A;  3IF9 A;  3AE5 A;  1D4D A;  2WS3 A;  3QFA A;  1IUW A;  1D7Y A;  4JDR A;  4EQX A;  4CRT A;  1SEZ A;  1CC6 A;  3ZYX A;  2OA1 A;  2XCG A;  5HXI A;  2YWL A;  4HB9 A;  3Q9T A;  1BF3 A;  4YT0 A;  1E39 A;  4IV9 A;  4UDQ A;  1ZX9 A;  2YG4 A;  2B9W A;  3UKK A;  2XVI A;  4EIP A;  4IVO B;  3PO7 A;  3VQR A;  1GSN A;  1CC4 A;  1B5Q A;  2GMH A;  1D4E A;  4H2R A;  4Z25 A;  3G5Q A;  1CL0 A;  4H4Y A;  2X3N A;  2GR2 A;  4EQW A;  1N4U A;  1M64 A;  4CCQ A;  4A79 A;  4YXD A;  3UP5 A;  2C76 A;  2JB2 A;  1OJA A;  1TDO A;  4MJW A;  2FJD A;  2QA2 A;  3BHF A;  5EOW A;  2BYB A;  2VQ7 A;  2XLP A;  3ICS A;  5L46 A;  3NRN A;  2WU2 A;  2BA9 A;  4CY8 A;  1FL2 A;  4X4J A;  3IHM A;  3LAD A;  4B66 A;  3Q6J A;  2NPX A;  2R0P A;  2GAH B;  4H4Q A;  2VOU A;  1MOK A;  1EL7 A;  3QSS A;  1V59 A;  4J2W A;  5U1O A;  4C77 A;  3GRS A;  3HZL A;  1NEK A;  1E1K A;  3LXD A;  5U63 A;  4Y4N A;  1NEN A;  4TM1 A;  4U8P A;  1DJN A;  1PS9 A;  3UP4 A;  4U2S A;  4NTD A;  4H4U A;  3DGH A;  5FS7 A;  3ICT A;  4A6N B;  4RG3 A;  2BC1 A;  1NHQ A;  1GND A;  3GDN A;  4U8K A;  2VZ2 A;  3OZ2 A;  2YG7 A;  3GDP A;  3UCL A;  4USQ A;  1GER A;  1EL9 A;  1N4W A;  3EAO A;  4FDC B;  2YLX A;  2EQ9 A;  2UZZ A;  3NLC A;  3II4 A;  3FPZ A;  1F8W A;  1DOD A;  2GB0 A;  3K7T A;  4LII A;  2WDR A;  1TDF A;  2RGO A;  1CJC A;  3FIM B;  1K0L A;  2FJE A;  3UKA A;  1DOE A;  4J36 A;  4H2Q A;  4BK1 A;  2YVG A;  2WET A;  3LOV A;  2V6O A;  4AP1 A;  4C3Y A;  1ZP0 A;  1GRF A;  3CGD A;  3SGL A;  4B67 A;  3RNM A;  3S61 A;  2YR6 A;  2GVC A;  3UOV A;  2NVK X;  2EQ6 A;  4BJZ A;  4H2P A;  4A5L A;  1OJ9 A;  3KPF A;  2V5Z A;  1JRX A;  1JNR A;  3CTY A;  4WX1 A;  3AE4 A;  1CJ2 A;  1B8S A;  4K2X A;  4B69 A;  2WPE A;  1K0J A;  4IA6 A;  2IVE A;  2X8H A;  2XLU A;  4AT0 A;  2WP5 A;  4YSX A;  4OPT A;  4ADW A;  1KSS A;  1GXF A;  1KNR A;  2PHH A;  1L9D A;  3E1T A;  4H4S A;  5KOW A;  2YQU A;  2AAQ A;  1P2H A;  3ISH A;  4C74 A;  4Z2R A;  3NYE A;  1Z6L A;  3NYC A;  3QJ4 A;  1HYU A;  1KDG A;  1BWC A;  2WQY A;  3D1C A;  1JNZ A;  3AE9 A;  4B65 A;  2ZZB A;  3NIX A;  3NKS A;  3DH9 A;  1YY5 A;  4X9N A;  1O94 A;  1D4C A;  4B63 A;  2WPF A;  4GDE A;  2BC0 A;  1ZDL A;  2C75 A;  2GMJ A;  2Q0K A;  4J33 A;  2GRT A;  3NK1 X;  5FS8 A;  3NGC X;  3ABV A;  3JSK A;  2RGJ A;  3UKL A;  4CCR A;  1M6I A;  4RG4 A;  5KVI A;  1B37 A;  2C67 A;  2VRL A;  5BRT A;  1EL5 A;  1ZOY A;  3LZW A;  4P9S A;  1GEU A;  1NDA A;  3AE3 A;  3RP7 A;  2ACZ A;  2GV8 A;  2H88 A;  4IVM B;  2QCU A;  2YM1 A;  1XAN A;  2B7R A;  3VR8 A;  4Z2U A;  4UP3 A;  3UTE A;  4EMI A;  1TYP A;  4U8O A;  4ECH A;  4YSZ A;  2HQM A;  2X50 A;  2YLT A;  4EMJ A;  3URH A;  3LB8 A;  3BI5 A;  1LPF A;  1ZOV A;  2JB1 A;  2R45 A;  4Z26 A;  3DME A;  3CGB A;  5FS9 A;  2Q7V A;  3IWA A;  4FK1 C;  4X9M A;  4N9X A;  2OAL A;  3GWF A;  2V60 A;  4REK A;  3OC4 A;  2E5V A;  4D03 A;  1IJH A;  3RHA A;  2GEW A;  3AD8 B;  4E0V A;  5J60 A;  4U8J A;  4PAA A;  2YG6 A;  2RAB A;  1GV4 A;  1LV0 A;  2VVL G;  2YLZ A;  1ZMD A;  4JQ9 A;  1BKW A;  4DGK A;  4Z43 A;  3QFB A;  3AEF A;  1PBF A;  3L1R A;  2W0H A;  4GRT A;  4U2T A;  1DNC A;  1COY A;  2BS2 A;  4CNJ A;  2XVE A;  4H7U A;  3AEE A;  1PBB A;  1S2Y A;  1H6V A;  1YQZ A;  1VQW A;  3COX A;  3PVC A;  4JY3 A;  1GT8 A;  4A7A A;  5JCK A;  3P9U A;  3KD9 A;  3V76 A;  1ZKQ A;  1LJ1 A;  4YSY A;  2YAU A;  2YG3 A;  1JEH A;  2J3N A;  2R0G A;  2Y6Q A;  4BV6 A;  4OPG A;  1UKV G;  4JY2 A;  1L0V A;  1NHP A;  2QA1 A;  2VVM A;  2C64 A;  3SFD A;  4KPR A;  1LQT A;  4H4X A;  1S2Q A;  2JK6 A;  2OLN A;  3UOX A;  4H2N A;  4OPU A;  1LVL A;  1QO8 A;  5JCM A;  2GR0 A;  5J7X A;  1O95 A;  3NT6 A;  2VQB A;  4GUV A;  5BUL A;  4DSH A;  3K7Q X;  1GAL A;  3GYI A;  4ICY A;  1K0I A;  1DXL A;  5KVH A;  3CPI G;  3VR9 A;  4A9W A;  4C3X A;  1IUS A;  2X8G A;  1ZY8 A;  2Z5Y A;  2OLO A;  2YM2 A;  5M0Z A;  2FJA A;  5FMH A;  3G5R A;  1TDE A;  3K7M X;  4GR1 A;  3FBS A;  4EQS A;  2FJB A;  2V3A A;  4U8L A;  4DSG A;  2WOW A;  5KRQ A;  4JNQ A;  4RSL A;  3RP8 A;  1P2E A;  4USR A;  3UTF A;  3LZX A;  1FEC A;  2C73 A;  1GOS A;  4OPC A;  4GF7 A;  4AOX A;  2WPC A;  4BJY A;  1MXT A;  2XLT A;  2YR4 A;  2AR8 A;  3KA7 A;  1H81 A;  4O5Q A;  1FCD A;  1VG0 A;  3NTA A;  3B6D A;  4Y4L A;  3M13 A;  2WHD A;  1CBO A;  1OJC A;  5EB4 A;  3C4A A;  1NHS A;  3CNT A;  1E1N A;  4IA5 A;  3C96 A;  1Y0P A;  3ZDN A;  3P1W A;  1EBD A;  2WOI A;  1RP0 A;  1O5W A;  3BI2 A;  4TM4 A;  3KLJ A;  1BZL A;  1XHC A;  3M0O A;  1KNP A;  3AE1 A;  1PHH A;  3ALM A;  4JNA A;  3I6D A;  1YKJ A;  1PDH A;  3SM8 A;  1MO9 A;  2JBV A;  3RP6 A;  2BS3 A;  3SQP A;  3F8D A;  2XVJ A;  3H8L A;  2Q6U A; 
#chains in the Genus database with same CATH topology
 5TR3 A;  5EB5 A;  4J34 A;  4F4R A;  3PWG A;  3OTR A;  4B68 A;  1JRO A;  4H4T A;  5GSN A;  2C7G A;  3ZLG A;  3FMW A;  5EBK A;  3DJE A;  4GGB A;  3H8I A;  4G74 A;  3QSM A;  1VDC A;  5FJO A;  2A89 A;  3V3O A;  3ICR A;  2DKH A;  3P3B A;  4B1B A;  3P4S A;  4E4U A;  4JN8 A;  2PPG A;  3AWI A;  2BK4 A;  1FFU C;  1ZK7 A;  3PS9 A;  1N4V A;  4K5R A;  4OPI A;  1NPX A;  2GGG A;  3CPJ G;  3BHK A;  4FX9 A;  1CF3 A;  1NHR A;  4H4P A;  2WU5 A;  2GQW A;  1N5W C;  2YLW A;  5U25 A;  2YLS A;  1MNS A;  3CK5 A;  4I59 A;  1F9C A;  3DER A;  3DA1 A;  3T2Y A;  1GES A;  4J31 A;  4NZH A;  3JVA A;  4Y4M A;  4ZN0 A;  1N1P A;  1JRP A;  4H4Z A;  3S5S A;  2Y6R A;  1JCT A;  5JCL A;  1S3B A;  2XFO A;  3NK0 X;  1H7X A;  2GR3 A;  1FOH A;  4FI4 A;  1JU2 A;  4Z2T A;  1GRE A;  3TQP A;  1IUT A;  3DJD A;  3QVP A;  3GC2 A;  2O9Z A;  2QDE A;  4YTN A;  1KFY A;  1AOG A;  5IPY A;  2PS2 A;  3UJS A;  1JRZ A;  1PDZ A;  3KVE A;  3H12 A;  3L8K A;  4HNL A;  4UDP A;  2QVH A;  2EQ7 A;  4K1W A;  3SFE A;  2PMQ A;  4HA6 A;  2GGI A;  5FS6 A;  1LQU A;  3AED A;  2WEU A;  2A87 A;  5BVA A;  4YKF A;  1X2H A;  4BUR A;  3AM9 A;  3I3L A;  2JKC A;  2CDU A;  2TPR A;  2HNE A;  3UXK A;  3T14 A;  4H4V A;  4M0X A;  4H50 A;  3BI4 A;  3DEQ A;  2WBA A;  3N6J A;  1GPE A;  4OVI A;  3TCS A;  4H19 A;  1K4Q A;  3FYY A;  3SQS A;  1TRB A;  2QJM A;  2JAE A;  2R9Z A;  3SZ0 A;  3FCP A;  2OQY A;  3P4R A;  1JPD X;  3O0H A;  3FXG A;  1CC2 A;  4A6N A;  2V3B A;  2QJJ A;  4EQR A;  2BS4 A;  1QLB A;  1E9I A;  3UKQ A;  3UCD A;  2R4J A;  3DG6 A;  2GR1 A;  1PJ6 A;  2XDO A;  1E1L A;  3ES7 A;  1YQ4 A;  1D5T A;  1MDL A;  2WDV A;  4IZG A;  4XWR A;  2GAG B;  1Y56 B;  2QGY A;  3CGC A;  3QFA A;  4G7F A;  3RCY A;  1SEZ A;  3MZN A;  2E3T A;  4UDQ A;  4E4F A;  2P8B A;  2NQL A;  2PSN A;  7ENL A;  4IVO B;  2FKP A;  3T31 A;  4H4Y A;  2GR2 A;  1N4U A;  1M64 A;  4A79 A;  3UP5 A;  1TKK A;  1IYX A;  4IL2 A;  2PCE A;  3UGV A;  2R0P A;  1MOK A;  1V59 A;  4YWS A;  1V97 A;  4TM1 A;  2DW7 A;  1PS9 A;  3DGH A;  3ICT A;  2BC1 A;  3VCN A;  2VZ2 A;  3OZ2 A;  4USQ A;  1EL9 A;  3NVW B;  3SY4 A;  3EAO A;  2YLX A;  3NLC A;  1F8W A;  3K7T A;  2I5Q A;  3CB3 A;  1DOE A;  4J36 A;  3DIP A;  4AP1 A;  3KPK A;  3CGD A;  4H2P A;  3NS1 B;  3RIT A;  4IA6 A;  2XLU A;  4OPT A;  1KNR A;  2PHH A;  3E1T A;  2XH2 A;  4C74 A;  1BWC A;  4X9N A;  4B63 A;  2WPF A;  3SZF A;  2GMJ A;  2Q0K A;  3ABV A;  3T2Z A;  4CCR A;  4IHC A;  4P9S A;  3K1G A;  1GEU A;  1NDA A;  3RP7 A;  2ACZ A;  2ZAD A;  2YM1 A;  4EMI A;  2X50 A;  3BI5 A;  5EU9 A;  3NO1 A;  4FK1 C;  3OC4 A;  2E5V A;  3FV9 A;  4E0V A;  4GIS A;  2PU1 A;  2YG6 A;  2RAB A;  3DG7 A;  2YLZ A;  1ZMD A;  4HN8 A;  3TOY A;  3AEF A;  2BRY A;  1DNC A;  2BS2 A;  2XVE A;  4H7U A;  3A7R A;  3AEE A;  1PBB A;  3QTP A;  1S2Y A;  1YQZ A;  3V76 A;  5JCK A;  3KD9 A;  2YAU A;  2FYM A;  1JEH A;  2OKT A;  1VQZ A;  4KPL A;  2RDX A;  1O95 A;  3NT6 A;  5BUL A;  4DSH A;  3HRD C;  3GYI A;  4A9W A;  1ZY8 A;  2YM2 A;  5FMH A;  3K7M X;  4GR1 A;  4EQS A;  2FJB A;  4JHM A;  3I6T A;  5KRQ A;  2ZC8 A;  3LZX A;  2C73 A;  3SX6 A;  1MXT A;  1SB3 B;  3NTA A;  4Y4L A;  3NRZ B;  1CBO A;  1NHS A;  3C96 A;  3ZDN A;  3P1W A;  3RO6 A;  3VA8 A;  2HZG A;  3SQP A;  3H8L A;  2Q6U A;  3UTH A;  1W6T A;  2XLR A;  3DK8 A;  3QSE A;  2WP6 A;  2WOV A;  3F8P A;  3BSM A;  1IUV A;  3UKF A;  2PGW A;  2E4G A;  3SXI A;  1ELS A;  1REO A;  4CBQ A;  4GAP A;  4NNJ A;  4XXG A;  2B9Y A;  3AN1 A;  4TM0 A;  3AD9 B;  5JCN A;  3PG6 A;  3AYJ A;  1E1M A;  3GMC A;  3DJG X;  2E1M A;  1BKH A;  1OJD A;  1IUX A;  2APG A;  2BRA A;  1CJ4 A;  4B64 A;  3D47 A;  2BCP A;  3AE6 A;  1H7W A;  2BCG G;  5LV9 A;  2PYX A;  1FHU A;  3SN1 A;  2XFN A;  3ZLF A;  4DN1 A;  3VDG A;  5IQ1 A;  2V61 A;  1S3E A;  3STP A;  1EC8 A;  2YG5 A;  4ZCD A;  4K8D A;  3DG3 A;  5C3J A;  3PFR A;  4OPD A;  2PTX A;  1NAA A;  4KT2 A;  4ZCC A;  5HHF A;  4DHG A;  3TWB A;  4E8G A;  3ZVH A;  4K22 A;  3AEA A;  3NG7 X;  3UXL A;  2OAM A;  3CMM A;  4IP4 A;  2PU0 A;  4TLX A;  2MUC A;  3AEG A;  1OEP A;  1Y56 A;  3NN0 X;  1RSG A;  3MUC A;  2ZZ0 A;  4GYP A;  2XSX A;  3ITJ A;  3ATQ A;  1DTN A;  1KKR A;  3VCC A;  1X2G A;  4IL0 A;  3AEC A;  3AB1 A;  1PJ5 A;  3M12 A;  3VRB A;  3FG2 P;  1GRA A;  3S47 A;  3C4N A;  4NEW A;  1H84 A;  3SJN A;  1RVK A;  2GH5 A;  4EWJ A;  3AYL A;  4I58 A;  1EC9 A;  1KN0 A;  1BGJ A;  2WES A;  1WUE A;  3UKH A;  3OZM A;  2VVL A;  2BK3 A;  5CQF A;  5BUK A;  3AD7 B;  4AP3 A;  3IJI A;  4LA1 A;  2P88 A;  1XDI A;  1JRY A;  3DGZ A;  2OFJ A;  5HY5 A;  2C70 A;  3ALL A;  1E7P A;  2XFP A;  4Z44 A;  3T9P A;  1H86 A;  1PXA A;  1NG3 A;  2XYO A;  1ELI A;  3EPT A;  2GQF A;  3CIR A;  3CND A;  2WDQ A;  3NTD A;  1N60 C;  4EMW A;  1TZZ A;  3V3N A;  2DKI A;  3ADA B;  1E6E A;  1L9E A;  1BQG A;  1IUW A;  1D7Y A;  3R11 A;  4JDR A;  4EQX A;  4CRT A;  3ZYX A;  2XCG A;  3UJF A;  5HXI A;  1BF3 A;  4YT0 A;  4IV9 A;  2B9W A;  2GMH A;  3FVD A;  5J04 A;  4Z25 A;  1CL0 A;  2X3N A;  4EQW A;  4GYP C;  4YXD A;  4NWZ A;  4A35 A;  2C76 A;  2JB2 A;  1OJA A;  4GAV A;  1TDO A;  5EOW A;  1R6W A;  2AKM A;  2VQ7 A;  2XLP A;  3ICS A;  2WU2 A;  2BA9 A;  4X4J A;  3LAD A;  4B66 A;  3Q6J A;  4H4Q A;  4C77 A;  2DW6 A;  1NEK A;  3LXD A;  4Y4N A;  6ENL A;  4U8P A;  1DJN A;  3UP4 A;  4NTD A;  4HPN A;  3VC6 A;  4H4U A;  1YEY A;  5FS7 A;  1NHQ A;  3GDN A;  4U8K A;  3B9J B;  3GDP A;  3UCL A;  1GER A;  2UZZ A;  3II4 A;  1TDF A;  2RGO A;  2PTY A;  3IK4 A;  4BK1 A;  2YVG A;  3LOV A;  2V6O A;  4C3Y A;  1GRF A;  3RNM A;  3V4B A;  2YR6 A;  2NVK X;  3QN3 A;  4A5L A;  1OJ9 A;  3DFY A;  1JNR A;  3CTY A;  3AE4 A;  4B69 A;  4ADW A;  1KSS A;  1GXF A;  5KOW A;  3OPS A;  1P2H A;  3QJ4 A;  1Z6L A;  3T4W A;  2WQY A;  1JNZ A;  3AE9 A;  4B65 A;  2ZZB A;  3NIX A;  3NKS A;  1D4C A;  3I4K A;  2BC0 A;  2C75 A;  4J33 A;  5FS8 A;  2OZ8 A;  4J1O A;  3JSK A;  1M6I A;  4RG4 A;  5KVI A;  4Z17 A;  2C67 A;  3LZW A;  3EUB 3;  1JDF A;  3V5C A;  2H88 A;  3V3W A;  3VR8 A;  4UP3 A;  2YLT A;  4EMJ A;  3LB8 A;  1FO4 A;  1LPF A;  3U9I A;  3FJ4 A;  2R45 A;  4Z26 A;  3HPF A;  4X9M A;  3GWF A;  2V60 A;  4REK A;  2PP1 A;  5J60 A;  4PAA A;  1LV0 A;  1BKW A;  3L1R A;  1WUF A;  2HXU A;  4CNJ A;  3CAW A;  3R10 A;  3UJE A;  5BOF A;  4A7A A;  4DWD A;  3P9U A;  2YG3 A;  4FP1 A;  1UKV G;  2QA1 A;  3U4F A;  4KPR A;  4H4X A;  1S2Q A;  2JK6 A;  4OPU A;  1LVL A;  1GAL A;  1K0I A;  4K2S A;  5M0Z A;  4II3 A;  3G5R A;  4DSG A;  2WOW A;  1T3Q C;  1GOS A;  2WPC A;  4BJY A;  1VG0 A;  4HCH A;  3M13 A;  3MWC A;  5EB4 A;  4IA5 A;  1Y0P A;  2WOI A;  1EC7 A;  3BI2 A;  3GYX A;  1KNP A;  3AE1 A;  3I6D A;  2JBV A;  2XH0 A;  3QKE A;  3R1Z A;  3Q45 A;  4J57 A;  4J3Z A;  3GMB A;  3TJI A;  4A65 A;  3T6C A;  2H89 A;  5IQ4 A;  2B7S A;  3OW1 A;  2XFU A;  1FFV C;  2FBW A;  2PTZ A;  2ZBW A;  4JN7 A;  1PN0 A;  3N4F A;  1F8S A;  3B3R A;  4HYR A;  3NK2 X;  3TTE A;  4GGH A;  1GRG A;  2Q0L A;  2AKZ A;  4BK2 A;  3TWA A;  1CHU A;  5CKU A;  4YTM A;  2RGH A;  4D04 A;  3D8X A;  3AEB A;  4AT2 A;  3K30 A;  2P8C A;  3CNS A;  2GF3 A;  5HYM A;  1TYT A;  4LU6 A;  2GGE A;  5DBJ A;  2EQ8 A;  4OCG A;  3R9U A;  4BK3 A;  3NH3 X;  4DX3 A;  5KXJ A;  4G9K A;  3GRT A;  3BNU A;  1MUC A;  3BNM A;  4H1Z A;  3SZW A;  2XLS A;  2OG9 A;  2CFY A;  4U8I A;  4K7Z A;  5GRT A;  3EAN A;  2C3C A;  2ZZC A;  5JCI A;  4IP5 A;  2QDD A;  4NTC A;  4U8N A;  4UDR A;  1PDY A;  1JOA A;  4MMW A;  2R46 A;  4JN9 A;  3A7U A;  1IUU A;  1CJ3 A;  2A8X A;  1DOC A;  4TVY A;  3IC9 A;  4C5O A;  1TDK A;  1PBE A;  3AXB A;  2PGE A;  2C4C A;  4EIQ A;  1F6M A;  2R0C A;  3GWD A;  4DXK A;  1OJT A;  2MNR A;  3P4P A;  3NNE A;  1BGN A;  2QJN A;  4E6M A;  1W4X A;  1NEL A;  4YKG A;  3H70 A;  3CNJ A;  3GD4 A;  4J56 A;  1XPQ A;  3EKG A;  1SJA A;  3ZVI A;  5KWF A;  4YWO A;  4APN A;  3KKJ A;  4EM3 A;  1F8R A;  3SN4 A;  1EBH A;  3S5W A;  1TDN A;  3T37 A;  3RR1 A;  1EL8 A;  3EEZ A;  4H4W A;  1B4V A;  1QJD A;  2R4E A;  4NTE A;  2C65 A;  4U2L A;  2QQ6 A;  3P0W A;  2E5A A;  1PBC A;  3UOY A;  5KOX A;  4WCT A;  2YVJ A;  3CPH G;  2TMD A;  1N62 C;  3AE2 A;  3P93 A;  2F5Z A;  4AOS A;  1YQ3 A;  3F8R A;  3NYF A;  3IF9 A;  2PTW A;  3UCC A;  1D4D A;  3T2K A;  4MKS A;  1CC6 A;  4G8T A;  3V5F A;  2OA1 A;  1E39 A;  3GD6 A;  1RM6 B;  1JPM A;  2XVI A;  3B97 A;  3PO7 A;  3VQR A;  1B5Q A;  1D4E A;  4H2R A;  1TE6 A;  5KMS A;  2CHR A;  4CCQ A;  1P43 A;  3GY1 A;  2FJD A;  2QA2 A;  2BYB A;  5L46 A;  3NRN A;  2OX4 A;  1FL2 A;  1ZXI C;  4DYE A;  2GAH B;  2VOU A;  1EL7 A;  3QSS A;  2AL1 A;  5U1O A;  3HZL A;  3R07 C;  1E1K A;  1NEN A;  4U2S A;  4A6N B;  4RG3 A;  3JW7 A;  1KD0 A;  1GND A;  3R25 A;  3RRA A;  2YG7 A;  1N4W A;  4FDC B;  2GB0 A;  1EBG A;  4LII A;  2WDR A;  4M6U A;  3FIM B;  1CJC A;  1K0L A;  4G6H A;  2FJE A;  3UKA A;  3NXL A;  3SGL A;  4G73 A;  3UOV A;  4BJZ A;  4WX1 A;  3SR6 B;  1CJ2 A;  3Q4D A;  1B8S A;  1K0J A;  4AT0 A;  4YSX A;  2WP5 A;  4H4S A;  3NYC A;  3MQT A;  1KDG A;  3D46 A;  4X2P A;  3DH9 A;  4GDE A;  3HYX A;  3CYJ A;  1B37 A;  3ETR B;  1ZOY A;  3AE3 A;  2GV8 A;  4IVM B;  2B7R A;  3UTE A;  4ECH A;  1VDV A;  2HQM A;  3URH A;  2JB1 A;  3DME A;  3HW2 A;  4ROP A;  3CGB A;  5FS9 A;  4ENL A;  2OAL A;  1IJH A;  4U8J A;  3AMZ A;  1GV4 A;  2VVL G;  4DGK A;  1PBF A;  3OP2 A;  2W0H A;  4U2T A;  3DGB A;  1FIQ B;  3IJQ A;  4G6G A;  1VQW A;  3COX A;  3PVC A;  1GT8 A;  3RGT A;  1ZKQ A;  1LJ1 A;  4YSY A;  1N5X A;  2Y6Q A;  2R0G A;  5FJT A;  4IT1 A;  2W54 A;  1L0V A;  3SFD A;  4HCL A;  2C64 A;  3UOX A;  1QO8 A;  2GR0 A;  4GUV A;  3K7Q X;  3NVV B;  1DXL A;  3CPI G;  3SSZ A;  4C3X A;  1IUS A;  2Z5Y A;  3N6H A;  1TDE A;  3FBS A;  2V3A A;  3RP8 A;  1P2E A;  3UTF A;  4AOX A;  5G5H B;  1H81 A;  3OZY A;  3B6D A;  4H2H A;  1NU5 A;  2WHD A;  2OQH A;  1STZ A;  3C4A A;  1E1N A;  1H2I A;  1EBD A;  2OPJ A;  1O5W A;  4TM4 A;  3ALM A;  4JNA A;  1XS2 A;  1YKJ A;  2GSH A;  3SM8 A;  3RP6 A;  3F8D A;  2XVJ A;  1MDR A;  3NN6 X;  4K8G A;  2IID A;  3JZU A;  2X99 A;  3SN0 A;  3CGE A;  2QAE A;  3VRD B;  2C3D A;  1FEA A;  2YLR A;  3AE7 A;  4OPL A;  4Z1Y A;  3H7V A;  1ZMC A;  1KSU A;  4KEM A;  3GD3 A;  1GET A;  1KKO A;  3TW9 A;  3GYJ A;  1D7L A;  1GTH A;  2YR5 A;  3PK7 A;  4CNK A;  4TVW A;  3WE0 A;  1P48 A;  2C72 A;  3DFH A;  2C66 A;  1XPY A;  4PAB A;  3D9X A;  1GRH A;  2YVF A;  2X8C A;  4H4R A;  2BK5 A;  3EF6 A;  1GRT A;  4K5S A;  1GRB A;  1L9C A;  2XVF A;  2OZT A;  1Q1R A;  3NFU A;  1X31 B;  3T8Q A;  2BXR A;  4YSH A;  1VG9 A;  1FEB A;  3MKC A;  2CUL A;  4GCM A;  2AQJ A;  3NHO X;  3DJJ A;  4YTP A;  3CXO A;  3THU A;  4NEV A;  1DOB A;  3QVR A;  3MY9 A;  4H83 A;  4KX6 A;  1ONF A;  1H83 A;  1PXB A;  4A99 A;  4EM4 A;  5M10 A;  2ARD A;  2BAC A;  4DNA A;  3UOZ A;  1LTX R;  1VRQ B;  4XWZ A;  5C2T A;  3ES8 A;  4M52 A;  4MGG A;  3H4K A;  2I0Z A;  3CN8 A;  1F3P A;  2B9X A;  4TM3 A;  3CNP A;  1KF6 A;  4GME A;  1PJ7 A;  2XVH A;  2Z5X A;  2BAB A;  5ER0 A;  2AL2 B;  3UTG A;  5KMQ A;  3H8A A;  4TLZ A;  3N4E A;  3ALJ A;  3DES A;  3RED A;  4FK1 A;  2WP9 A;  4GIR A;  3UKP A;  2ONE A;  2O56 A;  3IHG A;  3VRA A;  3P4Q A;  4Z24 A;  1NG4 A;  1WYG A;  2CVJ A;  3ATR A;  2AL2 A;  3QLD A;  2IVD A;  3ZLH A;  2OVL A;  3DK9 A;  1Q1W A;  2XH7 A;  4O5U A;  5KMP A;  2GGJ A;  2JB3 A;  2B76 A;  5KNL A;  2GDQ A;  1H82 A;  3DK4 A;  1DJQ A;  2VRM A;  1Q9I A;  5FJR A;  3GO2 A;  2HXT A;  1GTE A;  3AE8 A;  3L5O A;  2BXS A;  2OZ3 A;  4CY6 A;  4A3R A;  5ENL A;  1PBD A;  2XFQ A;  3KU9 A;  4GDP A;  4ZA0 A;  3GSI A;  3DDM A;  1PXC A;  3AYI A;  3G5S A;  4U8M A;  3CXB A;  3LJP A;  1RYI A;  3AE5 A;  2XGZ A;  2WS3 A;  5IDZ A;  2YWL A;  1N61 C;  3ZVH B;  4HB9 A;  3Q9T A;  1ZX9 A;  2YG4 A;  3UKK A;  1ONE A;  2POD A;  4EIP A;  5G5G B;  1R0M A;  1GSN A;  1CC4 A;  3G5Q A;  4MJW A;  3BHF A;  3SYI A;  4CY8 A;  3IHM A;  2NPX A;  4E5T A;  4J2W A;  3GRS A;  3NVY B;  5U63 A;  3BJS A;  1KCZ A;  3MSY A;  1N63 C;  2OO6 A;  2EQ9 A;  3FPZ A;  1DOD A;  4ZOH B;  3PWI A;  4H2Q A;  2WET A;  5FJU A;  2W3R A;  5JRB A;  1ZP0 A;  1SJD A;  4B67 A;  3S61 A;  2GVC A;  3HYW A;  1SJB A;  2EQ6 A;  3KPF A;  1ECQ A;  2V5Z A;  5BOE A;  1JRX A;  4K2X A;  1L8P A;  2WPE A;  4ZCW A;  2IVE A;  2X8H A;  3BOX A;  1L9D A;  2YQU A;  2AAQ A;  3ISH A;  4Z2R A;  3NYE A;  1HYU A;  3D1C A;  5FJP A;  1YY5 A;  1O94 A;  3IJL A;  1ZDL A;  3CT2 A;  2GRT A;  3NK1 X;  3NGC X;  2RGJ A;  3UKL A;  2P3Z A;  3HYV A;  2VRL A;  5BRT A;  1EL5 A;  2QCU A;  1XAN A;  3A7A A;  4Z2U A;  1TYP A;  4U8O A;  4YSZ A;  2W55 A;  3R0U A;  3NVZ B;  1ZOV A;  3UJ2 A;  2Q7V A;  3IWA A;  4N9X A;  2POZ A;  4D03 A;  3RHA A;  2GEW A;  3AD8 B;  3T0K A;  4A6G A;  4JQ9 A;  4Z43 A;  3QFB A;  3SZC A;  4GRT A;  1COY A;  1H6V A;  2GL5 A;  1SJC A;  4HNC A;  4JY3 A;  5KMR A;  4II2 A;  2J3N A;  3I6E A;  1FHV A;  4BV6 A;  4OPG A;  4JY2 A;  4HCD A;  1NHP A;  2VVM A;  3VC5 A;  1LQT A;  2OLN A;  3ENL A;  4H2N A;  5J7X A;  5JCM A;  3NZG A;  2VQB A;  1MRA A;  4ICY A;  2PA6 A;  3QPE A;  3VFC A;  5KVH A;  3VR9 A;  4GFI A;  2GGH A;  2X8G A;  2OLO A;  2FJA A;  3R0K A;  4U8L A;  2OLA A;  3KUM A;  4JNQ A;  4RSL A;  4USR A;  1FEC A;  4OPC A;  4GF7 A;  2XLT A;  2YR4 A;  2AR8 A;  3KA7 A;  4O5Q A;  1FCD A;  3SBF A;  3TJ4 A;  1S7M A;  2PP3 A;  1OJC A;  3CNT A;  1RP0 A;  3KLJ A;  1BZL A;  1XHC A;  3M0O A;  1PHH A;  2XH4 A;  1PDH A;  1MO9 A;  2W3S A;  2BS3 A;  4KWS A;  2P0I A;  2PP0 A;  3UJR A; 
#chains in the Genus database with same CATH homology
 4J57 A;  3UTH A;  5TR3 A;  3NN6 X;  3GMB A;  5EB5 A;  4J34 A;  4A65 A;  5IQ4 A;  2H89 A;  2B7S A;  2IID A;  2XFU A;  2XLR A;  2X99 A;  3CGE A;  2QAE A;  3DK8 A;  3VRD B;  4B68 A;  3QSE A;  2C3D A;  2FBW A;  2WP6 A;  2ZBW A;  2WOV A;  4H4T A;  3F8P A;  1FEA A;  1PN0 A;  5GSN A;  1IUV A;  1F8S A;  2C7G A;  2E4G A;  3UKF A;  3SXI A;  3B3R A;  2YLR A;  3AE7 A;  3FMW A;  3NK2 X;  5EBK A;  1REO A;  4OPL A;  4CBQ A;  4GAP A;  4NNJ A;  3DJE A;  1ZMC A;  3H8I A;  3QSM A;  4G74 A;  4XXG A;  2B9Y A;  1KSU A;  1VDC A;  4TM0 A;  3AD9 B;  5JCN A;  3PG6 A;  3GD3 A;  3AYJ A;  1GRG A;  1E1M A;  2Q0L A;  3GMC A;  2A89 A;  4BK2 A;  3DJG X;  1GET A;  3V3O A;  3ICR A;  2DKH A;  3GYJ A;  2E1M A;  1D7L A;  1CHU A;  1GTH A;  1OJD A;  2YR5 A;  3P4S A;  5CKU A;  4B1B A;  3AWI A;  2BK4 A;  4CNK A;  4YTM A;  1IUX A;  2APG A;  2BRA A;  1ZK7 A;  2RGH A;  3WE0 A;  1CJ4 A;  3D8X A;  4B64 A;  4D04 A;  3PS9 A;  1N4V A;  2C72 A;  3AEB A;  4K5R A;  4AT2 A;  3K30 A;  3CNS A;  2BCP A;  2GF3 A;  3AE6 A;  1H7W A;  4OPI A;  2BCG G;  1NPX A;  5LV9 A;  5HYM A;  1TYT A;  2C66 A;  2PYX A;  4LU6 A;  5DBJ A;  3CPJ G;  3BHK A;  2EQ8 A;  4FX9 A;  1CF3 A;  4OCG A;  4PAB A;  1NHR A;  1GRH A;  3D9X A;  4H4P A;  2XFN A;  2WU5 A;  3NH3 X;  2GQW A;  2YVF A;  3R9U A;  4BK3 A;  2YLW A;  5U25 A;  5IQ1 A;  2YLS A;  2X8C A;  4H4R A;  2BK5 A;  3EF6 A;  1GRT A;  2V61 A;  1S3E A;  1GRB A;  4K5S A;  4G9K A;  1L9C A;  4I59 A;  2XVF A;  5KXJ A;  3GRT A;  3DA1 A;  1Q1R A;  3BNU A;  3T2Y A;  1GES A;  2YG5 A;  1X31 B;  3BNM A;  4J31 A;  4YSH A;  2BXR A;  4ZCD A;  3SZW A;  4K8D A;  2XLS A;  5C3J A;  4NZH A;  1VG9 A;  2CFY A;  4U8I A;  4Y4M A;  4OPD A;  4K7Z A;  4ZN0 A;  1FEB A;  1N1P A;  2CUL A;  4GCM A;  5GRT A;  2AQJ A;  3NHO X;  4H4Z A;  1NAA A;  3DJJ A;  4YTP A;  3EAN A;  2C3C A;  2ZZC A;  2Y6R A;  4ZCC A;  5JCI A;  5HHF A;  5JCL A;  4NEV A;  1DOB A;  1S3B A;  2XFO A;  3NK0 X;  4NTC A;  4U8N A;  1H7X A;  4UDR A;  2GR3 A;  3QVR A;  1FOH A;  1JU2 A;  1JOA A;  4K22 A;  4KX6 A;  3AEA A;  3NG7 X;  1ONF A;  4Z2T A;  1H83 A;  1PXB A;  4EM4 A;  4A99 A;  2OAM A;  1GRE A;  2ARD A;  2BAC A;  3CMM A;  4DNA A;  5M10 A;  2R46 A;  3UOZ A;  1LTX R;  4JN9 A;  1IUT A;  4TLX A;  1VRQ B;  4XWZ A;  3DJD A;  5C2T A;  3AEG A;  3QVP A;  2O9Z A;  4M52 A;  1IUU A;  1Y56 A;  1RSG A;  3NN0 X;  3H4K A;  2I0Z A;  3CN8 A;  4YTN A;  2ZZ0 A;  1CJ3 A;  2A8X A;  1F3P A;  1AOG A;  1KFY A;  3ITJ A;  1DOC A;  3IC9 A;  2B9X A;  4TM3 A;  3CNP A;  4C5O A;  5IPY A;  1TDK A;  3ATQ A;  1KF6 A;  1PBE A;  1PJ7 A;  2XVH A;  3AXB A;  2Z5X A;  1JRZ A;  2BAB A;  2C4C A;  3KVE A;  4EIQ A;  5ER0 A;  3L8K A;  3UTG A;  5KMQ A;  1F6M A;  3AEC A;  3AB1 A;  2R0C A;  4UDP A;  4TLZ A;  1PJ5 A;  3M12 A;  2EQ7 A;  3ALJ A;  3VRB A;  3SFE A;  3FG2 P;  3GWD A;  4HA6 A;  1GRA A;  1OJT A;  5FS6 A;  1LQU A;  3AED A;  3NNE A;  3P4P A;  1BGN A;  3RED A;  2WEU A;  3C4N A;  4FK1 A;  2WP9 A;  4NEW A;  2A87 A;  1W4X A;  3UKP A;  5BVA A;  4YKF A;  1H84 A;  4YKG A;  3CNJ A;  4BUR A;  3GD4 A;  2GH5 A;  4J56 A;  1XPQ A;  3I3L A;  2JKC A;  3AYL A;  2CDU A;  4I58 A;  5KWF A;  4YWO A;  2TPR A;  3IHG A;  3VRA A;  1KN0 A;  1BGJ A;  2WES A;  3P4Q A;  4Z24 A;  1NG4 A;  4APN A;  3T14 A;  2CVJ A;  3ATR A;  3UKH A;  3KKJ A;  4H4V A;  4H50 A;  2IVD A;  3BI4 A;  2VVL A;  2WBA A;  4EM3 A;  3DK9 A;  1F8R A;  1Q1W A;  1GPE A;  2BK3 A;  4OVI A;  5CQF A;  5BUK A;  3AD7 B;  3S5W A;  1K4Q A;  1TDN A;  4AP3 A;  4O5U A;  3T37 A;  5KMP A;  4LA1 A;  2JB3 A;  1TRB A;  2B76 A;  1EL8 A;  5KNL A;  1H82 A;  2R9Z A;  2JAE A;  3SZ0 A;  3DK4 A;  1DJQ A;  3P4R A;  2VRM A;  1Q9I A;  1XDI A;  3O0H A;  1JRY A;  3DGZ A;  1CC2 A;  4A6N A;  1GTE A;  4H4W A;  1B4V A;  2C70 A;  3AE8 A;  3ALL A;  5HY5 A;  2V3B A;  1E7P A;  2XFP A;  4EQR A;  4Z44 A;  2BS4 A;  1H86 A;  3L5O A;  2BXS A;  1QLB A;  1QJD A;  1PXA A;  2R4E A;  2C65 A;  4NTE A;  3UKQ A;  4U2L A;  1NG3 A;  4CY6 A;  2XYO A;  1ELI A;  2R4J A;  3EPT A;  2GQF A;  3CIR A;  3CND A;  2GR1 A;  1PJ6 A;  2WDQ A;  1PBD A;  2XDO A;  1PBC A;  1E1L A;  2XFQ A;  3NTD A;  3UOY A;  5KOX A;  4WCT A;  3KU9 A;  2YVJ A;  3CPH G;  1YQ4 A;  4GDP A;  1D5T A;  2TMD A;  4EMW A;  3AE2 A;  3V3N A;  3GSI A;  1PXC A;  3AYI A;  2F5Z A;  2DKI A;  2WDV A;  3ADA B;  3G5S A;  4U8M A;  4AOS A;  4XWR A;  2GAG B;  1Y56 B;  1E6E A;  1YQ3 A;  3LJP A;  3CGC A;  1L9E A;  1RYI A;  3F8R A;  3NYF A;  3IF9 A;  3AE5 A;  1D4D A;  2WS3 A;  3QFA A;  3T2K A;  1IUW A;  1D7Y A;  4JDR A;  4EQX A;  4CRT A;  1SEZ A;  1CC6 A;  3ZYX A;  2OA1 A;  2XCG A;  5HXI A;  2YWL A;  4HB9 A;  3Q9T A;  1BF3 A;  4YT0 A;  1E39 A;  4IV9 A;  4UDQ A;  1ZX9 A;  2YG4 A;  2B9W A;  3UKK A;  2XVI A;  4EIP A;  4IVO B;  3PO7 A;  3VQR A;  1GSN A;  1CC4 A;  1B5Q A;  2GMH A;  1D4E A;  4H2R A;  4Z25 A;  3G5Q A;  1CL0 A;  3T31 A;  4H4Y A;  5KMS A;  2X3N A;  2GR2 A;  4EQW A;  1N4U A;  1M64 A;  4CCQ A;  4A79 A;  4YXD A;  4NWZ A;  3UP5 A;  2C76 A;  2JB2 A;  1OJA A;  4GAV A;  1TDO A;  4MJW A;  2FJD A;  2QA2 A;  3BHF A;  5EOW A;  2BYB A;  2VQ7 A;  2XLP A;  3ICS A;  5L46 A;  3NRN A;  3SYI A;  2WU2 A;  2BA9 A;  4CY8 A;  1FL2 A;  4X4J A;  3IHM A;  3LAD A;  4B66 A;  3Q6J A;  2NPX A;  2R0P A;  2GAH B;  4H4Q A;  2VOU A;  1MOK A;  1EL7 A;  3QSS A;  1V59 A;  4J2W A;  5U1O A;  4C77 A;  3GRS A;  3HZL A;  1NEK A;  1E1K A;  3LXD A;  5U63 A;  4Y4N A;  1NEN A;  4TM1 A;  4U8P A;  1DJN A;  1PS9 A;  3UP4 A;  4U2S A;  4NTD A;  4H4U A;  3DGH A;  5FS7 A;  3ICT A;  4A6N B;  4RG3 A;  2BC1 A;  1NHQ A;  1GND A;  3GDN A;  4U8K A;  2VZ2 A;  3OZ2 A;  2YG7 A;  3GDP A;  3UCL A;  4USQ A;  1GER A;  1EL9 A;  1N4W A;  3SY4 A;  3EAO A;  4FDC B;  2YLX A;  2EQ9 A;  2UZZ A;  3NLC A;  3II4 A;  3FPZ A;  1F8W A;  1DOD A;  2GB0 A;  3K7T A;  4LII A;  2WDR A;  1TDF A;  2RGO A;  1CJC A;  3FIM B;  1K0L A;  4G6H A;  2FJE A;  3UKA A;  1DOE A;  4J36 A;  4H2Q A;  4BK1 A;  2YVG A;  2WET A;  3LOV A;  2V6O A;  4AP1 A;  4C3Y A;  5JRB A;  3KPK A;  1ZP0 A;  1GRF A;  3CGD A;  3SGL A;  4G73 A;  4B67 A;  3RNM A;  3S61 A;  2YR6 A;  2GVC A;  3UOV A;  2NVK X;  2EQ6 A;  3HYW A;  4BJZ A;  4H2P A;  4A5L A;  1OJ9 A;  3KPF A;  2V5Z A;  1JRX A;  1JNR A;  3CTY A;  4WX1 A;  3AE4 A;  1CJ2 A;  1B8S A;  4K2X A;  4B69 A;  2WPE A;  1K0J A;  4IA6 A;  2IVE A;  2X8H A;  2XLU A;  4AT0 A;  2WP5 A;  4YSX A;  4OPT A;  4ADW A;  1KSS A;  1GXF A;  1KNR A;  2PHH A;  1L9D A;  3E1T A;  4H4S A;  5KOW A;  2YQU A;  2AAQ A;  1P2H A;  3ISH A;  4C74 A;  4Z2R A;  3NYE A;  1Z6L A;  3NYC A;  3QJ4 A;  1HYU A;  1KDG A;  1BWC A;  2WQY A;  3D1C A;  1JNZ A;  3AE9 A;  4B65 A;  2ZZB A;  3NIX A;  3NKS A;  3DH9 A;  1YY5 A;  4X9N A;  1O94 A;  1D4C A;  4B63 A;  2WPF A;  4GDE A;  3SZF A;  2BC0 A;  1ZDL A;  2C75 A;  2GMJ A;  2Q0K A;  4J33 A;  2GRT A;  3NK1 X;  5FS8 A;  3HYX A;  3NGC X;  3ABV A;  3JSK A;  2RGJ A;  3UKL A;  3T2Z A;  4CCR A;  1M6I A;  4RG4 A;  5KVI A;  3HYV A;  1B37 A;  2C67 A;  2VRL A;  5BRT A;  1EL5 A;  1ZOY A;  3LZW A;  4P9S A;  1GEU A;  1NDA A;  3AE3 A;  3RP7 A;  2ACZ A;  2GV8 A;  2H88 A;  4IVM B;  2QCU A;  2YM1 A;  1XAN A;  2B7R A;  3VR8 A;  4Z2U A;  4UP3 A;  3UTE A;  4EMI A;  1TYP A;  4U8O A;  4ECH A;  4YSZ A;  2HQM A;  2X50 A;  2YLT A;  4EMJ A;  3URH A;  3LB8 A;  3BI5 A;  1LPF A;  1ZOV A;  2JB1 A;  2R45 A;  4Z26 A;  3DME A;  3CGB A;  5FS9 A;  2Q7V A;  3IWA A;  4FK1 C;  4X9M A;  4N9X A;  2OAL A;  3GWF A;  2V60 A;  4REK A;  3OC4 A;  2E5V A;  4D03 A;  1IJH A;  3RHA A;  2GEW A;  3AD8 B;  4E0V A;  3T0K A;  5J60 A;  4U8J A;  4PAA A;  2YG6 A;  2RAB A;  1GV4 A;  1LV0 A;  2VVL G;  2YLZ A;  1ZMD A;  4JQ9 A;  1BKW A;  4DGK A;  4Z43 A;  3QFB A;  3AEF A;  1PBF A;  3SZC A;  3L1R A;  2W0H A;  4GRT A;  4U2T A;  2BRY A;  1DNC A;  1COY A;  2BS2 A;  4CNJ A;  2XVE A;  4H7U A;  3AEE A;  1PBB A;  1S2Y A;  1H6V A;  1YQZ A;  4G6G A;  1VQW A;  3COX A;  3PVC A;  4JY3 A;  5KMR A;  1GT8 A;  4II2 A;  4A7A A;  5JCK A;  3P9U A;  3KD9 A;  3V76 A;  1ZKQ A;  1LJ1 A;  4YSY A;  2YAU A;  2YG3 A;  1JEH A;  2J3N A;  2R0G A;  2Y6Q A;  4BV6 A;  4OPG A;  1UKV G;  4JY2 A;  1L0V A;  1NHP A;  2QA1 A;  2VVM A;  2C64 A;  3SFD A;  4KPR A;  1LQT A;  4H4X A;  1S2Q A;  2JK6 A;  2OLN A;  3UOX A;  4H2N A;  4OPU A;  1LVL A;  1QO8 A;  5JCM A;  2GR0 A;  5J7X A;  1O95 A;  3NT6 A;  2VQB A;  4GUV A;  5BUL A;  4DSH A;  3K7Q X;  1GAL A;  3GYI A;  4ICY A;  1K0I A;  1DXL A;  5KVH A;  3CPI G;  3VR9 A;  4A9W A;  4C3X A;  1IUS A;  2X8G A;  1ZY8 A;  2Z5Y A;  2OLO A;  2YM2 A;  5M0Z A;  2FJA A;  5FMH A;  4II3 A;  3G5R A;  1TDE A;  3K7M X;  4GR1 A;  3FBS A;  4EQS A;  2FJB A;  2V3A A;  4U8L A;  4DSG A;  2WOW A;  5KRQ A;  4JNQ A;  4RSL A;  3RP8 A;  1P2E A;  4USR A;  3UTF A;  3LZX A;  1FEC A;  2C73 A;  1GOS A;  4OPC A;  3SX6 A;  4GF7 A;  4AOX A;  2WPC A;  4BJY A;  1MXT A;  2XLT A;  2YR4 A;  2AR8 A;  3KA7 A;  1H81 A;  4O5Q A;  1FCD A;  1VG0 A;  3NTA A;  1S7M A;  3B6D A;  4Y4L A;  3M13 A;  2WHD A;  1CBO A;  1OJC A;  5EB4 A;  3C4A A;  1NHS A;  3CNT A;  1E1N A;  1H2I A;  4IA5 A;  3C96 A;  1Y0P A;  3ZDN A;  3P1W A;  1EBD A;  2WOI A;  1RP0 A;  1O5W A;  3BI2 A;  4TM4 A;  3KLJ A;  1BZL A;  1XHC A;  3GYX A;  3M0O A;  1KNP A;  3AE1 A;  1PHH A;  3ALM A;  4JNA A;  3I6D A;  1YKJ A;  1PDH A;  3SM8 A;  1MO9 A;  2JBV A;  3RP6 A;  2BS3 A;  3SQP A;  3F8D A;  2XVJ A;  3H8L A;  2Q6U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...