3CGEA

Pyridine nucleotide complexes with bacillus anthracis coenzyme a-disulfide reductase: a structural analysis of dual nad(p)h specificity
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
444
structure length
444
Chain Sequence
MNYVIIGGDAAGMSAAMQIVRNDENANVVTLEKGEIYSYAQCGLPYVISGAIASTEKLIARNVKTFRDKYGIDAKVRHEVTKVDTEKKIVYAEHTKTKDVFEFSYDRLLIATGVRPVMPEWEGRDLQGVHLLKTIPDAERILKTLETNKVEDVTIIGGGAIGLEMAETFVELGKKVRMIERNDHIGTIYDGDMAEYIYKEADKHHIEILTNENVKAFKGNERVEAVETDKGTYKADLVLVSVGVKPNTDFLEGTNIRTNHKGAIEVNAYMQTNVQDVYAAGDCATHYHVIKEIHDHIPIGTTANKQGRLAGLNMLDKRRAFKGTLGTGIIKFMNLTLARTGLNEKEAKGLHIPYKTVKVDSTNMAGYYPNAKPLYLKLLYRSDTKQLLGGQVIGEEGVDKRIDVIAMALFNKMSIHDLEDVDLSYAPPYNSVWDPIQQAARRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Pyridine Nucleotide Complexes with Bacillus anthracis Coenzyme A-Disulfide Reductase: A Structural Analysis of Dual NAD(P)H Specificity.
pubmed doi rcsb
source organism Bacillus anthracis str.
molecule tags Oxidoreductase
molecule keywords Pyridine nucleotide-disulfide oxidoreductase, class I
total genus 151
structure length 444
sequence length 444
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3cgeA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3cgeA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3cgeA02
1ZOVA 1H84A 3CPIG 1QJDA 2EQ6A 3IHGA 1CF3A 2C65A 1S3BA 2XFNA 4I59A 1L0VA 4IVMB 4D03A 4K7ZA 2YWLA 3AE8A 1BF3A 1TDKA 2R46A 4UDQA 5FS8A 2Q0KA 3AB1A 4GDPA 4AOSA 4EMIA 1PBCA 3F8RA 2YAUA 4YSZA 2J3NA 5HY5A 2CFYA 2B9XA 1YQZA 1VQWA 1LPFA 5FS9A 3KD9A 1IUXA 4ECHA 4GF7A 1VRQB 1NHSA 3ALLA 3UP5A 1M64A 3GYJA 4A6NA 1CJ4A 3BNMA 2BS2A 4K5RA 5IQ4A 2WETA 5EOWA 5EBKA 1GSNA 2V61A 2C75A 2GR3A 2VQBA 3B3RA 1OJAA 4O5UA 4EIQA 2BABA 1COYA 2FJDA 4H4WA 4BV6A 4J31A 4B64A 2V3BA 3AE3A 3GDNA 4DNAA 3CGEA 1D7YA 1GNDA 1H7XA 3FPZA 1GTHA 3GRSA 2TPRA 4Z2RA 1O94A 3OZ2A 3CGCA 1D4DA 4FK1A 3NTDA 1E39A 3QVPA 5KVHA 2A87A 3ICRA 2JKCA 1GRFA 4B66A 4YWOA 1Q9IA 2R0PA 4FK1C 3QFAA 3NGCX 3NK0X 2C7GA 4YTPA 1RSGA 3AD7B 4AT2A 2NPXA 3NH3X 3G5QA 4ADWA 3ATRA 5JCMA 4JDRA 1H82A 4O5QA 4YSYA 5BRTA 1KSUA 4JN9A 3UTHA 3QSSA 3AD8B 5J7XA 2H89A 3AEDA 3NN0X 3DJGX 3PVCA 5HHFA 3FMWA 4HA6A 2JB1A 2YM1A 1H81A 5CQFA 1ZKQA 2YG6A 4UDRA 2X99A 2X8CA 2CULA 1TRBA 4BK1A 4JY2A 1DNCA 2BS3A 3QVRA 2VRMA 2YG3A 3F8DA 3NK1X 3AE2A 1NDAA 2AR8A 2WOIA 2YG5A 3AYLA 4U2LA 3E1TA 1JRXA 1HYUA 1GXFA 4TM4A 3L1RA 1PBDA 4K8DA 4EQSA 2EQ8A 1BWCA 4A7AA 2JB2A 3ITJA 1Z6LA 2GR2A 3LADA 1E1NA 3UCLA 4H4VA 3P1WA 2VQ7A 3ALMA 4GCMA 2C76A 2JK6A 1LTXR 4NTDA 4H7UA 1P2EA 4OPTA 4C74A 4GDEA 1GOSA 1TDFA 1JNRA 2XVJA 2FBWA 4DSGA 4YXDA 4B68A 1F8SA 1W4XA 3SGLA 2C67A 2BC1A 3M0OA 1LV0A 2R4JA 4EM3A 4AOXA 2GAGB 3SM8A 2OLOA 1GERA 1PHHA 1IJHA 1F8WA 3GD4A 3RNMA 5U25A 2OALA 1KNPA 2BA9A 4TM0A 3Q9TA 3GWFA 2GV8A 5EB5A 3CNJA 3JSKA 4B1BA 1E1LA 3CNPA 3UOYA 3DJJA 5M0ZA 1GRHA 3KLJA 2B76A 4H4RA 2WDQA 3KA7A 4K22A 5J60A 3F8PA 2VRLA 3AE5A 4A6NB 4EIPA 4Z2UA 4H4QA 2XFPA 4M52A 2CVJA 2X50A 1KF6A 4BK3A 1CBOA 3M12A 4NEWA 5GRTA 1Q1WA 5FS6A 1IUVA 1PXBA 2GQWA 1P2HA 2R0GA 1PBEA 1LQUA 4H4YA 2BYBA 3II4A 3EPTA 4Z24A 5M10A 4JY3A 3O0HA 3ICTA 5L46A 4U8MA 3V3OA 2XVIA 1B8SA 2BXSA 1FEBA 2X8HA 1IUUA 3AE6A 3IWAA 4IV9A 4B69A 1DODA 3M13A 4EM4A 1NG3A 1UKVG 2DKIA 2WDRA 4J57A 3P4SA 4DGKA 3EANA 1CL0A 2WEUA 2FJAA 2JAEA 2JBVA 3OC4A 4XXGA 3KVEA 4H2RA 1GV4A 1TDNA 4TM1A 1XANA 3NKSA 1B5QA 2AQJA 4LU6A 4YT0A 3EAOA 3UTEA 5KRQA 1XPQA 1D5TA 1DJQA 1H86A 1N4WA 2WPEA 1PJ6A 4U8IA 2VVLA 2C72A 2R0CA 3NYEA 1PJ7A 2OAMA 3UKPA 5CKUA 1PBFA 1JU2A 1EL7A 1Y56B 3NNEA 1NAAA 1GALA 4U8PA 3QJ4A 1GEUA 4U8NA 1JOAA 3DJEA 2WOVA 4UP3A 3Q6JA 1JEHA 1EL8A 2C3DA 1D4EA 2Z5XA 1PS9A 2YR4A 1QLBA 4C77A 3QSEA 5DBJA 1L9CA 1MO9A 3IHMA 3CNDA 2YVGA 1JRZA 4H2PA 4CCRA 1LQTA 4AP1A 3RHAA 2C64A 2Q6UA 3LB8A 2Q0LA 1KFYA 4APNA 2EQ9A 3B6DA 4X9NA 1L9DA 4JQ9A 1E1MA 2Y6QA 2BCPA 1D7LA 3AE9A 2FJEA 1F3PA 4EQWA 2IIDA 2YLSA 2R9ZA 3DK4A 5HXIA 1CHUA 1CC6A 2BK3A 4IVOB 4Z26A 2XFOA 3ALJA 1O95A 2V6OA 2A89A 1VG0A 2YVFA 3K30A 4PABA 1GPEA 4NZHA 1V59A 2B9YA 4NTEA 2BS4A 3AEGA 1CJ3A 1DOEA 2WP5A 1D4CA 5ER0A 3AYIA 3NN6X 5KVIA 1EL9A 2VVMA 3AE1A 4ZCDA 5BUKA 3AWIA 2XVHA 3H8IA 3AECA 2YVJA 4H2QA 2VZ2A 3NK2X 5KWFA 3AE7A 1DOCA 3ISHA 2ZZBA 1NENA 3G5RA 4OPDA 4YSHA 5LV9A 2QCUA 1CC2A 4Z43A 3BI2A 1BGJA 1FL2A 4ICYA 5KXJA 1E6EA 1F6MA 2VVLG 3REDA 3CTYA 4TLZA 4YSXA 2TMDA 3UKQA 1IUSA 3DMEA 2YG4A 4BJYA 4USRA 2Z5YA 3NYCA 1GETA 3UKAA 1EBDA 1SEZA 4WCTA 4ZCCA 1GREA 2XCGA 4A9WA 1M6IA 5TR3A 1K0IA 4TM3A 4XWRA 2ZZ0A 4OPLA 3LJPA 1TDOA 4Y4LA 2WDVA 2QAEA 2I0ZA 1PJ5A 1FECA 3LZWA 4IA6A 1Q1RA 1YQ3A 4D04A 2XVFA 4H4XA 5U63A 4H50A 4U8OA 4H2NA 4YKGA 2WHDA 4KPRA 4OVIA 4CY6A 3UKFA 3RP8A 4U8JA 3GMBA 1S3EA 2OA1A 4B65A 3NHOX 3PO7A 3P4QA 1BKWA 3NT6A 1BZLA 2CDUA 3RP7A 2WU2A 4GR1A 1YY5A 1E7PA 2JB3A 1PBBA 2E4GA 4IA5A 3UKLA 1NG4A 3AEEA 2X8GA 2XLRA 3SFDA 2IVEA 4J33A 2YQUA 2BACA 2WS3A 3G5SA 4C5OA 1H6VA 3ICSA 3CIRA 4A5LA 3R9UA 4H4UA 1CJ2A 4YKFA 4A79A 3RP6A 1ZMDA 1DJNA 3H8LA 1N4VA 1RP0A 4Z2TA 3L8KA 4C3XA 2V5ZA 2APGA 3FG2P 2E5VA 4U2TA 2C66A 3CNTA 2BC0A 4RG3A 2ZZCA 1BGNA 2NVKX 1EL5A 5JCIA 2YR6A 2A8XA 2ZBWA 2C70A 4BJZA 1XHCA 1CJCA 1JRYA 3AXBA 4OPCA 2WPCA 1GRGA 2XLTA 2XDOA 2YLZA 2ARDA 2GVCA 1FEAA 1K0JA 3QSMA 3PS9A 1PN0A 4A65A 3C4AA 2C3CA 2RABA 2C73A 5BVAA 1KDGA 2Y6RA 3ZYXA 4J2WA 4CBQA 2GB0A 4NTCA 4UDPA 4CNKA 4OPGA 2RGJA 2Q7VA 3C96A 3ADAB 1X31B 2WQYA 3GDPA 1ZY8A 2B7RA 2E1MA 2OLNA 3BI5A 4Y4NA 4HB9A 4A99A 3UOZA 4AT0A 3ATQA 1OJ9A 1LVLA 1ZX9A 5EB4A 4EQXA 3BHKA 1DOBA 3I6DA 4OPUA 2YLXA 1B37A 1NHQA 3COXA 1GRBA 4MJWA 1NEKA 2XFQA 3NLCA 3P4PA 4RSLA 2RGHA 3KKJA 4EMWA 2XLPA 1AOGA 1GRAA 5U1OA 5JCNA 4EQRA 1JNZA 2YLTA 3BI4A 2WPFA 4K2XA 3T37A 3IF9A 1K0LA 3UTGA 1KNRA 1OJCA 4K5SA 1XDIA 2B9WA 2PHHA 1PXCA 2X3NA 2XLSA 3FIMB 4N9XA 4YTMA 3UKHA 3GD3A 3AYJA 3SQPA 2PYXA 3DK8A 2YLRA 3DJDA 4LA1A 1S2QA 2O9ZA 4Z25A 1TYTA 4KX6A 4USQA 2B7SA 1H7WA 2YG7A 4AP3A 1PXAA 3GWDA 3KU9A 1E1KA 4U8LA 4J56A 3SFEA 1N1PA 1VG9A 3GSIA 2BXRA 3C4NA 3P9UA 4OCGA 4XWZA 2YM2A 2F5ZA 2UZZA 5IPYA 2GH5A 1IUTA 1S2YA 2GAHB 1PDHA 2GR0A 3V76A 4U2SA 3BNUA 3GRTA 3VR8A 3EF6A 1ZK7A 5KOXA 3HZLA 4BURA 3D1CA 4EMJA 1DXLA 4J34A 1LJ1A 4FDCB 2WP6A 3QFBA 5FS7A 5JCKA 2GR1A 3AEFA 1OJDA 2EQ7A 2H88A 2BK4A 1QO8A 2GMHA 4U8KA 1Y56A 2BCGG 3CPHG 5JCLA 1GT8A 2RGOA 4Z44A 4H4TA 1YKJA 1K4QA 3DK9A 3VRAA 1B4VA 1NPXA 3LXDA 2GRTA 1Y0PA 3S61A 3CGBA 2BK5A 3DGZA 3AE4A 2AAQA 3ZDNA 3UOVA 1TDEA 4CRTA 3DA1A 3D8XA 5BULA 2GF3A 1ELIA 1CC4A 1REOA 1OJTA 2YLWA 1GESA 4TLXA 4H4SA 1F8RA 3GMCA 1KSSA 2ACZA 2GQFA 3NIXA 1ZDLA 1O5WA 3FBSA 4J36A 1TYPA 3VRBA 4C3YA 4YTNA 4ZN0A 1ZP0A 3NTAA 3WE0A 3CPJG 1NHPA 3VQRA 3IC9A 3K7QX 1ZMCA 3H4KA 5KOWA 1ONFA 3LZXA 2XFUA 4LIIA 4JNAA 4FX9A 2WESA 3K7MX 2WOWA 4X4JA 1N4UA 4OPIA 5HYMA 1VDCA 4CNJA 1MOKA 4H4PA 3AEAA 3AEBA 3CGDA 4GRTA 4REKA 4RG4A 1MXTA 1ZOYA 4WX1A 1GRTA 3DH9A 3CNSA 4PAAA 3KPFA 2V60A 2XLUA 2WP9A 4P9SA 3S5WA 4JNQA 4I58A 2QA2A 3UKKA 2GMJA 2GEWA 1RYIA 3AD9B 2XYOA 3P4RA 1FOHA 1L9EA 2FJBA 5GSNA 3V3NA 1YQ4A 4DSHA 4E0VA 3LOVA 3UTFA 2WBAA 1FCDA 2QA1A 2R45A 4X9MA 5C2TA 2VOUA 3NRNA 4GUVA 3UP4A 2V3AA 4H4ZA 4CCQA 3I3LA 3ABVA 3BHFA 3NG7X 4Y4MA 1IUWA 3VR9A 3URHA 5C3JA 3NYFA 3UOXA 2W0HA 3GYIA 4BK2A 2R4EA 2HQMA 2WU5A 4B63A 1H83A 3CN8A 5IQ1A 4B67A 4CY8A 4NEVA 2XVEA 3K7TA 2YR5A 2IVDA 3DGHA 1GTEA 3VRDB 5FMHA 1NHRA 2DKHA
chains in the Genus database with same CATH superfamily
2OPJA 4Z17A 3HW2A 2C65A 1S3BA 1L0VA 4IVMB 1BF3A 4E4FA 2R46A 3T9PA 4UDQA 1JROA 2B9XA 1LPFA 1IUXA 4NNJA 2BRYA 3UP5A 1M64A 1P48A 2WETA 4EIQA 2BABA 1COYA 1D7YA 1GNDA 3FPZA 2PCEA 3BJSA 3OZ2A 3CGCA 4FK1A 3QPEA 3QVPA 5KVHA 4IT1A 4YWSA 2R0PA 1W6TA 3NGCX 1MUCA 4ENLA 3NH3X 1H82A 1KSUA 3AD8B 4IZGA 3NN0X 3H8AA 4HNCA 4F4RA 2JB1A 5CQFA 1ZKQA 4UDRA 4BK1A 2VRMA 2YG3A 3F8DA 3AE2A 2YG5A 2MNRA 1HYUA 5G5GB 2XH4A 1BWCA 1Z6LA 2GR2A 1E1NA 2OQYA 1LTXR 4H7UA 4GDEA 1JNRA 3IK4A 4DSGA 4B68A 2XH7A 2BC1A 2R4JA 3ZVHA 1GERA 3KPKA 3RNMA 2OALA 2PS2A 2B76A 2WDQA 3KA7A 4A6NB 2P88A 4Z2UA 1KF6A 4BK3A 4GAPA 4NEWA 2R0GA 2BYBA 1JCTA 3CXOA 4U8MA 2XVIA 1B8SA 2X8HA 1IUUA 4IV9A 4B69A 4TVWA 3M13A 2DKIA 2WDRA 4J57A 1CL0A 2JAEA 2JBVA 4IL0A 1F9CA 1E9IA 4H2RA 1TDNA 1B5QA 3RO6A 4G6HA 3EAOA 4KEMA 1D5TA 2WPEA 4U8IA 2VVLA 3SXIA 1PJ7A 2OAMA 3UKPA 5CKUA 1NAAA 3QJ4A 1GEUA 4U8NA 4A6GA 3Q6JA 1JEHA 1PS9A 3T4WA 2AKMA 4H2HA 1L9CA 3IHMA 1JRZA 3AE9A 2IIDA 3OPSA 5KMPA 1MDRA 1CHUA 3U9IA 2XFOA 1O95A 2A89A 2YVFA 3K30A 4JN7A 4NZHA 3TOYA 3UJRA 3CB3A 2VVMA 3AE1A 5G5HB 4ZCDA 2YVJA 3NK2X 1DOCA 3DIPA 2QCUA 2ONEA 4Z43A 3BI2A 4HCDA 1E6EA 1KCZA 1IUSA 2YG4A 4MMWA 3R0KA 4ZCCA 2P8CA 2P3ZA 4OPLA 3LJPA 3CYJA 3LZWA 1YQ3A 3R07C 4U8OA 4YKGA 4U8JA 3DFHA 4B65A 2NQLA 3PO7A 1BKWA 3S47A 4IP5A 1X2GA 3SFDA 2XLRA 4GIRA 3QN3A 4J33A 2YQUA 4HCLA 4C5OA 1SJCA 1SJBA 4H4UA 3RP6A 3H8LA 1N4VA 2OVLA 3L8KA 4C3XA 3H12A 1WUEA 2APGA 2AL2B 4U2TA 2C66A 3CNTA 2NVKX 2ZBWA 3N4FA 3TJIA 1CJCA 3AXBA 2XLTA 3MSYA 1N5WC 2ARDA 1FFVC 2GVCA 1K0JA 3QSMA 4A65A 3C4AA 4J2WA 3H70A 4CNKA 3DG7A 2Q7VA 3L5OA 1ZY8A 2B7RA 3BI5A 4AT0A 1LVLA 5EB4A 4OPUA 3COXA 3P4PA 2OX4A 2RGHA 2XLPA 2W55A 3B9JB 4DWDA 1GRAA 1JNZA 3T37A 3IF9A 3A7UA 1OJCA 4K5SA 3UKHA 2B9WA 2XLSA 1S2QA 1H7WA 1MRAA 1PXAA 4J56A 4OCGA 1FIQB 2CHRA 5IPYA 3VC5A 3EUB3 4U2SA 3D1CA 2H88A 2BK4A 4U8KA 1Y56A 5JCLA 1YKJA 2ZC8A 1Y0PA 3S61A 3CGBA 1FHUA 3DGZA 3SY4A 2AAQA 1TDEA 3NVWB 1ELIA 2W54A 1GESA 4TLXA 3GMCA 3T2YA 1KSSA 3NIXA 1O5WA 3FBSA 3UJFA 1N61C 3K7QX 4ZOHB 3AEBA 5J04A 4REKA 4WX1A 3DH9A 4P9SA 3SBFA 3KPFA 3HYWA 2QA2A 3UKKA 2GMJA 2GEWA 1ELSA 5GSNA 1YQ4A 4E0VA 4GYPC 3UTFA 1FCDA 2QA1A 2VOUA 4GUVA 3UP4A 3BHFA 3NG7X 1IUWA 2PSNA 3NYFA 3UOXA 5BOEA 4CY8A 3FYYA 1H83A 4B67A 2IVDA 5FMHA 1NHRA 3GC2A 3NO1A 2QVHA 3IHGA 2XFNA 4K7ZA 3AE8A 5FJTA 5FS8A 4GDPA 4AOSA 1PBCA 2YAUA 4YSZA 2J3NA 1VQWA 4HPNA 3SZFA 4G6GA 3ENLA 3TTEA 4A6NA 2OQHA 5EOWA 2C75A 3B3RA 1OJAA 4H4WA 3AN1A 2V3BA 3AE3A 2C4CA 3SN4A 3DESA 1O94A 4IHCA 1E39A 3ICRA 2JKCA 3ZVIA 4B66A 4YTPA 2NPXA 1SJDA 4JDRA 4O5QA 2DW6A 4JN9A 3P0WA 5J7XA 3PVCA 3SQSA 4H19A 1ECQA 2GGJA 4TVYA 1TRBA 4JY2A 3ZLGA 3BOXA 1NDAA 4U2LA 3E1TA 1JRXA 4TM4A 4G8TA 3ITJA 3LADA 3EEZA 4GCMA 3U4FA 2JK6A 4OPTA 4NTDA 1GOSA 1P43A 4Z1YA 3SM8A 4TM0A 3MWCA 3GWFA 1E1LA 3DG3A 2QGYA 3MQTA 3V5FA 5M0ZA 3KLJA 3H7VA 4EIPA 3MKCA 2CVJA 4GGBA 1CBOA 3M12A 1Q1WA 5FS6A 1R6WA 4GGHA 3SX6A 3V3OA 1FEBA 1WUFA 3AE6A 2PTXA 1UKVG 3P4SA 3EANA 3KVEA 1GV4A 2OZTA 4YT0A 4MKSA 1PJ6A 5JRBA 2QDDA 3NYEA 2OFJA 3IJQA 1MNSA 2WOVA 1OEPA 2C3DA 2YR4A 1QLBA 5DBJA 1FFUC 4CCRA 4G7FA 1LQTA 2Q6UA 2Q0LA 4APNA 2EQ9A 3B6DA 1L9DA 3HYXA 1E1MA 3OZMA 2FJEA 1F3PA 4IL2A 1CC6A 2BK3A 4A3RA 3TWAA 2V6OA 1VG0A 4PABA 1GPEA 1V59A 1CJ3A 2WP5A 3FV9A 5BUKA 3AWIA 2XVHA 3AECA 4H2QA 3ISHA 2PP3A 2XH2A 3G5RA 4YSHA 1CC2A 3D9XA 4ICYA 3REDA 4TLZA 2TMDA 2Z5YA 1GETA 3UKAA 1SEZA 4WCTA 3SSZA 4TM3A 4XWRA 2ZZ0A 2PTZA 4Y4LA 2WDVA 3V3WA 2QAEA 3CK5A 4IA6A 4D04A 3ETRB 2XVFA 3AM9A 4H4XA 4H2NA 1XS2A 2HXUA 3RP8A 3GMBA 2OA1A 3NHOX 4GMEA 3NT6A 3RITA 3RP7A 5ENLA 3AMZA 1E7PA 2JB3A 1PBBA 3SZWA 2PA6A 3AEEA 2IVEA 4FI4A 3G5SA 1BKHA 1ZMDA 1RP0A 4Z2TA 3S5SA 3R0UA 2BC0A 2ZZCA 1EL5A 3T14A 5JCIA 2A8XA 1JRYA 3T2ZA 4OPCA 1GRGA 1FEAA 2MUCA 2RABA 5BVAA 2Y6RA 3PWGA 2GB0A 4J1OA 3R1ZA 3ADAB 2E1MA 4X2PA 4HB9A 2FYMA 3JZUA 3R10A 3BSMA 1DOBA 3OTRA 3Q45A 3Q4DA 4MJWA 2XFQA 3NLCA 1KKOA 3ZLHA 4EMWA 4EQRA 3BI4A 2P8BA 3UTGA 1XDIA 2PHHA 3P3BA 4N9XA 3GD3A 2PYXA 2PP1A 2YLRA 2OG9A 3DJDA 4Z25A 2RDXA 1BQGA 3A7RA 3KU9A 4U8LA 1E1KA 1VG9A 2PP0A 2F5ZA 1IUTA 3NZGA 4H1ZA 1TKKA 3VR8A 2HZGA 3EF6A 1ZK7A 3HZLA 4BURA 3QFBA 2QJNA 4MGGA 1OJDA 2EQ7A 3HPFA 1QO8A 2GMHA 2BCGG 4IP4A 4Z44A 1K4QA 3LXDA 2BK5A 3UOVA 4DYEA 3CT2A 5BULA 2GF3A 1JDFA 1REOA 1N60C 1OJTA 4H4SA 1F8RA 1ZDLA 3VRBA 4YTNA 3NFUA 1ZP0A 3WE0A 1NHPA 3GYXA 5FJOA 3T0KA 4E5TA 1ONFA 4FX9A 5HYMA 3CGDA 2GGIA 3RCYA 3CNSA 3S5WA 1RYIA 2XYOA 3V3NA 3LOVA 5C2TA 1FHVA 2V3AA 4H4ZA 4CCQA 3ABVA 5IDZA 4Y4MA 2W0HA 3GYIA 2WU5A 4B63A 5IQ1A 2OZ8A 3DGHA 4JN8A 2GDQA 4HCHA 2EQ6A 1CF3A 5KNLA 4D03A 2Q0KA 4K1WA 1N62C 3MZNA 2O56A 1YQZA 1V97A 5FS9A 3KD9A 4DXKA 4ECHA 4GF7A 1NHSA 3ALLA 3GYJA 4K5RA 5EBKA 2V61A 2VQBA 3P93A 3THUA 4J31A 4B64A 3SZ0A 1GTHA 3GRSA 4G74A 3NTDA 4GAVA 1Q9IA 2GGHA 4NWZA 3QFAA 3NK0X 1RSGA 4AT2A 3G5QA 4ADWA 3ATRA 5JCMA 2OZ3A 2E5AA 5BRTA 3PFRA 3QSSA 4E4UA 5HHFA 3FMWA 4HA6A 3UJSA 2X8CA 2P0IA 2CULA 2OO6A 2AR8A 2WOIA 2W3RA 1GXFA 1PBDA 4K8DA 4EQSA 2JB2A 2HXTA 3UCLA 4H4VA 4KWSA 3P1WA 4EWJA 3ALMA 2C76A 4A35A 1P2EA 3T8QA 1TDFA 4HYRA 1F8SA 3FXGA 2C67A 3M0OA 4AOXA 1PHHA 5U25A 3T6CA 3Q9TA 3GD6A 5KMRA 4M6UA 3JSKA 4B1BA 3UOYA 1EBHA 1GRHA 3SZCA 1KKRA 4K22A 3F8PA 4H4QA 2XFPA 2X50A 1EBGA 5GRTA 1PXBA 2GQWA 3EPTA 4Z24A 5M10A 3O0HA 5L46A 2BXSA 3IWAA 4DGKA 1NG3A 3UXLA 3VA8A 3PG6A 4DX3A 2AQJA 3D46A 3UTEA 1XPQA 5FJUA 1H86A 1PBFA 1JU2A 1GALA 4U8PA 1T3QC 2AL2A 1JOAA 3DJEA 4UP3A 2PODA 2XSXA 3QSEA 1MO9A 4H2PA 4AP1A 3RHAA 3LB8A 1KFYA 2Y6QA 3PWIA 1H2IA 2BCPA 1D7LA 4EQWA 2YLSA 2R9ZA 3DK4A 4IVOB 4Z26A 1KN0A 3ALJA 2BS4A 1DOEA 3NN6X 3H8IA 2QDEA 4DHGA 4G73A 3IJLA 2VZ2A 4K2SA 5KMSA 1NENA 4OPDA 5LV9A 3QKEA 1FL2A 3UCDA 3CTYA 4YSXA 3UKQA 1DTNA 4BJYA 3NYCA 3B97A 2XCGA 4A9WA 1M6IA 3STPA 1TDOA 3VCCA 3OW1A 2PPGA 1FECA 2PU1A 3DERA 4KPRA 4OVIA 4J3ZA 1RVKA 1BZLA 3PK7A 3NVYB 3NXLA 2E4GA 3UKLA 2X8GA 2BACA 2WS3A 1VDVA 1H6VA 3ICSA 3R9UA 1CJ2A 4YKFA 1DJNA 2V5ZA 3FG2P 4RG3A 1PDZA 4BJZA 1XHCA 2XDOA 2PTYA 4ZA0A 3PS9A 1PN0A 2C73A 3UJEA 4CBQA 4UDPA 4OPGA 1X31B 2WQYA 4Y4NA 3GO2A 3UOZA 4EQXA 1JPDX 1B37A 1NHQA 1NEKA 1JPMA 1WYGA 1AOGA 2GGGA 5JCNA 2PTWA 1EC9A 3DG6A 1K0LA 1KNRA 2X3NA 3DEQA 4YTMA 3CAWA 1PXCA 3TW9A 2DW7A 3AYJA 3SQPA 4LA1A 2O9ZA 1TYTA 2B7SA 3QTPA 4AP3A 3GWDA 3SFEA 1IYXA 2E3TA 3GSIA 3P9UA 3NS1B 1PDHA 2GR0A 3V76A 3NVVB 3BNUA 4EMJA 1DXLA 3SYIA 4FDCB 2WP6A 5JCKA 2GR1A 2RGOA 3SR6B 5FJPA 3AE4A 3VDGA 4CRTA 3FVDA 1CC4A 1STZA 2ACZA 4J36A 1TYPA 3UCCA 1ONEA 1VQZA 3NTAA 3CPJG 3IC9A 3NRZB 1ZMCA 4GFIA 3LZXA 2XFUA 3K7MX 4X4JA 3HRDC 1MOKA 2AL1A 3VFCA 4HNLA 1EC8A 3UXKA 1ZOYA 3ES8A 4PAAA 2V60A 3AD9B 1FOHA 4DSHA 3QLDA 4X9MA 3SJNA 3TJ4A 3VR9A 3URHA 2ZADA 2HQMA 3CN8A 4NEVA 4ZCWA 3K7TA 2YR5A 2HNEA 3VRDB 2BRAA 1ZOVA 1H84A 3CPIG 1QJDA 4I59A 3N6JA 2FKPA 2YWLA 1TDKA 2XGZA 3AB1A 4EMIA 3F8RA 5HY5A 2CFYA 3KUMA 3MUCA 1VRQB 1CJ4A 3BNMA 2BS2A 5IQ4A 1GSNA 2GR3A 4O5UA 2FJDA 4BV6A 3GDNA 4DNAA 3CGEA 1H7XA 6ENLA 2TPRA 3DDMA 4Z2RA 1D4DA 2A87A 1GRFA 4YWOA 4FK1C 2C7GA 3AD7B 1YEYA 3SN1A 4E8GA 4YSYA 3I6EA 3UTHA 2H89A 4E6MA 3AEDA 3DJGX 3RR1A 2YM1A 1H81A 2YG6A 2X99A 1DNCA 2BS3A 3QVRA 3NK1X 3AYLA 3T2KA 1SB3B 3L1RA 2EQ8A 4A7AA 2VQ7A 4C74A 2XVJA 2FBWA 2QQ6A 4YXDA 3ZLFA 1W4XA 3SGLA 3NVZB 1LV0A 4EM3A 2GAGB 2OLOA 1N5XA 1F8WA 3GD4A 1L8PA 1IJHA 1KNPA 2BA9A 2GV8A 1X2HA 4KT2A 3CNJA 5EB5A 3CNPA 3DJJA 4H4RA 5J60A 2VRLA 3AE5A 3SN0A 4M52A 3N4EA 1IUVA 1P2HA 1PBEA 1LQUA 4H4YA 3II4A 1NELA 4JY3A 3ICTA 1DODA 4EM4A 3V5CA 2WEUA 2FJAA 3OC4A 4XXGA 4TM1A 1XANA 5KMQA 3V4BA 3NKSA 4LU6A 2QJMA 5KRQA 1N4WA 1DJQA 1S7MA 3TQPA 3HYVA 2C72A 2R0CA 1Y56B 1EL7A 3NNEA 3I4KA 4GISA 3CMMA 1EL8A 2W3SA 1D4EA 2Z5XA 4C77A 3CNDA 2YVGA 3FCPA 4GYPA 2C64A 1PDYA 2OKTA 4X9NA 4JQ9A 3ZVHB 3R25A 5HXIA 5EU9A 1FO4A 2B9YA 4NTEA 3AEGA 3AYIA 1D4CA 5ER0A 5KVIA 4HN8A 1EL9A 7ENLA 4JHMA 1RM6B 5KWFA 3AE7A 1NU5A 3CXBA 2ZZBA 2PMQA 1BGJA 5KXJA 1N63C 1F6MA 2VVLG 3DMEA 4USRA 4ROPA 1EBDA 2I5QA 1MDLA 1GREA 3I6TA 5TR3A 1K0IA 3GY1A 3OZYA 3EKGA 2I0ZA 1PJ5A 1Q1RA 5U63A 4H50A 3JVAA 2WHDA 4CY6A 3UKFA 4K8GA 1S3EA 3P4QA 2CDUA 1R0MA 2WU2A 4GR1A 1YY5A 3K1GA 4IA5A 1NG4A 3IJIA 3CIRA 4A5LA 4A79A 3VC6A 3FJ4A 2QJJA 5BOFA 2E5VA 3OP2A 4KPLA 1TE6A 4DN1A 1BGNA 4FP1A 2YR6A 2C70A 2WPCA 2YLZA 3MY9A 2GGEA 2C3CA 1KDGA 3ZYXA 2PGWA 3RGTA 4NTCA 4H83A 3UGVA 2RGJA 3C96A 3R11A 3GDPA 2OLNA 4A99A 2XH0A 3ATQA 1OJ9A 1ZX9A 2GSHA 3BHKA 3I6DA 2YLXA 2AKZA 1GRBA 4RSLA 3KKJA 3JW7A 5U1OA 2YLTA 2WPFA 4K2XA 3FIMB 3TWBA 3N6HA 3DK8A 4M0XA 3DFYA 4KX6A 4USQA 2PGEA 3DGBA 2YG7A 1N1PA 2BXRA 4XWZA 3C4NA 2PU0A 2YM2A 2UZZA 2GH5A 1S2YA 2GAHB 2POZA 3GRTA 5KOXA 4J34A 1JRPA 1LJ1A 3RRAA 5FS7A 4II3A 3AEFA 3CPHG 1GT8A 4H4TA 4II2A 3VRAA 3DK9A 3UJ2A 1B4VA 1NPXA 2GRTA 3TCSA 3ZDNA 1TZZA 3DA1A 3D8XA 2YLWA 3VCNA 2GQFA 4C3YA 4ZN0A 1EC7A 3VQRA 3ES7A 3H4KA 5KOWA 4LIIA 4JNAA 2WESA 2WOWA 1N4UA 4OPIA 1VDCA 4CNJA 4H4PA 3AEAA 4G9KA 1KD0A 3D47A 4GRTA 1XPYA 4RG4A 1MXTA 1GRTA 2XLUA 5FJRA 2WP9A 4JNQA 4I58A 1SJAA 2GL5A 3P4RA 1L9EA 2FJBA 2WBAA 2R45A 3T31A 3NRNA 3I3LA 5C3JA 4BK2A 2OLAA 2R4EA 1ZXIC 2XVEA 1GTEA 2DKHA 3A7AA
chains in the Genus database with same CATH topology
1ZOVA 1H84A 3CPIG 1QJDA 2EQ6A 3IHGA 1CF3A 2C65A 5KNLA 1S3BA 2XFNA 4I59A 1L0VA 4IVMB 4D03A 4K7ZA 2YWLA 3AE8A 1BF3A 1TDKA 2R46A 4UDQA 5FS8A 2Q0KA 3AB1A 4GDPA 4AOSA 4EMIA 1PBCA 3F8RA 2YAUA 4YSZA 2J3NA 5HY5A 2CFYA 2B9XA 1YQZA 1VQWA 3SZFA 1LPFA 5FS9A 3KD9A 1IUXA 4ECHA 4NNJA 2BRYA 4G6GA 4GF7A 1VRQB 1NHSA 3ALLA 3UP5A 1M64A 3GYJA 4A6NA 1CJ4A 3BNMA 2BS2A 4K5RA 5IQ4A 2WETA 5EOWA 5EBKA 1GSNA 2V61A 2C75A 2GR3A 2VQBA 3B3RA 1OJAA 4O5UA 4EIQA 2BABA 1COYA 2FJDA 4H4WA 4BV6A 4J31A 4B64A 2V3BA 3AE3A 3GDNA 4DNAA 3CGEA 1D7YA 1H7XA 1GNDA 2C4CA 1GTHA 3FPZA 3SZ0A 3GRSA 2TPRA 4Z2RA 1O94A 3OZ2A 3CGCA 1D4DA 4FK1A 4G74A 3NTDA 1E39A 3QVPA 5KVHA 2A87A 3ICRA 2JKCA 1GRFA 4B66A 4GAVA 4YWOA 1Q9IA 2R0PA 4FK1C 4NWZA 3QFAA 3NGCX 3NK0X 2C7GA 4YTPA 1RSGA 3AD7B 4AT2A 2NPXA 3NH3X 3G5QA 4ADWA 3ATRA 5JCMA 4JDRA 1H82A 4O5QA 4YSYA 5BRTA 1KSUA 4JN9A 3UTHA 3QSSA 3AD8B 5J7XA 2H89A 3AEDA 3NN0X 3DJGX 3PVCA 5HHFA 3FMWA 4HA6A 2JB1A 2YM1A 1H81A 5CQFA 1ZKQA 2YG6A 4UDRA 2X99A 2X8CA 2CULA 1TRBA 4BK1A 4JY2A 1DNCA 2BS3A 3QVRA 2VRMA 2YG3A 3F8DA 3NK1X 3AE2A 1NDAA 2AR8A 2WOIA 2YG5A 3AYLA 4U2LA 3T2KA 3E1TA 1JRXA 1HYUA 1GXFA 4TM4A 3L1RA 1PBDA 4K8DA 4EQSA 2EQ8A 1BWCA 4A7AA 2JB2A 3ITJA 1Z6LA 2GR2A 3LADA 1E1NA 3UCLA 4H4VA 3P1WA 2VQ7A 3ALMA 4GCMA 2C76A 2JK6A 1LTXR 4NTDA 4H7UA 1P2EA 4OPTA 4C74A 4GDEA 1GOSA 1TDFA 1JNRA 2XVJA 2FBWA 4DSGA 4YXDA 4B68A 1F8SA 1W4XA 3SGLA 2C67A 2BC1A 3M0OA 1LV0A 2R4JA 4EM3A 4AOXA 2GAGB 3SM8A 2OLOA 1GERA 1PHHA 3KPKA 1IJHA 1F8WA 3GD4A 3RNMA 5U25A 2OALA 1KNPA 2BA9A 4TM0A 3Q9TA 3GWFA 2GV8A 5EB5A 3CNJA 5KMRA 3JSKA 4B1BA 1E1LA 3CNPA 3UOYA 3DJJA 5M0ZA 1GRHA 3KLJA 3SZCA 2B76A 4H4RA 2WDQA 3KA7A 4K22A 5J60A 3F8PA 2VRLA 3AE5A 4A6NB 4EIPA 4Z2UA 4H4QA 2XFPA 4M52A 2CVJA 2X50A 1KF6A 4BK3A 4GAPA 1CBOA 3M12A 4NEWA 5GRTA 1Q1WA 5FS6A 1IUVA 1PXBA 2GQWA 1P2HA 2R0GA 1PBEA 1LQUA 4H4YA 2BYBA 3II4A 3EPTA 4Z24A 5M10A 4JY3A 3O0HA 3ICTA 5L46A 4U8MA 3SX6A 3V3OA 2XVIA 1B8SA 2BXSA 1FEBA 2X8HA 1IUUA 3AE6A 3IWAA 4IV9A 4B69A 1DODA 3M13A 4EM4A 1NG3A 1UKVG 2DKIA 2WDRA 4J57A 3P4SA 4DGKA 3EANA 1CL0A 2WEUA 2FJAA 2JAEA 2JBVA 3OC4A 4XXGA 3KVEA 4H2RA 1GV4A 3PG6A 1TDNA 4TM1A 1XANA 5KMQA 3NKSA 1B5QA 2AQJA 4G6HA 4LU6A 4YT0A 3EAOA 3UTEA 5KRQA 1XPQA 1D5TA 1DJQA 1H86A 1N4WA 2WPEA 5JRBA 1PJ6A 1S7MA 2VVLA 4U8IA 3HYVA 3SXIA 2C72A 2R0CA 3NYEA 1PJ7A 2OAMA 3UKPA 5CKUA 1PBFA 1JU2A 1EL7A 1Y56B 3NNEA 1NAAA 1GALA 4U8PA 3QJ4A 1GEUA 4U8NA 1JOAA 3DJEA 3CMMA 2WOVA 4UP3A 3Q6JA 1JEHA 1EL8A 2C3DA 1D4EA 2Z5XA 1PS9A 2YR4A 1QLBA 4C77A 3QSEA 5DBJA 1L9CA 1MO9A 3IHMA 3CNDA 2YVGA 1JRZA 4H2PA 4CCRA 1LQTA 4AP1A 3RHAA 2C64A 2Q6UA 3LB8A 2Q0LA 1KFYA 4APNA 2EQ9A 3B6DA 4X9NA 1L9DA 4JQ9A 3HYXA 1E1MA 2Y6QA 1H2IA 2BCPA 1D7LA 3AE9A 2FJEA 1F3PA 4EQWA 2IIDA 2YLSA 5KMPA 2R9ZA 3DK4A 5HXIA 1CHUA 1CC6A 2BK3A 4IVOB 4Z26A 2XFOA 1KN0A 3ALJA 1O95A 2V6OA 2A89A 1VG0A 2YVFA 3K30A 4PABA 1GPEA 4NZHA 1V59A 2B9YA 4NTEA 2BS4A 3AEGA 1CJ3A 1DOEA 2WP5A 1D4CA 5ER0A 3AYIA 3NN6X 5KVIA 1EL9A 2VVMA 3AE1A 4ZCDA 5BUKA 3AWIA 2XVHA 3H8IA 3AECA 2YVJA 4G73A 4H2QA 2VZ2A 3NK2X 5KWFA 3AE7A 1DOCA 5KMSA 3ISHA 2ZZBA 1NENA 3G5RA 4OPDA 4YSHA 5LV9A 2QCUA 1CC2A 4Z43A 3BI2A 3D9XA 1BGJA 1FL2A 4ICYA 5KXJA 1E6EA 1F6MA 2VVLG 3REDA 3CTYA 4TLZA 4YSXA 2TMDA 3UKQA 1IUSA 3DMEA 2YG4A 4BJYA 4USRA 2Z5YA 3NYCA 1GETA 3UKAA 1EBDA 1SEZA 4WCTA 4ZCCA 1GREA 2XCGA 4A9WA 1M6IA 5TR3A 1K0IA 4TM3A 4XWRA 2ZZ0A 4OPLA 3LJPA 1TDOA 4Y4LA 2WDVA 2QAEA 2I0ZA 1PJ5A 1FECA 3LZWA 4IA6A 1Q1RA 1YQ3A 4D04A 2XVFA 4H4XA 5U63A 4H50A 4U8OA 4H2NA 4YKGA 2WHDA 4KPRA 4OVIA 4CY6A 3UKFA 3RP8A 4U8JA 3GMBA 1S3EA 2OA1A 4B65A 3NHOX 3PO7A 3P4QA 1BKWA 3NT6A 1BZLA 2CDUA 3RP7A 2WU2A 4GR1A 1YY5A 1E7PA 2JB3A 1PBBA 2E4GA 4IA5A 3SZWA 3UKLA 1NG4A 3AEEA 2X8GA 2XLRA 3SFDA 2IVEA 4J33A 2YQUA 2BACA 2WS3A 3G5SA 4C5OA 1H6VA 3ICSA 3CIRA 4A5LA 3R9UA 4H4UA 1CJ2A 4YKFA 4A79A 3RP6A 1ZMDA 1DJNA 3H8LA 1N4VA 1RP0A 4Z2TA 3L8KA 4C3XA 2V5ZA 2APGA 3FG2P 2E5VA 4U2TA 2C66A 3CNTA 2BC0A 4RG3A 2ZZCA 1BGNA 2NVKX 1EL5A 3T14A 5JCIA 2YR6A 2A8XA 2ZBWA 2C70A 4BJZA 1XHCA 1CJCA 1JRYA 3AXBA 3T2ZA 4OPCA 2WPCA 1GRGA 2XLTA 2XDOA 2YLZA 2ARDA 2GVCA 1FEAA 1K0JA 3QSMA 3PS9A 1PN0A 4A65A 3C4AA 2C3CA 2RABA 2C73A 5BVAA 1KDGA 2Y6RA 3ZYXA 4J2WA 4CBQA 2GB0A 4NTCA 4UDPA 4CNKA 4OPGA 2RGJA 2Q7VA 3C96A 3ADAB 1X31B 2WQYA 3L5OA 3GDPA 1ZY8A 2B7RA 2E1MA 2OLNA 3BI5A 4Y4NA 4HB9A 4A99A 3UOZA 4AT0A 3ATQA 1OJ9A 1LVLA 1ZX9A 5EB4A 4EQXA 3BHKA 1DOBA 3I6DA 4OPUA 2YLXA 1B37A 1NHQA 3COXA 1GRBA 4MJWA 1NEKA 2XFQA 3NLCA 3P4PA 4RSLA 2RGHA 3KKJA 4EMWA 2XLPA 1AOGA 1GRAA 5U1OA 5JCNA 4EQRA 1JNZA 2YLTA 3BI4A 2WPFA 4K2XA 3T37A 3IF9A 1K0LA 3UTGA 1KNRA 1OJCA 4K5SA 1XDIA 2B9WA 2PHHA 1PXCA 2X3NA 2XLSA 3FIMB 4N9XA 4YTMA 3UKHA 3GD3A 3AYJA 3SQPA 2PYXA 3DK8A 2YLRA 3DJDA 4LA1A 1S2QA 2O9ZA 4Z25A 1TYTA 4KX6A 4USQA 2B7SA 1H7WA 2YG7A 4AP3A 1PXAA 3GWDA 3KU9A 1E1KA 4U8LA 4J56A 3SFEA 1N1PA 1VG9A 3GSIA 2BXRA 3C4NA 3P9UA 4OCGA 4XWZA 2YM2A 2F5ZA 2UZZA 5IPYA 2GH5A 1IUTA 1S2YA 2GAHB 1PDHA 2GR0A 3V76A 4U2SA 3BNUA 3GRTA 3VR8A 3EF6A 1ZK7A 5KOXA 3HZLA 4BURA 3D1CA 4EMJA 1DXLA 4J34A 1LJ1A 3SYIA 4FDCB 2WP6A 3QFBA 5FS7A 5JCKA 4II3A 2GR1A 3AEFA 1OJDA 2EQ7A 2H88A 2BK4A 1QO8A 2GMHA 4U8KA 1Y56A 2BCGG 3CPHG 5JCLA 1GT8A 2RGOA 4Z44A 4H4TA 1YKJA 4II2A 1K4QA 3DK9A 3VRAA 1B4VA 1NPXA 3LXDA 2GRTA 1Y0PA 3S61A 3CGBA 2BK5A 3DGZA 3AE4A 3SY4A 2AAQA 3ZDNA 3UOVA 1TDEA 4CRTA 3DA1A 3D8XA 5BULA 2GF3A 1ELIA 1CC4A 1REOA 1OJTA 2YLWA 1GESA 4TLXA 4H4SA 1F8RA 3GMCA 1KSSA 3T2YA 2ACZA 2GQFA 3NIXA 1ZDLA 1O5WA 3FBSA 4J36A 1TYPA 3VRBA 4C3YA 4YTNA 4ZN0A 1ZP0A 3NTAA 3WE0A 3CPJG 1NHPA 3GYXA 3T0KA 3VQRA 3IC9A 3K7QX 1ZMCA 3H4KA 5KOWA 1ONFA 3LZXA 2XFUA 4LIIA 4JNAA 4FX9A 2WESA 3K7MX 2WOWA 4X4JA 1N4UA 4OPIA 5HYMA 1VDCA 4CNJA 1MOKA 4H4PA 3AEAA 3AEBA 4G9KA 3CGDA 4GRTA 4REKA 4RG4A 1MXTA 1ZOYA 4WX1A 1GRTA 3DH9A 3CNSA 4PAAA 3KPFA 2V60A 2XLUA 2WP9A 3HYWA 4P9SA 4JNQA 3S5WA 4I58A 2QA2A 3UKKA 2GMJA 2GEWA 1RYIA 3AD9B 2XYOA 3P4RA 1FOHA 1L9EA 2FJBA 5GSNA 3V3NA 1YQ4A 4DSHA 4E0VA 3LOVA 3UTFA 2WBAA 1FCDA 2QA1A 2R45A 4X9MA 5C2TA 3T31A 2VOUA 3NRNA 4GUVA 3UP4A 2V3AA 4H4ZA 4CCQA 3I3LA 3ABVA 3BHFA 3NG7X 4Y4MA 1IUWA 3VR9A 3URHA 5C3JA 3NYFA 3UOXA 2W0HA 3GYIA 4BK2A 2R4EA 2HQMA 2WU5A 4B63A 1H83A 3CN8A 5IQ1A 4B67A 4CY8A 4NEVA 2XVEA 3K7TA 2YR5A 2IVDA 3DGHA 1GTEA 3VRDB 5FMHA 1NHRA 2DKHA 2BRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZOV A;  1H84 A;  3CPI G;  1QJD A;  2EQ6 A;  3IHG A;  1CF3 A;  2C65 A;  1S3B A;  2XFN A;  4I59 A;  1L0V A;  4IVM B;  4D03 A;  4K7Z A;  2YWL A;  3AE8 A;  1BF3 A;  1TDK A;  2R46 A;  4UDQ A;  5FS8 A;  2Q0K A;  3AB1 A;  4GDP A;  4AOS A;  4EMI A;  1PBC A;  3F8R A;  2YAU A;  4YSZ A;  2J3N A;  5HY5 A;  2CFY A;  2B9X A;  1YQZ A;  1VQW A;  1LPF A;  5FS9 A;  3KD9 A;  1IUX A;  4ECH A;  4GF7 A;  1VRQ B;  1NHS A;  3ALL A;  3UP5 A;  1M64 A;  3GYJ A;  4A6N A;  1CJ4 A;  3BNM A;  2BS2 A;  4K5R A;  5IQ4 A;  2WET A;  5EOW A;  5EBK A;  1GSN A;  2V61 A;  2C75 A;  2GR3 A;  2VQB A;  3B3R A;  1OJA A;  4O5U A;  4EIQ A;  2BAB A;  1COY A;  2FJD A;  4H4W A;  4BV6 A;  4J31 A;  4B64 A;  2V3B A;  3AE3 A;  3GDN A;  4DNA A;  3CGE A;  1D7Y A;  1GND A;  1H7X A;  3FPZ A;  1GTH A;  3GRS A;  2TPR A;  4Z2R A;  1O94 A;  3OZ2 A;  3CGC A;  1D4D A;  4FK1 A;  3NTD A;  1E39 A;  3QVP A;  5KVH A;  2A87 A;  3ICR A;  2JKC A;  1GRF A;  4B66 A;  4YWO A;  1Q9I A;  2R0P A;  4FK1 C;  3QFA A;  3NGC X;  3NK0 X;  2C7G A;  4YTP A;  1RSG A;  3AD7 B;  4AT2 A;  2NPX A;  3NH3 X;  3G5Q A;  4ADW A;  3ATR A;  5JCM A;  4JDR A;  1H82 A;  4O5Q A;  4YSY A;  5BRT A;  1KSU A;  4JN9 A;  3UTH A;  3QSS A;  3AD8 B;  5J7X A;  2H89 A;  3AED A;  3NN0 X;  3DJG X;  3PVC A;  5HHF A;  3FMW A;  4HA6 A;  2JB1 A;  2YM1 A;  1H81 A;  5CQF A;  1ZKQ A;  2YG6 A;  4UDR A;  2X99 A;  2X8C A;  2CUL A;  1TRB A;  4BK1 A;  4JY2 A;  1DNC A;  2BS3 A;  3QVR A;  2VRM A;  2YG3 A;  3F8D A;  3NK1 X;  3AE2 A;  1NDA A;  2AR8 A;  2WOI A;  2YG5 A;  3AYL A;  4U2L A;  3E1T A;  1JRX A;  1HYU A;  1GXF A;  4TM4 A;  3L1R A;  1PBD A;  4K8D A;  4EQS A;  2EQ8 A;  1BWC A;  4A7A A;  2JB2 A;  3ITJ A;  1Z6L A;  2GR2 A;  3LAD A;  1E1N A;  3UCL A;  4H4V A;  3P1W A;  2VQ7 A;  3ALM A;  4GCM A;  2C76 A;  2JK6 A;  1LTX R;  4NTD A;  4H7U A;  1P2E A;  4OPT A;  4C74 A;  4GDE A;  1GOS A;  1TDF A;  1JNR A;  2XVJ A;  2FBW A;  4DSG A;  4YXD A;  4B68 A;  1F8S A;  1W4X A;  3SGL A;  2C67 A;  2BC1 A;  3M0O A;  1LV0 A;  2R4J A;  4EM3 A;  4AOX A;  2GAG B;  3SM8 A;  2OLO A;  1GER A;  1PHH A;  1IJH A;  1F8W A;  3GD4 A;  3RNM A;  5U25 A;  2OAL A;  1KNP A;  2BA9 A;  4TM0 A;  3Q9T A;  3GWF A;  2GV8 A;  5EB5 A;  3CNJ A;  3JSK A;  4B1B A;  1E1L A;  3CNP A;  3UOY A;  3DJJ A;  5M0Z A;  1GRH A;  3KLJ A;  2B76 A;  4H4R A;  2WDQ A;  3KA7 A;  4K22 A;  5J60 A;  3F8P A;  2VRL A;  3AE5 A;  4A6N B;  4EIP A;  4Z2U A;  4H4Q A;  2XFP A;  4M52 A;  2CVJ A;  2X50 A;  1KF6 A;  4BK3 A;  1CBO A;  3M12 A;  4NEW A;  5GRT A;  1Q1W A;  5FS6 A;  1IUV A;  1PXB A;  2GQW A;  1P2H A;  2R0G A;  1PBE A;  1LQU A;  4H4Y A;  2BYB A;  3II4 A;  3EPT A;  4Z24 A;  5M10 A;  4JY3 A;  3O0H A;  3ICT A;  5L46 A;  4U8M A;  3V3O A;  2XVI A;  1B8S A;  2BXS A;  1FEB A;  2X8H A;  1IUU A;  3AE6 A;  3IWA A;  4IV9 A;  4B69 A;  1DOD A;  3M13 A;  4EM4 A;  1NG3 A;  1UKV G;  2DKI A;  2WDR A;  4J57 A;  3P4S A;  4DGK A;  3EAN A;  1CL0 A;  2WEU A;  2FJA A;  2JAE A;  2JBV A;  3OC4 A;  4XXG A;  3KVE A;  4H2R A;  1GV4 A;  1TDN A;  4TM1 A;  1XAN A;  3NKS A;  1B5Q A;  2AQJ A;  4LU6 A;  4YT0 A;  3EAO A;  3UTE A;  5KRQ A;  1XPQ A;  1D5T A;  1DJQ A;  1H86 A;  1N4W A;  2WPE A;  1PJ6 A;  4U8I A;  2VVL A;  2C72 A;  2R0C A;  3NYE A;  1PJ7 A;  2OAM A;  3UKP A;  5CKU A;  1PBF A;  1JU2 A;  1EL7 A;  1Y56 B;  3NNE A;  1NAA A;  1GAL A;  4U8P A;  3QJ4 A;  1GEU A;  4U8N A;  1JOA A;  3DJE A;  2WOV A;  4UP3 A;  3Q6J A;  1JEH A;  1EL8 A;  2C3D A;  1D4E A;  2Z5X A;  1PS9 A;  2YR4 A;  1QLB A;  4C77 A;  3QSE A;  5DBJ A;  1L9C A;  1MO9 A;  3IHM A;  3CND A;  2YVG A;  1JRZ A;  4H2P A;  4CCR A;  1LQT A;  4AP1 A;  3RHA A;  2C64 A;  2Q6U A;  3LB8 A;  2Q0L A;  1KFY A;  4APN A;  2EQ9 A;  3B6D A;  4X9N A;  1L9D A;  4JQ9 A;  1E1M A;  2Y6Q A;  2BCP A;  1D7L A;  3AE9 A;  2FJE A;  1F3P A;  4EQW A;  2IID A;  2YLS A;  2R9Z A;  3DK4 A;  5HXI A;  1CHU A;  1CC6 A;  2BK3 A;  4IVO B;  4Z26 A;  2XFO A;  3ALJ A;  1O95 A;  2V6O A;  2A89 A;  1VG0 A;  2YVF A;  3K30 A;  4PAB A;  1GPE A;  4NZH A;  1V59 A;  2B9Y A;  4NTE A;  2BS4 A;  3AEG A;  1CJ3 A;  1DOE A;  2WP5 A;  1D4C A;  5ER0 A;  3AYI A;  3NN6 X;  5KVI A;  1EL9 A;  2VVM A;  3AE1 A;  4ZCD A;  5BUK A;  3AWI A;  2XVH A;  3H8I A;  3AEC A;  2YVJ A;  4H2Q A;  2VZ2 A;  3NK2 X;  5KWF A;  3AE7 A;  1DOC A;  3ISH A;  2ZZB A;  1NEN A;  3G5R A;  4OPD A;  4YSH A;  5LV9 A;  2QCU A;  1CC2 A;  4Z43 A;  3BI2 A;  1BGJ A;  1FL2 A;  4ICY A;  5KXJ A;  1E6E A;  1F6M A;  2VVL G;  3RED A;  3CTY A;  4TLZ A;  4YSX A;  2TMD A;  3UKQ A;  1IUS A;  3DME A;  2YG4 A;  4BJY A;  4USR A;  2Z5Y A;  3NYC A;  1GET A;  3UKA A;  1EBD A;  1SEZ A;  4WCT A;  4ZCC A;  1GRE A;  2XCG A;  4A9W A;  1M6I A;  5TR3 A;  1K0I A;  4TM3 A;  4XWR A;  2ZZ0 A;  4OPL A;  3LJP A;  1TDO A;  4Y4L A;  2WDV A;  2QAE A;  2I0Z A;  1PJ5 A;  1FEC A;  3LZW A;  4IA6 A;  1Q1R A;  1YQ3 A;  4D04 A;  2XVF A;  4H4X A;  5U63 A;  4H50 A;  4U8O A;  4H2N A;  4YKG A;  2WHD A;  4KPR A;  4OVI A;  4CY6 A;  3UKF A;  3RP8 A;  4U8J A;  3GMB A;  1S3E A;  2OA1 A;  4B65 A;  3NHO X;  3PO7 A;  3P4Q A;  1BKW A;  3NT6 A;  1BZL A;  2CDU A;  3RP7 A;  2WU2 A;  4GR1 A;  1YY5 A;  1E7P A;  2JB3 A;  1PBB A;  2E4G A;  4IA5 A;  3UKL A;  1NG4 A;  3AEE A;  2X8G A;  2XLR A;  3SFD A;  2IVE A;  4J33 A;  2YQU A;  2BAC A;  2WS3 A;  3G5S A;  4C5O A;  1H6V A;  3ICS A;  3CIR A;  4A5L A;  3R9U A;  4H4U A;  1CJ2 A;  4YKF A;  4A79 A;  3RP6 A;  1ZMD A;  1DJN A;  3H8L A;  1N4V A;  1RP0 A;  4Z2T A;  3L8K A;  4C3X A;  2V5Z A;  2APG A;  3FG2 P;  2E5V A;  4U2T A;  2C66 A;  3CNT A;  2BC0 A;  4RG3 A;  2ZZC A;  1BGN A;  2NVK X;  1EL5 A;  5JCI A;  2YR6 A;  2A8X A;  2ZBW A;  2C70 A;  4BJZ A;  1XHC A;  1CJC A;  1JRY A;  3AXB A;  4OPC A;  2WPC A;  1GRG A;  2XLT A;  2XDO A;  2YLZ A;  2ARD A;  2GVC A;  1FEA A;  1K0J A;  3QSM A;  3PS9 A;  1PN0 A;  4A65 A;  3C4A A;  2C3C A;  2RAB A;  2C73 A;  5BVA A;  1KDG A;  2Y6R A;  3ZYX A;  4J2W A;  4CBQ A;  2GB0 A;  4NTC A;  4UDP A;  4CNK A;  4OPG A;  2RGJ A;  2Q7V A;  3C96 A;  3ADA B;  1X31 B;  2WQY A;  3GDP A;  1ZY8 A;  2B7R A;  2E1M A;  2OLN A;  3BI5 A;  4Y4N A;  4HB9 A;  4A99 A;  3UOZ A;  4AT0 A;  3ATQ A;  1OJ9 A;  1LVL A;  1ZX9 A;  5EB4 A;  4EQX A;  3BHK A;  1DOB A;  3I6D A;  4OPU A;  2YLX A;  1B37 A;  1NHQ A;  3COX A;  1GRB A;  4MJW A;  1NEK A;  2XFQ A;  3NLC A;  3P4P A;  4RSL A;  2RGH A;  3KKJ A;  4EMW A;  2XLP A;  1AOG A;  1GRA A;  5U1O A;  5JCN A;  4EQR A;  1JNZ A;  2YLT A;  3BI4 A;  2WPF A;  4K2X A;  3T37 A;  3IF9 A;  1K0L A;  3UTG A;  1KNR A;  1OJC A;  4K5S A;  1XDI A;  2B9W A;  2PHH A;  1PXC A;  2X3N A;  2XLS A;  3FIM B;  4N9X A;  4YTM A;  3UKH A;  3GD3 A;  3AYJ A;  3SQP A;  2PYX A;  3DK8 A;  2YLR A;  3DJD A;  4LA1 A;  1S2Q A;  2O9Z A;  4Z25 A;  1TYT A;  4KX6 A;  4USQ A;  2B7S A;  1H7W A;  2YG7 A;  4AP3 A;  1PXA A;  3GWD A;  3KU9 A;  1E1K A;  4U8L A;  4J56 A;  3SFE A;  1N1P A;  1VG9 A;  3GSI A;  2BXR A;  3C4N A;  3P9U A;  4OCG A;  4XWZ A;  2YM2 A;  2F5Z A;  2UZZ A;  5IPY A;  2GH5 A;  1IUT A;  1S2Y A;  2GAH B;  1PDH A;  2GR0 A;  3V76 A;  4U2S A;  3BNU A;  3GRT A;  3VR8 A;  3EF6 A;  1ZK7 A;  5KOX A;  3HZL A;  4BUR A;  3D1C A;  4EMJ A;  1DXL A;  4J34 A;  1LJ1 A;  4FDC B;  2WP6 A;  3QFB A;  5FS7 A;  5JCK A;  2GR1 A;  3AEF A;  1OJD A;  2EQ7 A;  2H88 A;  2BK4 A;  1QO8 A;  2GMH A;  4U8K A;  1Y56 A;  2BCG G;  3CPH G;  5JCL A;  1GT8 A;  2RGO A;  4Z44 A;  4H4T A;  1YKJ A;  1K4Q A;  3DK9 A;  3VRA A;  1B4V A;  1NPX A;  3LXD A;  2GRT A;  1Y0P A;  3S61 A;  3CGB A;  2BK5 A;  3DGZ A;  3AE4 A;  2AAQ A;  3ZDN A;  3UOV A;  1TDE A;  4CRT A;  3DA1 A;  3D8X A;  5BUL A;  2GF3 A;  1ELI A;  1CC4 A;  1REO A;  1OJT A;  2YLW A;  1GES A;  4TLX A;  4H4S A;  1F8R A;  3GMC A;  1KSS A;  2ACZ A;  2GQF A;  3NIX A;  1ZDL A;  1O5W A;  3FBS A;  4J36 A;  1TYP A;  3VRB A;  4C3Y A;  4YTN A;  4ZN0 A;  1ZP0 A;  3NTA A;  3WE0 A;  3CPJ G;  1NHP A;  3VQR A;  3IC9 A;  3K7Q X;  1ZMC A;  3H4K A;  5KOW A;  1ONF A;  3LZX A;  2XFU A;  4LII A;  4JNA A;  4FX9 A;  2WES A;  3K7M X;  2WOW A;  4X4J A;  1N4U A;  4OPI A;  5HYM A;  1VDC A;  4CNJ A;  1MOK A;  4H4P A;  3AEA A;  3AEB A;  3CGD A;  4GRT A;  4REK A;  4RG4 A;  1MXT A;  1ZOY A;  4WX1 A;  1GRT A;  3DH9 A;  3CNS A;  4PAA A;  3KPF A;  2V60 A;  2XLU A;  2WP9 A;  4P9S A;  3S5W A;  4JNQ A;  4I58 A;  2QA2 A;  3UKK A;  2GMJ A;  2GEW A;  1RYI A;  3AD9 B;  2XYO A;  3P4R A;  1FOH A;  1L9E A;  2FJB A;  5GSN A;  3V3N A;  1YQ4 A;  4DSH A;  4E0V A;  3LOV A;  3UTF A;  2WBA A;  1FCD A;  2QA1 A;  2R45 A;  4X9M A;  5C2T A;  2VOU A;  3NRN A;  4GUV A;  3UP4 A;  2V3A A;  4H4Z A;  4CCQ A;  3I3L A;  3ABV A;  3BHF A;  3NG7 X;  4Y4M A;  1IUW A;  3VR9 A;  3URH A;  5C3J A;  3NYF A;  3UOX A;  2W0H A;  3GYI A;  4BK2 A;  2R4E A;  2HQM A;  2WU5 A;  4B63 A;  1H83 A;  3CN8 A;  5IQ1 A;  4B67 A;  4CY8 A;  4NEV A;  2XVE A;  3K7T A;  2YR5 A;  2IVD A;  3DGH A;  1GTE A;  3VRD B;  5FMH A;  1NHR A;  2DKH A; 
#chains in the Genus database with same CATH topology
 2OPJ A;  4Z17 A;  3HW2 A;  2C65 A;  1S3B A;  1L0V A;  4IVM B;  1BF3 A;  4E4F A;  2R46 A;  3T9P A;  4UDQ A;  1JRO A;  2B9X A;  1LPF A;  1IUX A;  4NNJ A;  2BRY A;  3UP5 A;  1M64 A;  1P48 A;  2WET A;  4EIQ A;  2BAB A;  1COY A;  1D7Y A;  1GND A;  3FPZ A;  2PCE A;  3BJS A;  3OZ2 A;  3CGC A;  4FK1 A;  3QPE A;  3QVP A;  5KVH A;  4IT1 A;  4YWS A;  2R0P A;  1W6T A;  3NGC X;  1MUC A;  4ENL A;  3NH3 X;  1H82 A;  1KSU A;  3AD8 B;  4IZG A;  3NN0 X;  3H8A A;  4HNC A;  4F4R A;  2JB1 A;  5CQF A;  1ZKQ A;  4UDR A;  4BK1 A;  2VRM A;  2YG3 A;  3F8D A;  3AE2 A;  2YG5 A;  2MNR A;  1HYU A;  5G5G B;  2XH4 A;  1BWC A;  1Z6L A;  2GR2 A;  1E1N A;  2OQY A;  1LTX R;  4H7U A;  4GDE A;  1JNR A;  3IK4 A;  4DSG A;  4B68 A;  2XH7 A;  2BC1 A;  2R4J A;  3ZVH A;  1GER A;  3KPK A;  3RNM A;  2OAL A;  2PS2 A;  2B76 A;  2WDQ A;  3KA7 A;  4A6N B;  2P88 A;  4Z2U A;  1KF6 A;  4BK3 A;  4GAP A;  4NEW A;  2R0G A;  2BYB A;  1JCT A;  3CXO A;  4U8M A;  2XVI A;  1B8S A;  2X8H A;  1IUU A;  4IV9 A;  4B69 A;  4TVW A;  3M13 A;  2DKI A;  2WDR A;  4J57 A;  1CL0 A;  2JAE A;  2JBV A;  4IL0 A;  1F9C A;  1E9I A;  4H2R A;  1TDN A;  1B5Q A;  3RO6 A;  4G6H A;  3EAO A;  4KEM A;  1D5T A;  2WPE A;  4U8I A;  2VVL A;  3SXI A;  1PJ7 A;  2OAM A;  3UKP A;  5CKU A;  1NAA A;  3QJ4 A;  1GEU A;  4U8N A;  4A6G A;  3Q6J A;  1JEH A;  1PS9 A;  3T4W A;  2AKM A;  4H2H A;  1L9C A;  3IHM A;  1JRZ A;  3AE9 A;  2IID A;  3OPS A;  5KMP A;  1MDR A;  1CHU A;  3U9I A;  2XFO A;  1O95 A;  2A89 A;  2YVF A;  3K30 A;  4JN7 A;  4NZH A;  3TOY A;  3UJR A;  3CB3 A;  2VVM A;  3AE1 A;  5G5H B;  4ZCD A;  2YVJ A;  3NK2 X;  1DOC A;  3DIP A;  2QCU A;  2ONE A;  4Z43 A;  3BI2 A;  4HCD A;  1E6E A;  1KCZ A;  1IUS A;  2YG4 A;  4MMW A;  3R0K A;  4ZCC A;  2P8C A;  2P3Z A;  4OPL A;  3LJP A;  3CYJ A;  3LZW A;  1YQ3 A;  3R07 C;  4U8O A;  4YKG A;  4U8J A;  3DFH A;  4B65 A;  2NQL A;  3PO7 A;  1BKW A;  3S47 A;  4IP5 A;  1X2G A;  3SFD A;  2XLR A;  4GIR A;  3QN3 A;  4J33 A;  2YQU A;  4HCL A;  4C5O A;  1SJC A;  1SJB A;  4H4U A;  3RP6 A;  3H8L A;  1N4V A;  2OVL A;  3L8K A;  4C3X A;  3H12 A;  1WUE A;  2APG A;  2AL2 B;  4U2T A;  2C66 A;  3CNT A;  2NVK X;  2ZBW A;  3N4F A;  3TJI A;  1CJC A;  3AXB A;  2XLT A;  3MSY A;  1N5W C;  2ARD A;  1FFV C;  2GVC A;  1K0J A;  3QSM A;  4A65 A;  3C4A A;  4J2W A;  3H70 A;  4CNK A;  3DG7 A;  2Q7V A;  3L5O A;  1ZY8 A;  2B7R A;  3BI5 A;  4AT0 A;  1LVL A;  5EB4 A;  4OPU A;  3COX A;  3P4P A;  2OX4 A;  2RGH A;  2XLP A;  2W55 A;  3B9J B;  4DWD A;  1GRA A;  1JNZ A;  3T37 A;  3IF9 A;  3A7U A;  1OJC A;  4K5S A;  3UKH A;  2B9W A;  2XLS A;  1S2Q A;  1H7W A;  1MRA A;  1PXA A;  4J56 A;  4OCG A;  1FIQ B;  2CHR A;  5IPY A;  3VC5 A;  3EUB 3;  4U2S A;  3D1C A;  2H88 A;  2BK4 A;  4U8K A;  1Y56 A;  5JCL A;  1YKJ A;  2ZC8 A;  1Y0P A;  3S61 A;  3CGB A;  1FHU A;  3DGZ A;  3SY4 A;  2AAQ A;  1TDE A;  3NVW B;  1ELI A;  2W54 A;  1GES A;  4TLX A;  3GMC A;  3T2Y A;  1KSS A;  3NIX A;  1O5W A;  3FBS A;  3UJF A;  1N61 C;  3K7Q X;  4ZOH B;  3AEB A;  5J04 A;  4REK A;  4WX1 A;  3DH9 A;  4P9S A;  3SBF A;  3KPF A;  3HYW A;  2QA2 A;  3UKK A;  2GMJ A;  2GEW A;  1ELS A;  5GSN A;  1YQ4 A;  4E0V A;  4GYP C;  3UTF A;  1FCD A;  2QA1 A;  2VOU A;  4GUV A;  3UP4 A;  3BHF A;  3NG7 X;  1IUW A;  2PSN A;  3NYF A;  3UOX A;  5BOE A;  4CY8 A;  3FYY A;  1H83 A;  4B67 A;  2IVD A;  5FMH A;  1NHR A;  3GC2 A;  3NO1 A;  2QVH A;  3IHG A;  2XFN A;  4K7Z A;  3AE8 A;  5FJT A;  5FS8 A;  4GDP A;  4AOS A;  1PBC A;  2YAU A;  4YSZ A;  2J3N A;  1VQW A;  4HPN A;  3SZF A;  4G6G A;  3ENL A;  3TTE A;  4A6N A;  2OQH A;  5EOW A;  2C75 A;  3B3R A;  1OJA A;  4H4W A;  3AN1 A;  2V3B A;  3AE3 A;  2C4C A;  3SN4 A;  3DES A;  1O94 A;  4IHC A;  1E39 A;  3ICR A;  2JKC A;  3ZVI A;  4B66 A;  4YTP A;  2NPX A;  1SJD A;  4JDR A;  4O5Q A;  2DW6 A;  4JN9 A;  3P0W A;  5J7X A;  3PVC A;  3SQS A;  4H19 A;  1ECQ A;  2GGJ A;  4TVY A;  1TRB A;  4JY2 A;  3ZLG A;  3BOX A;  1NDA A;  4U2L A;  3E1T A;  1JRX A;  4TM4 A;  4G8T A;  3ITJ A;  3LAD A;  3EEZ A;  4GCM A;  3U4F A;  2JK6 A;  4OPT A;  4NTD A;  1GOS A;  1P43 A;  4Z1Y A;  3SM8 A;  4TM0 A;  3MWC A;  3GWF A;  1E1L A;  3DG3 A;  2QGY A;  3MQT A;  3V5F A;  5M0Z A;  3KLJ A;  3H7V A;  4EIP A;  3MKC A;  2CVJ A;  4GGB A;  1CBO A;  3M12 A;  1Q1W A;  5FS6 A;  1R6W A;  4GGH A;  3SX6 A;  3V3O A;  1FEB A;  1WUF A;  3AE6 A;  2PTX A;  1UKV G;  3P4S A;  3EAN A;  3KVE A;  1GV4 A;  2OZT A;  4YT0 A;  4MKS A;  1PJ6 A;  5JRB A;  2QDD A;  3NYE A;  2OFJ A;  3IJQ A;  1MNS A;  2WOV A;  1OEP A;  2C3D A;  2YR4 A;  1QLB A;  5DBJ A;  1FFU C;  4CCR A;  4G7F A;  1LQT A;  2Q6U A;  2Q0L A;  4APN A;  2EQ9 A;  3B6D A;  1L9D A;  3HYX A;  1E1M A;  3OZM A;  2FJE A;  1F3P A;  4IL2 A;  1CC6 A;  2BK3 A;  4A3R A;  3TWA A;  2V6O A;  1VG0 A;  4PAB A;  1GPE A;  1V59 A;  1CJ3 A;  2WP5 A;  3FV9 A;  5BUK A;  3AWI A;  2XVH A;  3AEC A;  4H2Q A;  3ISH A;  2PP3 A;  2XH2 A;  3G5R A;  4YSH A;  1CC2 A;  3D9X A;  4ICY A;  3RED A;  4TLZ A;  2TMD A;  2Z5Y A;  1GET A;  3UKA A;  1SEZ A;  4WCT A;  3SSZ A;  4TM3 A;  4XWR A;  2ZZ0 A;  2PTZ A;  4Y4L A;  2WDV A;  3V3W A;  2QAE A;  3CK5 A;  4IA6 A;  4D04 A;  3ETR B;  2XVF A;  3AM9 A;  4H4X A;  4H2N A;  1XS2 A;  2HXU A;  3RP8 A;  3GMB A;  2OA1 A;  3NHO X;  4GME A;  3NT6 A;  3RIT A;  3RP7 A;  5ENL A;  3AMZ A;  1E7P A;  2JB3 A;  1PBB A;  3SZW A;  2PA6 A;  3AEE A;  2IVE A;  4FI4 A;  3G5S A;  1BKH A;  1ZMD A;  1RP0 A;  4Z2T A;  3S5S A;  3R0U A;  2BC0 A;  2ZZC A;  1EL5 A;  3T14 A;  5JCI A;  2A8X A;  1JRY A;  3T2Z A;  4OPC A;  1GRG A;  1FEA A;  2MUC A;  2RAB A;  5BVA A;  2Y6R A;  3PWG A;  2GB0 A;  4J1O A;  3R1Z A;  3ADA B;  2E1M A;  4X2P A;  4HB9 A;  2FYM A;  3JZU A;  3R10 A;  3BSM A;  1DOB A;  3OTR A;  3Q45 A;  3Q4D A;  4MJW A;  2XFQ A;  3NLC A;  1KKO A;  3ZLH A;  4EMW A;  4EQR A;  3BI4 A;  2P8B A;  3UTG A;  1XDI A;  2PHH A;  3P3B A;  4N9X A;  3GD3 A;  2PYX A;  2PP1 A;  2YLR A;  2OG9 A;  3DJD A;  4Z25 A;  2RDX A;  1BQG A;  3A7R A;  3KU9 A;  4U8L A;  1E1K A;  1VG9 A;  2PP0 A;  2F5Z A;  1IUT A;  3NZG A;  4H1Z A;  1TKK A;  3VR8 A;  2HZG A;  3EF6 A;  1ZK7 A;  3HZL A;  4BUR A;  3QFB A;  2QJN A;  4MGG A;  1OJD A;  2EQ7 A;  3HPF A;  1QO8 A;  2GMH A;  2BCG G;  4IP4 A;  4Z44 A;  1K4Q A;  3LXD A;  2BK5 A;  3UOV A;  4DYE A;  3CT2 A;  5BUL A;  2GF3 A;  1JDF A;  1REO A;  1N60 C;  1OJT A;  4H4S A;  1F8R A;  1ZDL A;  3VRB A;  4YTN A;  3NFU A;  1ZP0 A;  3WE0 A;  1NHP A;  3GYX A;  5FJO A;  3T0K A;  4E5T A;  1ONF A;  4FX9 A;  5HYM A;  3CGD A;  2GGI A;  3RCY A;  3CNS A;  3S5W A;  1RYI A;  2XYO A;  3V3N A;  3LOV A;  5C2T A;  1FHV A;  2V3A A;  4H4Z A;  4CCQ A;  3ABV A;  5IDZ A;  4Y4M A;  2W0H A;  3GYI A;  2WU5 A;  4B63 A;  5IQ1 A;  2OZ8 A;  3DGH A;  4JN8 A;  2GDQ A;  4HCH A;  2EQ6 A;  1CF3 A;  5KNL A;  4D03 A;  2Q0K A;  4K1W A;  1N62 C;  3MZN A;  2O56 A;  1YQZ A;  1V97 A;  5FS9 A;  3KD9 A;  4DXK A;  4ECH A;  4GF7 A;  1NHS A;  3ALL A;  3GYJ A;  4K5R A;  5EBK A;  2V61 A;  2VQB A;  3P93 A;  3THU A;  4J31 A;  4B64 A;  3SZ0 A;  1GTH A;  3GRS A;  4G74 A;  3NTD A;  4GAV A;  1Q9I A;  2GGH A;  4NWZ A;  3QFA A;  3NK0 X;  1RSG A;  4AT2 A;  3G5Q A;  4ADW A;  3ATR A;  5JCM A;  2OZ3 A;  2E5A A;  5BRT A;  3PFR A;  3QSS A;  4E4U A;  5HHF A;  3FMW A;  4HA6 A;  3UJS A;  2X8C A;  2P0I A;  2CUL A;  2OO6 A;  2AR8 A;  2WOI A;  2W3R A;  1GXF A;  1PBD A;  4K8D A;  4EQS A;  2JB2 A;  2HXT A;  3UCL A;  4H4V A;  4KWS A;  3P1W A;  4EWJ A;  3ALM A;  2C76 A;  4A35 A;  1P2E A;  3T8Q A;  1TDF A;  4HYR A;  1F8S A;  3FXG A;  2C67 A;  3M0O A;  4AOX A;  1PHH A;  5U25 A;  3T6C A;  3Q9T A;  3GD6 A;  5KMR A;  4M6U A;  3JSK A;  4B1B A;  3UOY A;  1EBH A;  1GRH A;  3SZC A;  1KKR A;  4K22 A;  3F8P A;  4H4Q A;  2XFP A;  2X50 A;  1EBG A;  5GRT A;  1PXB A;  2GQW A;  3EPT A;  4Z24 A;  5M10 A;  3O0H A;  5L46 A;  2BXS A;  3IWA A;  4DGK A;  1NG3 A;  3UXL A;  3VA8 A;  3PG6 A;  4DX3 A;  2AQJ A;  3D46 A;  3UTE A;  1XPQ A;  5FJU A;  1H86 A;  1PBF A;  1JU2 A;  1GAL A;  4U8P A;  1T3Q C;  2AL2 A;  1JOA A;  3DJE A;  4UP3 A;  2POD A;  2XSX A;  3QSE A;  1MO9 A;  4H2P A;  4AP1 A;  3RHA A;  3LB8 A;  1KFY A;  2Y6Q A;  3PWI A;  1H2I A;  2BCP A;  1D7L A;  4EQW A;  2YLS A;  2R9Z A;  3DK4 A;  4IVO B;  4Z26 A;  1KN0 A;  3ALJ A;  2BS4 A;  1DOE A;  3NN6 X;  3H8I A;  2QDE A;  4DHG A;  4G73 A;  3IJL A;  2VZ2 A;  4K2S A;  5KMS A;  1NEN A;  4OPD A;  5LV9 A;  3QKE A;  1FL2 A;  3UCD A;  3CTY A;  4YSX A;  3UKQ A;  1DTN A;  4BJY A;  3NYC A;  3B97 A;  2XCG A;  4A9W A;  1M6I A;  3STP A;  1TDO A;  3VCC A;  3OW1 A;  2PPG A;  1FEC A;  2PU1 A;  3DER A;  4KPR A;  4OVI A;  4J3Z A;  1RVK A;  1BZL A;  3PK7 A;  3NVY B;  3NXL A;  2E4G A;  3UKL A;  2X8G A;  2BAC A;  2WS3 A;  1VDV A;  1H6V A;  3ICS A;  3R9U A;  1CJ2 A;  4YKF A;  1DJN A;  2V5Z A;  3FG2 P;  4RG3 A;  1PDZ A;  4BJZ A;  1XHC A;  2XDO A;  2PTY A;  4ZA0 A;  3PS9 A;  1PN0 A;  2C73 A;  3UJE A;  4CBQ A;  4UDP A;  4OPG A;  1X31 B;  2WQY A;  4Y4N A;  3GO2 A;  3UOZ A;  4EQX A;  1JPD X;  1B37 A;  1NHQ A;  1NEK A;  1JPM A;  1WYG A;  1AOG A;  2GGG A;  5JCN A;  2PTW A;  1EC9 A;  3DG6 A;  1K0L A;  1KNR A;  2X3N A;  3DEQ A;  4YTM A;  3CAW A;  1PXC A;  3TW9 A;  2DW7 A;  3AYJ A;  3SQP A;  4LA1 A;  2O9Z A;  1TYT A;  2B7S A;  3QTP A;  4AP3 A;  3GWD A;  3SFE A;  1IYX A;  2E3T A;  3GSI A;  3P9U A;  3NS1 B;  1PDH A;  2GR0 A;  3V76 A;  3NVV B;  3BNU A;  4EMJ A;  1DXL A;  3SYI A;  4FDC B;  2WP6 A;  5JCK A;  2GR1 A;  2RGO A;  3SR6 B;  5FJP A;  3AE4 A;  3VDG A;  4CRT A;  3FVD A;  1CC4 A;  1STZ A;  2ACZ A;  4J36 A;  1TYP A;  3UCC A;  1ONE A;  1VQZ A;  3NTA A;  3CPJ G;  3IC9 A;  3NRZ B;  1ZMC A;  4GFI A;  3LZX A;  2XFU A;  3K7M X;  4X4J A;  3HRD C;  1MOK A;  2AL1 A;  3VFC A;  4HNL A;  1EC8 A;  3UXK A;  1ZOY A;  3ES8 A;  4PAA A;  2V60 A;  3AD9 B;  1FOH A;  4DSH A;  3QLD A;  4X9M A;  3SJN A;  3TJ4 A;  3VR9 A;  3URH A;  2ZAD A;  2HQM A;  3CN8 A;  4NEV A;  4ZCW A;  3K7T A;  2YR5 A;  2HNE A;  3VRD B;  2BRA A;  1ZOV A;  1H84 A;  3CPI G;  1QJD A;  4I59 A;  3N6J A;  2FKP A;  2YWL A;  1TDK A;  2XGZ A;  3AB1 A;  4EMI A;  3F8R A;  5HY5 A;  2CFY A;  3KUM A;  3MUC A;  1VRQ B;  1CJ4 A;  3BNM A;  2BS2 A;  5IQ4 A;  1GSN A;  2GR3 A;  4O5U A;  2FJD A;  4BV6 A;  3GDN A;  4DNA A;  3CGE A;  1H7X A;  6ENL A;  2TPR A;  3DDM A;  4Z2R A;  1D4D A;  2A87 A;  1GRF A;  4YWO A;  4FK1 C;  2C7G A;  3AD7 B;  1YEY A;  3SN1 A;  4E8G A;  4YSY A;  3I6E A;  3UTH A;  2H89 A;  4E6M A;  3AED A;  3DJG X;  3RR1 A;  2YM1 A;  1H81 A;  2YG6 A;  2X99 A;  1DNC A;  2BS3 A;  3QVR A;  3NK1 X;  3AYL A;  3T2K A;  1SB3 B;  3L1R A;  2EQ8 A;  4A7A A;  2VQ7 A;  4C74 A;  2XVJ A;  2FBW A;  2QQ6 A;  4YXD A;  3ZLF A;  1W4X A;  3SGL A;  3NVZ B;  1LV0 A;  4EM3 A;  2GAG B;  2OLO A;  1N5X A;  1F8W A;  3GD4 A;  1L8P A;  1IJH A;  1KNP A;  2BA9 A;  2GV8 A;  1X2H A;  4KT2 A;  3CNJ A;  5EB5 A;  3CNP A;  3DJJ A;  4H4R A;  5J60 A;  2VRL A;  3AE5 A;  3SN0 A;  4M52 A;  3N4E A;  1IUV A;  1P2H A;  1PBE A;  1LQU A;  4H4Y A;  3II4 A;  1NEL A;  4JY3 A;  3ICT A;  1DOD A;  4EM4 A;  3V5C A;  2WEU A;  2FJA A;  3OC4 A;  4XXG A;  4TM1 A;  1XAN A;  5KMQ A;  3V4B A;  3NKS A;  4LU6 A;  2QJM A;  5KRQ A;  1N4W A;  1DJQ A;  1S7M A;  3TQP A;  3HYV A;  2C72 A;  2R0C A;  1Y56 B;  1EL7 A;  3NNE A;  3I4K A;  4GIS A;  3CMM A;  1EL8 A;  2W3S A;  1D4E A;  2Z5X A;  4C77 A;  3CND A;  2YVG A;  3FCP A;  4GYP A;  2C64 A;  1PDY A;  2OKT A;  4X9N A;  4JQ9 A;  3ZVH B;  3R25 A;  5HXI A;  5EU9 A;  1FO4 A;  2B9Y A;  4NTE A;  3AEG A;  3AYI A;  1D4C A;  5ER0 A;  5KVI A;  4HN8 A;  1EL9 A;  7ENL A;  4JHM A;  1RM6 B;  5KWF A;  3AE7 A;  1NU5 A;  3CXB A;  2ZZB A;  2PMQ A;  1BGJ A;  5KXJ A;  1N63 C;  1F6M A;  2VVL G;  3DME A;  4USR A;  4ROP A;  1EBD A;  2I5Q A;  1MDL A;  1GRE A;  3I6T A;  5TR3 A;  1K0I A;  3GY1 A;  3OZY A;  3EKG A;  2I0Z A;  1PJ5 A;  1Q1R A;  5U63 A;  4H50 A;  3JVA A;  2WHD A;  4CY6 A;  3UKF A;  4K8G A;  1S3E A;  3P4Q A;  2CDU A;  1R0M A;  2WU2 A;  4GR1 A;  1YY5 A;  3K1G A;  4IA5 A;  1NG4 A;  3IJI A;  3CIR A;  4A5L A;  4A79 A;  3VC6 A;  3FJ4 A;  2QJJ A;  5BOF A;  2E5V A;  3OP2 A;  4KPL A;  1TE6 A;  4DN1 A;  1BGN A;  4FP1 A;  2YR6 A;  2C70 A;  2WPC A;  2YLZ A;  3MY9 A;  2GGE A;  2C3C A;  1KDG A;  3ZYX A;  2PGW A;  3RGT A;  4NTC A;  4H83 A;  3UGV A;  2RGJ A;  3C96 A;  3R11 A;  3GDP A;  2OLN A;  4A99 A;  2XH0 A;  3ATQ A;  1OJ9 A;  1ZX9 A;  2GSH A;  3BHK A;  3I6D A;  2YLX A;  2AKZ A;  1GRB A;  4RSL A;  3KKJ A;  3JW7 A;  5U1O A;  2YLT A;  2WPF A;  4K2X A;  3FIM B;  3TWB A;  3N6H A;  3DK8 A;  4M0X A;  3DFY A;  4KX6 A;  4USQ A;  2PGE A;  3DGB A;  2YG7 A;  1N1P A;  2BXR A;  4XWZ A;  3C4N A;  2PU0 A;  2YM2 A;  2UZZ A;  2GH5 A;  1S2Y A;  2GAH B;  2POZ A;  3GRT A;  5KOX A;  4J34 A;  1JRP A;  1LJ1 A;  3RRA A;  5FS7 A;  4II3 A;  3AEF A;  3CPH G;  1GT8 A;  4H4T A;  4II2 A;  3VRA A;  3DK9 A;  3UJ2 A;  1B4V A;  1NPX A;  2GRT A;  3TCS A;  3ZDN A;  1TZZ A;  3DA1 A;  3D8X A;  2YLW A;  3VCN A;  2GQF A;  4C3Y A;  4ZN0 A;  1EC7 A;  3VQR A;  3ES7 A;  3H4K A;  5KOW A;  4LII A;  4JNA A;  2WES A;  2WOW A;  1N4U A;  4OPI A;  1VDC A;  4CNJ A;  4H4P A;  3AEA A;  4G9K A;  1KD0 A;  3D47 A;  4GRT A;  1XPY A;  4RG4 A;  1MXT A;  1GRT A;  2XLU A;  5FJR A;  2WP9 A;  4JNQ A;  4I58 A;  1SJA A;  2GL5 A;  3P4R A;  1L9E A;  2FJB A;  2WBA A;  2R45 A;  3T31 A;  3NRN A;  3I3L A;  5C3J A;  4BK2 A;  2OLA A;  2R4E A;  1ZXI C;  2XVE A;  1GTE A;  2DKH A;  3A7A A; 
#chains in the Genus database with same CATH homology
 1ZOV A;  1H84 A;  3CPI G;  1QJD A;  2EQ6 A;  3IHG A;  1CF3 A;  2C65 A;  5KNL A;  1S3B A;  2XFN A;  4I59 A;  1L0V A;  4IVM B;  4D03 A;  4K7Z A;  2YWL A;  3AE8 A;  1BF3 A;  1TDK A;  2R46 A;  4UDQ A;  5FS8 A;  2Q0K A;  3AB1 A;  4GDP A;  4AOS A;  4EMI A;  1PBC A;  3F8R A;  2YAU A;  4YSZ A;  2J3N A;  5HY5 A;  2CFY A;  2B9X A;  1YQZ A;  1VQW A;  3SZF A;  1LPF A;  5FS9 A;  3KD9 A;  1IUX A;  4ECH A;  4NNJ A;  2BRY A;  4G6G A;  4GF7 A;  1VRQ B;  1NHS A;  3ALL A;  3UP5 A;  1M64 A;  3GYJ A;  4A6N A;  1CJ4 A;  3BNM A;  2BS2 A;  4K5R A;  5IQ4 A;  2WET A;  5EOW A;  5EBK A;  1GSN A;  2V61 A;  2C75 A;  2GR3 A;  2VQB A;  3B3R A;  1OJA A;  4O5U A;  4EIQ A;  2BAB A;  1COY A;  2FJD A;  4H4W A;  4BV6 A;  4J31 A;  4B64 A;  2V3B A;  3AE3 A;  3GDN A;  4DNA A;  3CGE A;  1D7Y A;  1H7X A;  1GND A;  2C4C A;  1GTH A;  3FPZ A;  3SZ0 A;  3GRS A;  2TPR A;  4Z2R A;  1O94 A;  3OZ2 A;  3CGC A;  1D4D A;  4FK1 A;  4G74 A;  3NTD A;  1E39 A;  3QVP A;  5KVH A;  2A87 A;  3ICR A;  2JKC A;  1GRF A;  4B66 A;  4GAV A;  4YWO A;  1Q9I A;  2R0P A;  4FK1 C;  4NWZ A;  3QFA A;  3NGC X;  3NK0 X;  2C7G A;  4YTP A;  1RSG A;  3AD7 B;  4AT2 A;  2NPX A;  3NH3 X;  3G5Q A;  4ADW A;  3ATR A;  5JCM A;  4JDR A;  1H82 A;  4O5Q A;  4YSY A;  5BRT A;  1KSU A;  4JN9 A;  3UTH A;  3QSS A;  3AD8 B;  5J7X A;  2H89 A;  3AED A;  3NN0 X;  3DJG X;  3PVC A;  5HHF A;  3FMW A;  4HA6 A;  2JB1 A;  2YM1 A;  1H81 A;  5CQF A;  1ZKQ A;  2YG6 A;  4UDR A;  2X99 A;  2X8C A;  2CUL A;  1TRB A;  4BK1 A;  4JY2 A;  1DNC A;  2BS3 A;  3QVR A;  2VRM A;  2YG3 A;  3F8D A;  3NK1 X;  3AE2 A;  1NDA A;  2AR8 A;  2WOI A;  2YG5 A;  3AYL A;  4U2L A;  3T2K A;  3E1T A;  1JRX A;  1HYU A;  1GXF A;  4TM4 A;  3L1R A;  1PBD A;  4K8D A;  4EQS A;  2EQ8 A;  1BWC A;  4A7A A;  2JB2 A;  3ITJ A;  1Z6L A;  2GR2 A;  3LAD A;  1E1N A;  3UCL A;  4H4V A;  3P1W A;  2VQ7 A;  3ALM A;  4GCM A;  2C76 A;  2JK6 A;  1LTX R;  4NTD A;  4H7U A;  1P2E A;  4OPT A;  4C74 A;  4GDE A;  1GOS A;  1TDF A;  1JNR A;  2XVJ A;  2FBW A;  4DSG A;  4YXD A;  4B68 A;  1F8S A;  1W4X A;  3SGL A;  2C67 A;  2BC1 A;  3M0O A;  1LV0 A;  2R4J A;  4EM3 A;  4AOX A;  2GAG B;  3SM8 A;  2OLO A;  1GER A;  1PHH A;  3KPK A;  1IJH A;  1F8W A;  3GD4 A;  3RNM A;  5U25 A;  2OAL A;  1KNP A;  2BA9 A;  4TM0 A;  3Q9T A;  3GWF A;  2GV8 A;  5EB5 A;  3CNJ A;  5KMR A;  3JSK A;  4B1B A;  1E1L A;  3CNP A;  3UOY A;  3DJJ A;  5M0Z A;  1GRH A;  3KLJ A;  3SZC A;  2B76 A;  4H4R A;  2WDQ A;  3KA7 A;  4K22 A;  5J60 A;  3F8P A;  2VRL A;  3AE5 A;  4A6N B;  4EIP A;  4Z2U A;  4H4Q A;  2XFP A;  4M52 A;  2CVJ A;  2X50 A;  1KF6 A;  4BK3 A;  4GAP A;  1CBO A;  3M12 A;  4NEW A;  5GRT A;  1Q1W A;  5FS6 A;  1IUV A;  1PXB A;  2GQW A;  1P2H A;  2R0G A;  1PBE A;  1LQU A;  4H4Y A;  2BYB A;  3II4 A;  3EPT A;  4Z24 A;  5M10 A;  4JY3 A;  3O0H A;  3ICT A;  5L46 A;  4U8M A;  3SX6 A;  3V3O A;  2XVI A;  1B8S A;  2BXS A;  1FEB A;  2X8H A;  1IUU A;  3AE6 A;  3IWA A;  4IV9 A;  4B69 A;  1DOD A;  3M13 A;  4EM4 A;  1NG3 A;  1UKV G;  2DKI A;  2WDR A;  4J57 A;  3P4S A;  4DGK A;  3EAN A;  1CL0 A;  2WEU A;  2FJA A;  2JAE A;  2JBV A;  3OC4 A;  4XXG A;  3KVE A;  4H2R A;  1GV4 A;  3PG6 A;  1TDN A;  4TM1 A;  1XAN A;  5KMQ A;  3NKS A;  1B5Q A;  2AQJ A;  4G6H A;  4LU6 A;  4YT0 A;  3EAO A;  3UTE A;  5KRQ A;  1XPQ A;  1D5T A;  1DJQ A;  1H86 A;  1N4W A;  2WPE A;  5JRB A;  1PJ6 A;  1S7M A;  2VVL A;  4U8I A;  3HYV A;  3SXI A;  2C72 A;  2R0C A;  3NYE A;  1PJ7 A;  2OAM A;  3UKP A;  5CKU A;  1PBF A;  1JU2 A;  1EL7 A;  1Y56 B;  3NNE A;  1NAA A;  1GAL A;  4U8P A;  3QJ4 A;  1GEU A;  4U8N A;  1JOA A;  3DJE A;  3CMM A;  2WOV A;  4UP3 A;  3Q6J A;  1JEH A;  1EL8 A;  2C3D A;  1D4E A;  2Z5X A;  1PS9 A;  2YR4 A;  1QLB A;  4C77 A;  3QSE A;  5DBJ A;  1L9C A;  1MO9 A;  3IHM A;  3CND A;  2YVG A;  1JRZ A;  4H2P A;  4CCR A;  1LQT A;  4AP1 A;  3RHA A;  2C64 A;  2Q6U A;  3LB8 A;  2Q0L A;  1KFY A;  4APN A;  2EQ9 A;  3B6D A;  4X9N A;  1L9D A;  4JQ9 A;  3HYX A;  1E1M A;  2Y6Q A;  1H2I A;  2BCP A;  1D7L A;  3AE9 A;  2FJE A;  1F3P A;  4EQW A;  2IID A;  2YLS A;  5KMP A;  2R9Z A;  3DK4 A;  5HXI A;  1CHU A;  1CC6 A;  2BK3 A;  4IVO B;  4Z26 A;  2XFO A;  1KN0 A;  3ALJ A;  1O95 A;  2V6O A;  2A89 A;  1VG0 A;  2YVF A;  3K30 A;  4PAB A;  1GPE A;  4NZH A;  1V59 A;  2B9Y A;  4NTE A;  2BS4 A;  3AEG A;  1CJ3 A;  1DOE A;  2WP5 A;  1D4C A;  5ER0 A;  3AYI A;  3NN6 X;  5KVI A;  1EL9 A;  2VVM A;  3AE1 A;  4ZCD A;  5BUK A;  3AWI A;  2XVH A;  3H8I A;  3AEC A;  2YVJ A;  4G73 A;  4H2Q A;  2VZ2 A;  3NK2 X;  5KWF A;  3AE7 A;  1DOC A;  5KMS A;  3ISH A;  2ZZB A;  1NEN A;  3G5R A;  4OPD A;  4YSH A;  5LV9 A;  2QCU A;  1CC2 A;  4Z43 A;  3BI2 A;  3D9X A;  1BGJ A;  1FL2 A;  4ICY A;  5KXJ A;  1E6E A;  1F6M A;  2VVL G;  3RED A;  3CTY A;  4TLZ A;  4YSX A;  2TMD A;  3UKQ A;  1IUS A;  3DME A;  2YG4 A;  4BJY A;  4USR A;  2Z5Y A;  3NYC A;  1GET A;  3UKA A;  1EBD A;  1SEZ A;  4WCT A;  4ZCC A;  1GRE A;  2XCG A;  4A9W A;  1M6I A;  5TR3 A;  1K0I A;  4TM3 A;  4XWR A;  2ZZ0 A;  4OPL A;  3LJP A;  1TDO A;  4Y4L A;  2WDV A;  2QAE A;  2I0Z A;  1PJ5 A;  1FEC A;  3LZW A;  4IA6 A;  1Q1R A;  1YQ3 A;  4D04 A;  2XVF A;  4H4X A;  5U63 A;  4H50 A;  4U8O A;  4H2N A;  4YKG A;  2WHD A;  4KPR A;  4OVI A;  4CY6 A;  3UKF A;  3RP8 A;  4U8J A;  3GMB A;  1S3E A;  2OA1 A;  4B65 A;  3NHO X;  3PO7 A;  3P4Q A;  1BKW A;  3NT6 A;  1BZL A;  2CDU A;  3RP7 A;  2WU2 A;  4GR1 A;  1YY5 A;  1E7P A;  2JB3 A;  1PBB A;  2E4G A;  4IA5 A;  3SZW A;  3UKL A;  1NG4 A;  3AEE A;  2X8G A;  2XLR A;  3SFD A;  2IVE A;  4J33 A;  2YQU A;  2BAC A;  2WS3 A;  3G5S A;  4C5O A;  1H6V A;  3ICS A;  3CIR A;  4A5L A;  3R9U A;  4H4U A;  1CJ2 A;  4YKF A;  4A79 A;  3RP6 A;  1ZMD A;  1DJN A;  3H8L A;  1N4V A;  1RP0 A;  4Z2T A;  3L8K A;  4C3X A;  2V5Z A;  2APG A;  3FG2 P;  2E5V A;  4U2T A;  2C66 A;  3CNT A;  2BC0 A;  4RG3 A;  2ZZC A;  1BGN A;  2NVK X;  1EL5 A;  3T14 A;  5JCI A;  2YR6 A;  2A8X A;  2ZBW A;  2C70 A;  4BJZ A;  1XHC A;  1CJC A;  1JRY A;  3AXB A;  3T2Z A;  4OPC A;  2WPC A;  1GRG A;  2XLT A;  2XDO A;  2YLZ A;  2ARD A;  2GVC A;  1FEA A;  1K0J A;  3QSM A;  3PS9 A;  1PN0 A;  4A65 A;  3C4A A;  2C3C A;  2RAB A;  2C73 A;  5BVA A;  1KDG A;  2Y6R A;  3ZYX A;  4J2W A;  4CBQ A;  2GB0 A;  4NTC A;  4UDP A;  4CNK A;  4OPG A;  2RGJ A;  2Q7V A;  3C96 A;  3ADA B;  1X31 B;  2WQY A;  3L5O A;  3GDP A;  1ZY8 A;  2B7R A;  2E1M A;  2OLN A;  3BI5 A;  4Y4N A;  4HB9 A;  4A99 A;  3UOZ A;  4AT0 A;  3ATQ A;  1OJ9 A;  1LVL A;  1ZX9 A;  5EB4 A;  4EQX A;  3BHK A;  1DOB A;  3I6D A;  4OPU A;  2YLX A;  1B37 A;  1NHQ A;  3COX A;  1GRB A;  4MJW A;  1NEK A;  2XFQ A;  3NLC A;  3P4P A;  4RSL A;  2RGH A;  3KKJ A;  4EMW A;  2XLP A;  1AOG A;  1GRA A;  5U1O A;  5JCN A;  4EQR A;  1JNZ A;  2YLT A;  3BI4 A;  2WPF A;  4K2X A;  3T37 A;  3IF9 A;  1K0L A;  3UTG A;  1KNR A;  1OJC A;  4K5S A;  1XDI A;  2B9W A;  2PHH A;  1PXC A;  2X3N A;  2XLS A;  3FIM B;  4N9X A;  4YTM A;  3UKH A;  3GD3 A;  3AYJ A;  3SQP A;  2PYX A;  3DK8 A;  2YLR A;  3DJD A;  4LA1 A;  1S2Q A;  2O9Z A;  4Z25 A;  1TYT A;  4KX6 A;  4USQ A;  2B7S A;  1H7W A;  2YG7 A;  4AP3 A;  1PXA A;  3GWD A;  3KU9 A;  1E1K A;  4U8L A;  4J56 A;  3SFE A;  1N1P A;  1VG9 A;  3GSI A;  2BXR A;  3C4N A;  3P9U A;  4OCG A;  4XWZ A;  2YM2 A;  2F5Z A;  2UZZ A;  5IPY A;  2GH5 A;  1IUT A;  1S2Y A;  2GAH B;  1PDH A;  2GR0 A;  3V76 A;  4U2S A;  3BNU A;  3GRT A;  3VR8 A;  3EF6 A;  1ZK7 A;  5KOX A;  3HZL A;  4BUR A;  3D1C A;  4EMJ A;  1DXL A;  4J34 A;  1LJ1 A;  3SYI A;  4FDC B;  2WP6 A;  3QFB A;  5FS7 A;  5JCK A;  4II3 A;  2GR1 A;  3AEF A;  1OJD A;  2EQ7 A;  2H88 A;  2BK4 A;  1QO8 A;  2GMH A;  4U8K A;  1Y56 A;  2BCG G;  3CPH G;  5JCL A;  1GT8 A;  2RGO A;  4Z44 A;  4H4T A;  1YKJ A;  4II2 A;  1K4Q A;  3DK9 A;  3VRA A;  1B4V A;  1NPX A;  3LXD A;  2GRT A;  1Y0P A;  3S61 A;  3CGB A;  2BK5 A;  3DGZ A;  3AE4 A;  3SY4 A;  2AAQ A;  3ZDN A;  3UOV A;  1TDE A;  4CRT A;  3DA1 A;  3D8X A;  5BUL A;  2GF3 A;  1ELI A;  1CC4 A;  1REO A;  1OJT A;  2YLW A;  1GES A;  4TLX A;  4H4S A;  1F8R A;  3GMC A;  1KSS A;  3T2Y A;  2ACZ A;  2GQF A;  3NIX A;  1ZDL A;  1O5W A;  3FBS A;  4J36 A;  1TYP A;  3VRB A;  4C3Y A;  4YTN A;  4ZN0 A;  1ZP0 A;  3NTA A;  3WE0 A;  3CPJ G;  1NHP A;  3GYX A;  3T0K A;  3VQR A;  3IC9 A;  3K7Q X;  1ZMC A;  3H4K A;  5KOW A;  1ONF A;  3LZX A;  2XFU A;  4LII A;  4JNA A;  4FX9 A;  2WES A;  3K7M X;  2WOW A;  4X4J A;  1N4U A;  4OPI A;  5HYM A;  1VDC A;  4CNJ A;  1MOK A;  4H4P A;  3AEA A;  3AEB A;  4G9K A;  3CGD A;  4GRT A;  4REK A;  4RG4 A;  1MXT A;  1ZOY A;  4WX1 A;  1GRT A;  3DH9 A;  3CNS A;  4PAA A;  3KPF A;  2V60 A;  2XLU A;  2WP9 A;  3HYW A;  4P9S A;  4JNQ A;  3S5W A;  4I58 A;  2QA2 A;  3UKK A;  2GMJ A;  2GEW A;  1RYI A;  3AD9 B;  2XYO A;  3P4R A;  1FOH A;  1L9E A;  2FJB A;  5GSN A;  3V3N A;  1YQ4 A;  4DSH A;  4E0V A;  3LOV A;  3UTF A;  2WBA A;  1FCD A;  2QA1 A;  2R45 A;  4X9M A;  5C2T A;  3T31 A;  2VOU A;  3NRN A;  4GUV A;  3UP4 A;  2V3A A;  4H4Z A;  4CCQ A;  3I3L A;  3ABV A;  3BHF A;  3NG7 X;  4Y4M A;  1IUW A;  3VR9 A;  3URH A;  5C3J A;  3NYF A;  3UOX A;  2W0H A;  3GYI A;  4BK2 A;  2R4E A;  2HQM A;  2WU5 A;  4B63 A;  1H83 A;  3CN8 A;  5IQ1 A;  4B67 A;  4CY8 A;  4NEV A;  2XVE A;  3K7T A;  2YR5 A;  2IVD A;  3DGH A;  1GTE A;  3VRD B;  5FMH A;  1NHR A;  2DKH A;  2BRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...