3CGEA

Pyridine nucleotide complexes with bacillus anthracis coenzyme a-disulfide reductase: a structural analysis of dual nad(p)h specificity
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
444
structure length
444
Chain Sequence
MNYVIIGGDAAGMSAAMQIVRNDENANVVTLEKGEIYSYAQCGLPYVISGAIASTEKLIARNVKTFRDKYGIDAKVRHEVTKVDTEKKIVYAEHTKTKDVFEFSYDRLLIATGVRPVMPEWEGRDLQGVHLLKTIPDAERILKTLETNKVEDVTIIGGGAIGLEMAETFVELGKKVRMIERNDHIGTIYDGDMAEYIYKEADKHHIEILTNENVKAFKGNERVEAVETDKGTYKADLVLVSVGVKPNTDFLEGTNIRTNHKGAIEVNAYMQTNVQDVYAAGDCATHYHVIKEIHDHIPIGTTANKQGRLAGLNMLDKRRAFKGTLGTGIIKFMNLTLARTGLNEKEAKGLHIPYKTVKVDSTNMAGYYPNAKPLYLKLLYRSDTKQLLGGQVIGEEGVDKRIDVIAMALFNKMSIHDLEDVDLSYAPPYNSVWDPIQQAARRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Pyridine Nucleotide Complexes with Bacillus anthracis Coenzyme A-Disulfide Reductase: A Structural Analysis of Dual NAD(P)H Specificity.
pubmed doi rcsb
source organism Bacillus anthracis str.
molecule tags Oxidoreductase
molecule keywords Pyridine nucleotide-disulfide oxidoreductase, class I
total genus 151
structure length 444
sequence length 444
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3cgeA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3cgeA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3cgeA02
3CGDA 4H4ZA 2V3BA 1SEZA 3UKAA 3ABVA 1UKVG 2BS2A 4O5QA 3T37A 4CCQA 3DMEA 3FIMB 4USRA 3Q6JA 2YM2A 3KKJA 1GRTA 3NYFA 4YXDA 1GEUA 3KA7A 4X9MA 3ISHA 4H2QA 4A6NB 4U8JA 1EBDA 4I59A 3AEFA 3KD9A 5BRTA 1LVLA 2IIDA 2JK6A 1L9DA 3NN6X 4OPUA 3NRNA 1CC2A 2ZBWA 1K0IA 2WETA 4TM1A 3ALMA 5EBKA 4NTDA 5BVAA 5HHFA 3BHKA 2WDRA 3CNDA 2OALA 1CC6A 4B65A 2R46A 1N4UA 1IUSA 2JKCA 2WESA 1GRFA 3P4RA 3AEEA 1PBFA 5HXIA 2Z5XA 4TM0A 2CFYA 4USQA 2BCGG 3LXDA 3QVRA 4UDQA 4YSXA 3CGEA 4TM4A 4Z44A 3LOVA 1P2EA 3NK2X 4LU6A 4Z2UA 2V61A 2XLSA 3CNPA 3KPFA 1GTHA 4GCMA 4IA6A 1BGJA 3AE1A 4NTEA 4U2LA 3RP6A 4J33A 2BCPA 3DH9A 3UOVA 5JCIA 4J57A 1LQUA 1KSUA 2WU5A 2B9WA 2BACA 3GYIA 3ICSA 1XPQA 2YLSA 1H7WA 2GF3A 4Z43A 1O5WA 4OPCA 1BZLA 1NHPA 3GWFA 3DJDA 3DGHA 4GDPA 3COXA 4J56A 4YTPA 3AE6A 3SFEA 4EQSA 3ITJA 2WPEA 2BC1A 1TDOA 2CVJA 2YR6A 4H7UA 3ZDNA 1F8SA 4K22A 3P4QA 3P4SA 1S2QA 3CTYA 4PABA 3ATQA 2YLXA 1GV4A 1VQWA 1QJDA 4LA1A 3EF6A 2C7GA 1OJTA 2OLOA 2X3NA 3L1RA 2GR0A 1GOSA 2IVDA 1LPFA 2WU2A 1TRBA 4A5LA 1E1MA 4NEWA 3NK0X 3GMBA 2H89A 1XHCA 2XLPA 4GUVA 4BK2A 2QA1A 2XVEA 4EMIA 2Q0LA 2R4JA 2XFUA 3AYIA 4DSHA 2GH5A 3SM8A 3DK9A 4J34A 1FOHA 2JB3A 4DSGA 4PAAA 1IUWA 3BNMA 1JRXA 1GETA 3AD7B 2EQ8A 1JU2A 3UP4A 2Y6RA 2QA2A 2ZZCA 3CPIG 3LJPA 4BK3A 1BGNA 2QAEA 3ATRA 5IQ1A 2BC0A 2B7RA 2YG6A 4A65A 1GERA 3CGBA 1BKWA 1D4EA 1S2YA 4U8MA 3UCLA 5DBJA 3DJJA 2C3DA 4K5RA 4A79A 4BJYA 3PS9A 3IHMA 2X8HA 1VDCA 2RABA 2FBWA 3NYCA 4OPDA 4AP3A 2C66A 4EQRA 2C72A 1CJ4A 1PJ7A 1GRAA 1TYTA 1K4QA 2X8GA 3AECA 4C5OA 1ZDLA 1NAAA 2XFQA 1GNDA 4ZN0A 4Y4NA 4CY6A 3RP8A 1N4VA 3NKSA 1P2HA 2BXSA 3UOZA 2V6OA 2XCGA 1V59A 4JNAA 1XANA 2VVMA 2OLNA 2JBVA 3M13A 4GRTA 2TPRA 2ZZBA 2FJAA 2IVEA 2C76A 2CDUA 2XDOA 3UOXA 4B63A 4EIQA 1GRGA 3JSKA 5HYMA 2GR2A 3CPJG 3PO7A 1NHSA 1ZOYA 3F8RA 5U63A 4JQ9A 1KDGA 2Q7VA 1KF6A 1BWCA 5KOXA 3ADAB 3OC4A 3GRTA 5LV9A 2YR4A 2WBAA 3DGZA 1IUVA 5J60A 2R45A 3DJGX 1YY5A 5JCLA 4D03A 2CULA 3H4KA 1PXAA 4OPLA 3BHFA 4ICYA 1DXLA 1B8SA 1F8RA 2VVLA 1GESA 1HYUA 4CY8A 1FCDA 2I0ZA 1KNRA 3RHAA 3L8KA 1D4DA 4YKGA 4B1BA 2VRLA 2VQ7A 5EB4A 1X31B 1ZMDA 3K7MX 1H82A 4H4RA 4Z24A 3UOYA 3GD3A 3AD9B 2GR3A 1BF3A 2YVFA 1NENA 2C64A 4Z25A 3ZYXA 4GF7A 4XWZA 3E1TA 3V3OA 1S3BA 3FPZA 4AOXA 3D8XA 3G5SA 1LV0A 2C70A 3FBSA 1KFYA 4A6NA 4H4QA 1NG3A 3M12A 2X8CA 2XVJA 2YAUA 4I58A 2BK5A 1RSGA 2F5ZA 1TDNA 2TMDA 3HZLA 2W0HA 4IA5A 5JCMA 4U8OA 5KOWA 1Q1RA 1NDAA 3UKFA 3KLJA 2YLZA 1EL8A 3SGLA 1H84A 1B5QA 4D04A 3UKLA 1LQTA 5CKUA 1MO9A 1Y56B 4H2PA 4C3YA 1NHRA 1ZOVA 2EQ6A 2GQFA 2HQMA 4TLZA 4NZHA 4Y4LA 5GSNA 5IPYA 3CNTA 3VRBA 4UDRA 4H4PA 1ELIA 1PXCA 5FS6A 1PS9A 1TDFA 3GMCA 4J31A 5ER0A 2WP9A 4U2SA 4KX6A 4U8IA 4CNJA 3I6DA 1DOCA 4BURA 3IF9A 3H8IA 2R9ZA 2J3NA 1N4WA 1EL7A 3GSIA 3B3RA 4Z2TA 3Q9TA 1IUXA 3R9UA 2WHDA 4A7AA 1VG9A 2R4EA 2WQYA 3G5RA 5U1OA 1JOAA 2WP5A 2DKHA 1L9CA 4RG3A 3BI4A 4ECHA 3NNEA 3NIXA 3NGCX 2Q6UA 1KSSA 1XDIA 4EMJA 2ARDA 2PYXA 3CN8A 3IHGA 4UDPA 1L0VA 1JNRA 2XLRA 1JRZA 1PBDA 4RSLA 4H4SA 2NPXA 1K0LA 3I3LA 3IWAA 2V5ZA 3O0HA 3VQRA 3VRAA 4JNQA 1JEHA 1ZKQA 1W4XA 2GQWA 3IC9A 1EL9A 4H4TA 1E1NA 1PJ6A 2FJEA 1D4CA 2A89A 4C77A 4KPRA 1F6MA 2E1MA 3AE8A 1NG4A 4NEVA 1S3EA 1FEAA 2OA1A 4H4XA 2BK4A 3NH3X 3P9UA 1CBOA 1IJHA 1CJ3A 3GWDA 2V60A 3AEBA 1D7LA 2DKIA 1AOGA 3AE9A 2BA9A 1CJCA 1NPXA 4YKFA 2E4GA 3LB8A 3AEAA 5BULA 5C2TA 3QSSA 5C3JA 3NTDA 4OVIA 3QJ4A 1O94A 4WX1A 5FS7A 3AEDA 3II4A 2E5VA 3P4PA 4X4JA 2NVKX 4APNA 1Y0PA 1YKJA 2WOIA 4AT0A 1DJQA 1B4VA 3AYJA 3NN0X 4REKA 2GMHA 5M10A 4EM4A 1GT8A 1KNPA 4X9NA 1NHQA 1CC4A 2GB0A 2B7SA 2WDQA 2Y6QA 3GYJA 3UP5A 3RNMA 3EAOA 2WOWA 1E6EA 4K7ZA 4O5UA 3LADA 3GD4A 1H7XA 4H50A 3AE7A 1E1KA 1RP0A 4FDCB 1ZP0A 2YM1A 3S61A 4BK1A 2B9YA 4YWOA 4AT2A 3P1WA 2PHHA 2RGOA 3G5QA 4JDRA 2X50A 1O95A 3H8LA 1MOKA 3CGCA 3NLCA 2Z5YA 1TYPA 2B9XA 4B66A 4M52A 3AYLA 4FX9A 4YSHA 5KVIA 4N9XA 3UTGA 1IUUA 1LTXR 4HB9A 4CBQA 4E0VA 1E39A 1H86A 2YG7A 5FS8A 1PBEA 5FMHA 3UKHA 4C74A 1H83A 4TLXA 3ICRA 1DOEA 1Q1WA 2WS3A 4YTMA 3DK8A 3F8PA 3UTFA 1FEBA 2XVFA 1B37A 1CHUA 1IUTA 1JRYA 4J36A 4B67A 1E1LA 2H88A 4Z2RA 2VQBA 3BI2A 2GRTA 4EQXA 2GVCA 2YLTA 3DA1A 2JB1A 2YLRA 5FS9A 4JY3A 2VRMA 4DNAA 3NG7X 4OPIA 3FMWA 1GREA 2WEUA 3NK1X 2WPCA 4U8PA 3B6DA 4UP3A 3UTEA 3UTHA 1H81A 2GV8A 2AQJA 1PHHA 1GRHA 3V3NA 2XVIA 4U2TA 3QFBA 1YQ4A 1LJ1A 1Y56A 2C75A 4K8DA 2XVHA 2YLWA 4WCTA 1ZX9A 3V76A 4Y4MA 3VRDB 2AAQA 1GPEA 1K0JA 4OCGA 4DGKA 1ZY8A 1NEKA 4EIPA 2GAHB 5KRQA 2C73A 2YVGA 2QCUA 5IQ4A 3OZ2A 1PXBA 4U8LA 2A87A 5EB5A 4FK1A 3C4NA 1GXFA 2YG4A 1TDKA 1GALA 3AB1A 3KVEA 4B68A 2V3AA 5BUKA 5L46A 3CIRA 3NTAA 2APGA 4B64A 1QO8A 3AXBA 2WP6A 1F8WA 1M6IA 3AE5A 3AE4A 4IVOB 1F3PA 2EQ9A 1N1PA 2XYOA 4FK1C 3C4AA 3WE0A 4CRTA 2XLTA 2XFOA 4BJZA 4OPTA 4MJWA 2GAGB 3QVPA 2A8XA 4HA6A 1DJNA 3GDNA 3C96A 4ZCDA 4H4VA 2C67A 4OPGA 3UKKA 3CNSA 1PDHA 3PVCA 3S5WA 1H6VA 2BS3A 2GMJA 3D1CA 4J2WA 4IV9A 3ALJA 1GRBA 1OJDA 3CPHG 1FECA 5KXJA 4YT0A 5HY5A 5JCKA 3K7TA 3EANA 1DODA 4GDEA 3AE2A 4K5SA 2VVLG 2XFPA 1CF3A 5JCNA 2Q0KA 4BV6A 1TDEA 4H2NA 1COYA 2YR5A 4YSYA 1QLBA 1JNZA 4RG4A 3NHOX 2YVJA 3ALLA 1DNCA 5CQFA 2YG3A 2RGJA 3BI5A 1Z6LA 3QSMA 2C65A 3VR9A 1PN0A 3AE3A 1DOBA 2AR8A 3DJEA 1CL0A 2VOUA 1GTEA 1YQZA 1OJAA 1Q9IA 3BNUA 4JY2A 4P9SA 1L9EA 2JAEA 4TM3A 2EQ7A 5KWFA 1YQ3A 2C3CA 2WPFA 2R0CA 3SFDA 1VG0A 2XLUA 1ZMCA 4EQWA 2OAMA 5GRTA 3LZXA 2R0GA 1FL2A 1RYIA 3LZWA 4CCRA 1CJ2A 3SQPA 2BXRA 1OJCA 1D5TA 4A9WA 4CNKA 5EOWA 2ACZA 3AEGA 4NTCA 3RP7A 1MXTA 1EL5A 4U8KA 4A99A 3FG2P 1OJ9A 3KU9A 1PBBA 1REOA 1M64A 3K30A 4H2RA 1PJ5A 3UKPA 2R0PA 4LIIA 2B76A 2WDVA 4XXGA 3UKQA 4C3XA 2BABA 4K2XA 5U25A 1ZK7A 3URHA 4EM3A 2FJBA 3AD8B 2RGHA 3GDPA 1PBCA 1VRQB 3QSEA 5KVHA 4Z26A 3DK4A 2XFNA 4IVMB 2BS4A 4H4YA 2VZ2A 2UZZA 2GR1A 4H4UA 4XWRA 1ONFA 2YG5A 3VR8A 4YSZA 3M0OA 1E7PA 4H4WA 4YTNA 2FJDA 4JN9A 4EMWA 4AP1A 5J7XA 2O9ZA 3CNJA 3GRSA 3NT6A 2X99A 3QFAA 4ZCCA 4U8NA 2ZZ0A 4B69A 2YQUA 2JB2A 3K7QX 3EPTA 4GR1A 3F8DA 1GSNA 3AWIA 2YWLA 3ICTA 4ADWA 2BK3A 2BYBA 2GEWA 3REDA 4AOSA 5M0ZA 2WOVA 3NYEA 1D7YA 5TR3A
chains in the Genus database with same CATH superfamily
4MGGA 2BS2A 3K1GA 2PODA 3DMEA 4USRA 2YM2A 1GEUA 4FI4A 4X9MA 1PDZA 3R07C 4H2QA 3HW2A 3KD9A 1L9DA 3NN6X 3BHKA 2OALA 4B65A 3TOYA 3N4EA 1GRFA 5HXIA 4A35A 4G74A 2MNRA 3QVRA 3CGEA 3MKCA 4LU6A 3CNPA 4NTEA 4J33A 2BCPA 2B9WA 3ICSA 1P43A 2XH0A 3GWFA 4HYRA 3JZUA 3AE6A 3ITJA 2PP1A 1EBHA 4E4FA 3ZDNA 1F8SA 1S2QA 3CTYA 2PCEA 1GV4A 1OJTA 2OLOA 1P48A 4H2HA 1E1MA 3GMBA 2XLPA 2XVEA 2P0IA 3DG3A 3DESA 2PGEA 3SM8A 3GYXA 1JRXA 3AD7B 2EQ8A 2Y6RA 2DW6A 3LJPA 4BK3A 2QAEA 2BC0A 3UCLA 5DBJA 3DJJA 2C3DA 4K5RA 3R0KA 4A79A 4G73A 1MNSA 2X8HA 4OPDA 1TYTA 1K4QA 4E5TA 1P2HA 2BXSA 2XCGA 2VVMA 2JBVA 4GRTA 2IVEA 2FJAA 2C76A 1R0MA 2CDUA 2E5AA 3PO7A 1KDGA 3ADAB 3V5FA 2WBAA 1IUVA 2O56A 3DJGX 2CULA 3H4KA 1F8RA 4YKGA 4DHGA 3GD3A 1X2GA 3GD6A 4X2PA 3T8QA 4GF7A 3E1TA 2FKPA 3I6TA 4GFIA 3FPZA 2C70A 3FBSA 2QDDA 4H4QA 1NG3A 2YAUA 4U8OA 3KLJA 1EL8A 3SGLA 1B5QA 5CKUA 2E3TA 4NZHA 3CNTA 3S5SA 4UDRA 4U8IA 4U2SA 4CNJA 3B3RA 2ONEA 2PS2A 2WQYA 4RG3A 3BSMA 3SQSA 3NNEA 1KSSA 4EMJA 3GO2A 3VC5A 3T14A 1KKOA 1PBDA 1K0LA 2V5ZA 2RDXA 4JNQA 1JEHA 2GQWA 3IC9A 4H4TA 2FJEA 1D4CA 2A89A 3NH3X 2BK4A 3ZLHA 1IJHA 3D46A 3GWDA 5FJTA 1AOGA 3AE9A 3QLDA 5C2TA 3AEAA 3QSSA 1O94A 4AT0A 2MUCA 5M10A 1GT8A 1CC4A 3IK4A 2B7SA 1MRAA 3CXBA 4HPNA 4DX3A 3GD4A 3PWIA 3VA8A 4EWJA 1E1KA 3P1WA 3CGCA 3BJSA 1TYPA 2Z5YA 3TWBA 3PK7A 5KVIA 3UTGA 1IUUA 2YG7A 3UKHA 4TLXA 1KKRA 3NVYB 2XH4A 1B37A 1IUTA 4DXKA 3T2KA 1SJCA 2GVCA 2YLTA 3CMMA 3QN3A 3ZVIA 3NK1X 2WPCA 4UP3A 3QFBA 1YQ4A 2HXUA 1Y56A 4K8DA 2XGZA 2XVHA 3T0KA 4WCTA 1ZX9A 3VRDB 1K0JA 4H19A 2GAHB 4HCLA 2QCUA 1GXFA 3OPSA 2APGA 1F3PA 1BKHA 3C4AA 4CRTA 3H70A 2GAGB 1DJNA 3C96A 4H4VA 4OPGA 3IJIA 2BS3A 1GRBA 1RVKA 4YT0A 3TCSA 3DFYA 3B97A 4GDEA 3K7TA 3AE2A 2VVLG 3NZGA 1COYA 1X2HA 4YSYA 2YVJA 4KPLA 2YG3A 3VR9A 3FXGA 1RM6B 2VOUA 1GTEA 1YQZA 3BNUA 2OX4A 2C3CA 2XLUA 4EQWA 3LZXA 1RYIA 4CCRA 3R10A 2HZGA 1D5TA 3RP7A 1MXTA 4A99A 3PFRA 3KU9A 4C3XA 2BABA 5U25A 3URHA 4KWSA 3GDPA 3AMZA 4Z26A 3T9PA 3NVVB 3VR8A 1ONFA 2OZTA 1E7PA 4YTNA 3U9IA 4IHCA 5J7XA 2O9ZA 3CNJA 3NT6A 2X99A 2ZZ0A 4IP5A 2YQUA 3ICTA 3CYJA 2YWLA 2BK3A 2GEWA 5TR3A 3CGDA 4H4ZA 1SEZA 3UKAA 3ABVA 1N60C 3T37A 4CCQA 3FIMB 3NVWB 3KA7A 3KUMA 1EBDA 4I59A 5BRTA 1LVLA 2IIDA 2JK6A 4OPUA 3NRNA 1CC2A 1K0IA 3B9JB 5BVAA 4H83A 3P4RA 3T31A 5KNLA 4USQA 2QVHA 4TM4A 4YSXA 1EC9A 2GL5A 4IA6A 2AL2A 4U2LA 6ENLA 3UOVA 1LQUA 2YLSA 4Z43A 4OPCA 1T3QC 4GDPA 3CAWA 3H7VA 4YTPA 3SY4A 2BC1A 2CVJA 3UJ2A 4H7UA 3HYXA 2YLXA 3SZFA 3L1RA 2GR0A 2WU2A 2PPGA 1TRBA 4A5LA 3NK0X 2GH5A 3DK9A 4PAAA 1DTNA 3BNMA 4MKSA 3UP4A 2QA2A 3P93A 1BGNA 3ATRA 5IQ1A 4A65A 1BKWA 1D4EA 2OVLA 2QQ6A 2FBWA 3NRZB 2C66A 2C72A 1KCZA 1ZDLA 4Y4NA 2HXTA 1ONEA 3UOZA 2V6OA 4JNAA 2ZZBA 3UOXA 4B63A 1JDFA 4IZGA 3RITA 1ZOYA 5U63A 1BWCA 5LV9A 2YR4A 4GAVA 2R45A 4ICYA 1B8SA 3D9XA 5FJRA 1HYUA 2I0ZA 1KNRA 2GDQA 3RHAA 4B1BA 5EB4A 1X31B 1ZMDA 1FFUC 3MSYA 3AD9B 1MDLA 1BF3A 1NENA 3VDGA 3ZYXA 3SN1A 3HPFA 1KFYA 4A6NA 2BK5A 1RSGA 1TDNA 2TMDA 1Q1RA 3UKFA 2YLZA 4HCDA 1H84A 4D04A 4ENLA 1LQTA 1Y56B 4H2PA 3N4FA 2PGWA 2FYMA 1JPDX 2HQMA 5GSNA 4BJYA 4EIPA 1PS9A 3GMCA 3ES7A 3IF9A 3R9UA 1ECQA 4A7AA 2R4EA 2QJMA 1FHUA 2ARDA 1XDIA 3CN8A 2QJJA 2W3SA 1JNRA 2XLRA 1JRZA 4ZA0A 3O0HA 3VQRA 1E1NA 1F6MA 1NG4A 1S3EA 2OA1A 3AEBA 3OZYA 1CJCA 4YKFA 5BULA 1WUEA 3NTDA 4OVIA 5FS7A 2E5VA 1Y0PA 4G8TA 4APNA 1FO4A 1DJQA 1B4VA 4G7FA 3NN0X 4EM4A 2WOWA 4K7ZA 4O5UA 1H7XA 3S61A 2B9YA 2PHHA 3UJFA 3G5QA 4JDRA 3H8LA 3NLCA 4M52A 4FX9A 4N9XA 4C74A 1PBEA 2HNEA 3UCCA 3DIPA 2P8CA 3ICRA 1DOEA 1Q1WA 3DK8A 3F8PA 1JPMA 4Z1YA 3ZVHB 2H88A 4Z2RA 3BI2A 2GRTA 4JY3A 2YLRA 2VRMA 2PSNA 3FV9A 3NO1A 1PHHA 3V3NA 3DG6A 2XVIA 4U2TA 2C75A 2AAQA 1GPEA 5G5GB 5EB5A 4FK1A 2W3RA 3A7RA 2V3AA 5BUKA 5L46A 3CIRA 1N1PA 4FK1C 2XFOA 5J04A 3QVPA 4J3ZA 4HA6A 3GDNA 3SBFA 4IP4A 4ZCDA 3UKKA 3FCPA 3S5WA 3D1CA 3QKEA 4NNJA 1FECA 5HY5A 3EANA 1DODA 4K5SA 1W6TA 5JCNA 4BV6A 2PTXA 5IDZA 3A7AA 4GGBA 4RG4A 1DNCA 2GSHA 4GGHA 4A6GA 3BI5A 3QSMA 3AE3A 2OQYA 1DOBA 1CL0A 4DYEA 2P88A 3DG7A 4JY2A 1MUCA 1L9EA 2EQ7A 5KWFA 2WPFA 2R0CA 2OAMA 2QDEA 5GRTA 2R0GA 1FL2A 3QTPA 3SQPA 1CJ2A 2BXRA 4CNKA 3CK5A 2ACZA 4E8GA 3S47A 3FG2P 4H2RA 1PBBA 3K30A 1PJ5A 2WDVA 4K2XA 5FJOA 2GGGA 2FJBA 3N6JA 3QSEA 1PBCA 1VRQB 3NVZB 3PG6A 3DK4A 5KVHA 2VZ2A 1N5XA 3M0OA 2FJDA 2PTYA 3QFAA 4ZCCA 4U8NA 4B69A 1PDYA 4GR1A 1GSNA 2BYBA 5M0ZA 4E6MA 2V3BA 1UKVG 1WUFA 3Q6JA 1GRTA 1N63C 1BQGA 3ISHA 5KMRA 1WYGA 3AEFA 1VDVA 3N6HA 4GAPA 4K1WA 4IL0A 2ZBWA 4TM1A 5EBKA 4NTDA 3UJRA 3NXLA 3CNDA 1CC6A 2R46A 1N4UA 1IUSA 2JKCA 2WESA 3AEEA 1PBFA 3SJNA 2Z5XA 4TM0A 2CFYA 2BCGG 3LXDA 3Q4DA 4K8GA 3LOVA 3NK2X 4Z2UA 2V61A 2XLSA 3ES8A 1GTHA 3SR6B 1SJBA 3AE1A 3RP6A 5JCIA 3GYIA 2BACA 1XPQA 2GF3A 2XH7A 3IJQA 1NHPA 3DJDA 3DGHA 4GIRA 4J56A 3SFEA 4EQSA 2WPEA 5KMSA 4K22A 3P4QA 3ATQA 2C7GA 2X3NA 1GOSA 2IVDA 1LPFA 1V97A 3TQPA 4NEWA 2H89A 1XHCA 4BK2A 3P0WA 2Q0LA 2R4JA 2XFUA 4DSHA 5FJPA 2JB3A 3Q45A 1GETA 1JU2A 4GISA 4M0XA 4KEMA 2ZZCA 3CPIG 1KD0A 3MZNA 2B7RA 1GERA 3CGBA 4U8MA 1S2YA 2GGJA 3PS9A 1VDCA 2RABA 4AP3A 3CXOA 4EQRA 1PJ7A 1GRAA 3AECA 4C5OA 1NAAA 4ZN0A 1GNDA 4CY6A 2QJNA 3NKSA 1XANA 2OLNA 3M13A 2TPRA 2XDOA 1GRGA 3JSKA 2GR2A 3CPJG 3MY9A 4H1ZA 3F8RA 4JQ9A 2Q7VA 1KF6A 3FJ4A 3GRTA 5J60A 1H2IA 1YY5A 2OKTA 2VVLA 3R0UA 1EBGA 3ETRB 3L8KA 1D4DA 5FJUA 2VRLA 2VQ7A 5G5HB 3UCDA 3EKGA 1H82A 2P8BA 2YVFA 2C64A 4Z25A 4XWZA 3V3OA 3MQTA 3D8XA 1LV0A 2X8CA 4IA5A 1SB3B 1NDAA 4J1OA 4C3YA 1MO9A 3TJ4A 1NHRA 2BRYA 2EQ6A 2PU1A 4Y4LA 5IPYA 3VRBA 4DWDA 4H4PA 2ZC8A 4CBQA 5FS6A 1TDFA 4KX6A 3I6DA 1DOCA 4BURA 3H8IA 2J3NA 1EL7A 4DN1A 2I5QA 3G5RA 5U1OA 3DEQA 1JOAA 4ECHA 3NGCX 2Q6UA 3R25A 2PYXA 4UDPA 1L0VA 2NPXA 3I3LA 3VRAA 3EEZA 1W4XA 1EL9A 4C77A 3AE8A 4NEVA 1FEAA 3P9UA 3AN1A 2V60A 1D7LA 2DKIA 2AKMA 1NPXA 2E4GA 3LB8A 1SJAA 3AEDA 3II4A 4X4JA 3UXKA 3R1ZA 1YKJA 2WOIA 3AYJA 3SX6A 4X9NA 2GB0A 2WDQA 3UP5A 3RNMA 1L8PA 1E6EA 3LADA 3OTRA 3V5CA 1FIQB 2YM1A 4BK1A 4YWOA 2X50A 1O95A 2PTZA 3FVDA 3V4BA 1TE6A 4YSHA 4HB9A 1H86A 1FFVC 3HYWA 4TVWA 3UTFA 1FEBA 4GMEA 2PA6A 4EQXA 5BOEA 4YWSA 4DNAA 4OPIA 3FMWA 1EC8A 4U8PA 3B6DA 3UTEA 3UTHA 2OO6A 1H81A 2GV8A 4FP1A 3ZVHA 1GRHA 2W55A 1LJ1A 2XH2A 2YLWA 2OPJA 3V76A 4Y4MA 4OCGA 4DGKA 1NEKA 3NS1B 3OZ2A 4U8LA 2A87A 3VFCA 2YG4A 1TDKA 3AB1A 3KVEA 4E4UA 3NTAA 4B64A 3AXBA 2WP6A 1M6IA 2EQ9A 2XYOA 2XLTA 4BJZA 4MJWA 2AL2B 2POZA 1PDHA 3PVCA 3UJEA 2GMJA 1OJDA 1FHVA 3CPHG 3UGVA 3STPA 2XFPA 1CF3A 3ZLFA 1TDEA 4G6GA 4HCHA 2OZ3A 3L5OA 1Z6LA 2C65A 1PN0A 2PU0A 2CHRA 1OJAA 3VCNA 1YQ3A 3SFDA 1ZMCA 3LZWA 4A9WA 5EOWA 3AEGA 3SZCA 1E9IA 3ZLGA 2B76A 4K2SA 4EM3A 3EUB3 3DERA 3CT2A 3SN4A 4IVMB 4H4YA 1F9CA 4H4UA 4XWRA 2YG5A 3DFHA 4H4WA 3SZ0A 3OP2A 3H12A 4JN9A 4AP1A 2OQHA 3GRSA 3JW7A 1NU5A 4JN8A 2JB2A 1ZXIC 3K7QX 3EPTA 4ADWA 4AOSA 2WOVA 1D7YA 2C4CA 3HYVA 4KT2A 4M6UA 4JHMA 3SZWA 3DGBA 4O5QA 3KKJA 3NYFA 3U4FA 4YXDA 1R6WA 1TKKA 4A6NB 4U8JA 4II2A 1SJDA 3SXIA 2WETA 3ALMA 5HHFA 2WDRA 5BOFA 4UDQA 4Z44A 1P2EA 3KPKA 3KPFA 4GCMA 3I4KA 1BGJA 3A7UA 3DH9A 4J57A 1KSUA 2WU5A 4HN8A 1H7WA 1O5WA 1BZLA 3COXA 1TDOA 2YR6A 3T6CA 3P4SA 2GGHA 4PABA 4ZOHB 1QJDA 2AL1A 1VQWA 4LA1A 3EF6A 2P3ZA 3BOXA 1MDRA 2OLAA 1VQZA 2OFJA 4GUVA 2QA1A 4EMIA 1NELA 3AYIA 3VCCA 4J34A 1FOHA 4DSGA 3TWAA 1IUWA 5KMQA 2YG6A 1IYXA 2DW7A 3RRAA 3IHMA 1N62C 3NYCA 1CJ4A 1N61C 2X8GA 2XFQA 3RP8A 1N4VA 1V59A 2PP3A 3P3BA 1XS2A 1JCTA 4GYPC 1EC7A 4EIQA 2W54A 5HYMA 1NHSA 3GY1A 4HNLA 5KOXA 3OC4A 3DGZA 1XPYA 2XSXA 5JCLA 4D03A 4JN7A 1PXAA 4OPLA 3BHFA 1DXLA 4Z17A 1GESA 4CY8A 1FCDA 3PWGA 3OZMA 3RO6A 4Z24A 3K7MX 4H4RA 3UOYA 2GR3A 3SN0A 1S3BA 4AOXA 3G5SA 4IT1A 3H8AA 3M12A 2XVJA 4I58A 5EU9A 2F5ZA 3HZLA 2W0HA 5JCMA 1JRPA 3UKLA 1TZZA 1ZOVA 2NQLA 2GQFA 4TLZA 3THUA 1PXCA 1ELIA 4J31A 5ER0A 2WP9A 2R9ZA 1N4WA 3GSIA 4Z2TA 3Q9TA 1IUXA 2WHDA 1VG9A 3MUCA 2WP5A 2DKHA 1L9CA 3BI4A 3NIXA 3IHGA 2OZ8A 4MMWA 4RSLA 4H4SA 3IWAA 1ZKQA 3JVAA 1PJ6A 4KPRA 2E1MA 4H4XA 1CBOA 1CJ3A 4G9KA 2BA9A 5JRBA 3UXLA 3RCYA 5C3JA 4A3RA 3QJ4A 4ROPA 4WX1A 3P4PA 2BRAA 2NVKX 3D47A 4REKA 2GMHA 3I6EA 1KNPA 1NHQA 3GYJA 2Y6QA 3EAOA 4ZCWA 4H50A 3AE7A 1RP0A 4FDCB 1ZP0A 4AT2A 2RGOA 1MOKA 4TVYA 2B9XA 1YEYA 4B66A 1STZA 3AYLA 3TTEA 1LTXR 4E0VA 2GGEA 1E39A 5FS8A 3ENLA 5FMHA 1H83A 3NFUA 2WS3A 4YTMA 1N5WC 2XVFA 1CHUA 1JRYA 3DDMA 4J36A 4B67A 1E1LA 2VQBA 5KOWA 3DA1A 2JB1A 5FS9A 3NG7X 1JROA 1GREA 2WEUA 3GC2A 3SYIA 5ENLA 2AQJA 1KN0A 3TW9A 4F4RA 1ZY8A 4HNCA 2QGYA 5KRQA 7ENLA 2C73A 2YVGA 2AKZA 3AM9A 5IQ4A 1PXBA 3C4NA 1GALA 3T2ZA 4B68A 2ZADA 1QO8A 1ELSA 1F8WA 3AE4A 3AE5A 4IVOB 3WE0A 4NWZA 4OPTA 2A8XA 2C67A 3CNSA 1H6VA 4J2WA 4IV9A 3IJLA 3ALJA 3QPEA 2PMQA 5KXJA 3RGTA 3UJSA 5JCKA 3MWCA 3TJIA 2Q0KA 4IL2A 4H2NA 2PTWA 2YR5A 1QLBA 1JNZA 3R11A 3NHOX 3ALLA 5CQFA 2RGJA 3FYYA 2AR8A 3DJEA 2GGIA 1Q9IA 4P9SA 2JAEA 4TM3A 3HRDC 1S7MA 3OW1A 1VG0A 3T2YA 3SSZA 3VC6A 1OJCA 4NTCA 5KMPA 4U8KA 1EL5A 1OJ9A 1REOA 1M64A 3UKPA 2R0PA 4LIIA 4XXGA 3UKQA 1ZK7A 3AD8B 2RGHA 2XFNA 2BS4A 2UZZA 4II3A 2PP0A 2GR1A 3CB3A 4YSZA 3V3WA 4EMWA 3RR1A 4GYPA 3T4WA 3F8DA 3AWIA 3REDA 3NYEA 1OEPA 2OG9A 4G6HA
chains in the Genus database with same CATH topology
3CGDA 4H4ZA 2V3BA 1SEZA 3UKAA 3ABVA 3SZWA 1UKVG 2BS2A 4O5QA 3T37A 4CCQA 3DMEA 3FIMB 4USRA 3Q6JA 2YM2A 3KKJA 1GRTA 3NYFA 4YXDA 1GEUA 3KA7A 4X9MA 3ISHA 4H2QA 4A6NB 5KMRA 4U8JA 1EBDA 4I59A 4II2A 3AEFA 3KD9A 4GAPA 5BRTA 1LVLA 2IIDA 2JK6A 1L9DA 3NN6X 4OPUA 3NRNA 1CC2A 2ZBWA 1K0IA 2WETA 4TM1A 3ALMA 5EBKA 3SXIA 4NTDA 5BVAA 5HHFA 3BHKA 2WDRA 3CNDA 2OALA 1CC6A 4B65A 2R46A 1N4UA 1IUSA 2JKCA 2WESA 1GRFA 3P4RA 3AEEA 1PBFA 3T31A 4G74A 5HXIA 2Z5XA 5KNLA 4TM0A 2CFYA 4USQA 2BCGG 3LXDA 3QVRA 4UDQA 4YSXA 3CGEA 4TM4A 4Z44A 3LOVA 1P2EA 3NK2X 3KPKA 4LU6A 4Z2UA 2V61A 2XLSA 3CNPA 3KPFA 1GTHA 4GCMA 4IA6A 1BGJA 3AE1A 4NTEA 4U2LA 3RP6A 4J33A 2BCPA 3DH9A 3UOVA 5JCIA 4J57A 1LQUA 1KSUA 2WU5A 2B9WA 2BACA 3GYIA 3ICSA 1XPQA 2YLSA 1H7WA 2GF3A 4Z43A 1O5WA 4OPCA 1BZLA 1NHPA 3GWFA 3DJDA 3DGHA 4GDPA 3COXA 4J56A 4YTPA 3AE6A 3SFEA 4EQSA 3ITJA 3SY4A 2WPEA 2BC1A 1TDOA 2CVJA 2YR6A 5KMSA 4H7UA 3ZDNA 1F8SA 4K22A 3P4QA 3P4SA 1S2QA 3HYXA 3CTYA 4PABA 3ATQA 2YLXA 3SZFA 1GV4A 1VQWA 1QJDA 4LA1A 3EF6A 2C7GA 1OJTA 2OLOA 2X3NA 3L1RA 2GR0A 1GOSA 2IVDA 1LPFA 2WU2A 1TRBA 4A5LA 1E1MA 4NEWA 3NK0X 3GMBA 2H89A 1XHCA 2XLPA 4GUVA 4BK2A 2QA1A 2XVEA 4EMIA 2Q0LA 2R4JA 2XFUA 3AYIA 4DSHA 2GH5A 3SM8A 3DK9A 4J34A 3GYXA 1FOHA 2JB3A 4DSGA 4PAAA 1IUWA 3BNMA 1JRXA 1GETA 3AD7B 2EQ8A 1JU2A 5KMQA 3UP4A 2Y6RA 2QA2A 2ZZCA 3CPIG 3LJPA 4BK3A 1BGNA 2QAEA 3ATRA 5IQ1A 2BC0A 2B7RA 2YG6A 4A65A 1GERA 3CGBA 1BKWA 1D4EA 1S2YA 4U8MA 3UCLA 5DBJA 3DJJA 2C3DA 4K5RA 4A79A 4BJYA 3PS9A 3IHMA 4G73A 2X8HA 1VDCA 2RABA 2FBWA 3NYCA 4OPDA 4AP3A 4G6HA 2C66A 4EQRA 2C72A 1CJ4A 1PJ7A 1GRAA 1TYTA 1K4QA 2X8GA 3AECA 4C5OA 1ZDLA 1NAAA 2XFQA 1GNDA 4ZN0A 4Y4NA 4CY6A 3RP8A 1N4VA 3NKSA 1P2HA 2BXSA 3UOZA 2V6OA 2XCGA 1V59A 4JNAA 1XANA 2VVMA 2OLNA 2JBVA 3M13A 4GRTA 2TPRA 2ZZBA 2FJAA 2IVEA 2C76A 2CDUA 2XDOA 3UOXA 4B63A 4EIQA 1GRGA 3JSKA 5HYMA 2GR2A 3CPJG 3PO7A 1NHSA 1ZOYA 3F8RA 5U63A 4JQ9A 1KDGA 2Q7VA 1KF6A 1BWCA 5KOXA 3ADAB 3OC4A 3GRTA 5LV9A 2YR4A 2WBAA 3DGZA 1IUVA 4GAVA 5J60A 2R45A 1H2IA 3DJGX 1YY5A 5JCLA 4D03A 2CULA 3H4KA 1PXAA 4OPLA 3BHFA 4ICYA 1DXLA 1B8SA 1F8RA 3D9XA 1GESA 1HYUA 2VVLA 4CY8A 1FCDA 2I0ZA 1KNRA 3RHAA 3L8KA 1D4DA 4YKGA 4B1BA 2VRLA 2VQ7A 5EB4A 1X31B 1ZMDA 3K7MX 1H82A 4H4RA 4Z24A 3UOYA 3GD3A 3AD9B 2GR3A 1BF3A 2YVFA 1NENA 2C64A 4Z25A 3ZYXA 4GF7A 4XWZA 3E1TA 3V3OA 1S3BA 3FPZA 4AOXA 3D8XA 3G5SA 1LV0A 2C70A 3FBSA 1KFYA 4A6NA 4H4QA 1NG3A 3M12A 2X8CA 2XVJA 2YAUA 4I58A 2BK5A 1RSGA 2F5ZA 1TDNA 2TMDA 3HZLA 2W0HA 4IA5A 5JCMA 4U8OA 5KOWA 1Q1RA 1NDAA 3UKFA 3KLJA 2YLZA 1EL8A 3SGLA 1H84A 1B5QA 4D04A 3UKLA 1LQTA 5CKUA 1MO9A 1Y56B 4H2PA 4C3YA 1NHRA 1ZOVA 2BRYA 2EQ6A 2GQFA 2HQMA 4TLZA 4NZHA 4Y4LA 5GSNA 5IPYA 3CNTA 3VRBA 4UDRA 4H4PA 1ELIA 1PXCA 5FS6A 1PS9A 1TDFA 3GMCA 4J31A 5ER0A 2WP9A 4U2SA 4KX6A 4U8IA 4CNJA 3I6DA 1DOCA 4BURA 3IF9A 3H8IA 2R9ZA 2J3NA 1N4WA 1EL7A 3GSIA 3B3RA 4Z2TA 3Q9TA 1IUXA 3R9UA 2WHDA 4A7AA 1VG9A 2R4EA 2WQYA 3G5RA 5U1OA 1JOAA 2WP5A 2DKHA 1L9CA 4RG3A 3BI4A 4ECHA 3NNEA 3NIXA 3NGCX 2Q6UA 1KSSA 1XDIA 4EMJA 2ARDA 2PYXA 3CN8A 3IHGA 4UDPA 1L0VA 1JNRA 3T14A 2XLRA 1JRZA 1PBDA 4RSLA 4H4SA 2NPXA 1K0LA 3I3LA 3IWAA 2V5ZA 3O0HA 3VQRA 3VRAA 4JNQA 1JEHA 1ZKQA 1W4XA 2GQWA 3IC9A 1EL9A 4H4TA 1E1NA 1PJ6A 2FJEA 1D4CA 2A89A 4C77A 4KPRA 1F6MA 2E1MA 3AE8A 1NG4A 4NEVA 1S3EA 1FEAA 2OA1A 4H4XA 2BK4A 3NH3X 3P9UA 1CBOA 1IJHA 1CJ3A 4G9KA 3GWDA 2V60A 3AEBA 1D7LA 2DKIA 1AOGA 3AE9A 2BA9A 5JRBA 1CJCA 1NPXA 4YKFA 2E4GA 3LB8A 3AEAA 5BULA 5C2TA 3QSSA 5C3JA 3NTDA 4OVIA 3QJ4A 1O94A 4WX1A 5FS7A 3AEDA 3II4A 2E5VA 3P4PA 4X4JA 2BRAA 2NVKX 4APNA 1Y0PA 1YKJA 2WOIA 4AT0A 1DJQA 1B4VA 3AYJA 3NN0X 4REKA 2GMHA 5M10A 4EM4A 1GT8A 3SX6A 1KNPA 4X9NA 1NHQA 1CC4A 2GB0A 2B7SA 2WDQA 2Y6QA 3GYJA 3UP5A 3RNMA 3EAOA 2WOWA 1E6EA 4K7ZA 4O5UA 3LADA 3GD4A 1H7XA 4H50A 3AE7A 1E1KA 1RP0A 4FDCB 1ZP0A 2YM1A 3S61A 4BK1A 2B9YA 4YWOA 4AT2A 3P1WA 2PHHA 2RGOA 3G5QA 4JDRA 2X50A 1O95A 3H8LA 1MOKA 3CGCA 3NLCA 2Z5YA 1TYPA 2B9XA 4B66A 4M52A 3AYLA 4FX9A 4YSHA 5KVIA 4N9XA 3UTGA 1IUUA 1LTXR 4HB9A 4CBQA 4E0VA 1E39A 1H86A 2YG7A 5FS8A 1PBEA 5FMHA 3UKHA 4C74A 1H83A 4TLXA 3HYWA 3ICRA 1DOEA 1Q1WA 2WS3A 4YTMA 3DK8A 3F8PA 3UTFA 1FEBA 2XVFA 1B37A 1CHUA 1IUTA 1JRYA 4J36A 4B67A 1E1LA 2H88A 4Z2RA 2VQBA 3T2KA 3BI2A 2GRTA 4EQXA 2GVCA 2YLTA 3DA1A 2JB1A 2YLRA 5FS9A 3CMMA 2VRMA 4JY3A 4DNAA 3NG7X 4OPIA 3FMWA 1GREA 2WEUA 3NK1X 2WPCA 4U8PA 3SYIA 3B6DA 4UP3A 3UTEA 3UTHA 1H81A 2GV8A 2AQJA 1PHHA 1GRHA 3V3NA 2XVIA 4U2TA 3QFBA 1YQ4A 1LJ1A 1Y56A 2C75A 4K8DA 3T0KA 2XVHA 2YLWA 4WCTA 1ZX9A 3V76A 4Y4MA 3VRDB 2AAQA 1KN0A 1GPEA 1K0JA 4OCGA 4DGKA 1ZY8A 1NEKA 4EIPA 2GAHB 5KRQA 2C73A 2YVGA 2QCUA 5IQ4A 3OZ2A 1PXBA 4U8LA 2A87A 5EB5A 4FK1A 3C4NA 1GXFA 2YG4A 1TDKA 1GALA 3AB1A 3KVEA 3T2ZA 4B68A 2V3AA 5BUKA 5L46A 3CIRA 3NTAA 2APGA 4B64A 1QO8A 3AXBA 2WP6A 1F8WA 1M6IA 3AE5A 3AE4A 4IVOB 1F3PA 2EQ9A 1N1PA 2XYOA 4FK1C 3C4AA 4NWZA 3WE0A 4CRTA 2XLTA 2XFOA 4BJZA 4OPTA 4MJWA 2GAGB 3QVPA 2A8XA 4HA6A 1DJNA 3GDNA 3C96A 4ZCDA 4H4VA 2C67A 4OPGA 3UKKA 3CNSA 1PDHA 3PVCA 3S5WA 1H6VA 2BS3A 2GMJA 3D1CA 4J2WA 4IV9A 3ALJA 1GRBA 1OJDA 4NNJA 3CPHG 1FECA 5KXJA 4YT0A 5HY5A 5JCKA 3K7TA 3EANA 1DODA 4GDEA 3AE2A 4K5SA 2VVLG 2XFPA 1CF3A 5JCNA 2Q0KA 4BV6A 1TDEA 4H2NA 4G6GA 1COYA 2YR5A 4YSYA 1QLBA 1JNZA 4RG4A 3NHOX 2YVJA 3ALLA 1DNCA 5CQFA 2YG3A 2RGJA 3BI5A 3L5OA 1Z6LA 3QSMA 2C65A 3VR9A 1PN0A 3AE3A 1DOBA 2AR8A 3DJEA 1CL0A 2VOUA 1GTEA 1YQZA 1OJAA 1Q9IA 3BNUA 4JY2A 4P9SA 1L9EA 2JAEA 4TM3A 2EQ7A 5KWFA 1YQ3A 2C3CA 2WPFA 2R0CA 1S7MA 1VG0A 3SFDA 2XLUA 1ZMCA 4EQWA 2OAMA 5GRTA 3LZXA 2R0GA 1FL2A 1RYIA 3LZWA 3T2YA 4CCRA 1CJ2A 3SQPA 2BXRA 1OJCA 1D5TA 4A9WA 4CNKA 5EOWA 2ACZA 3AEGA 4NTCA 5KMPA 3RP7A 1MXTA 1EL5A 4U8KA 4A99A 3SZCA 3FG2P 1OJ9A 3KU9A 1PBBA 1REOA 1M64A 3K30A 4H2RA 1PJ5A 3UKPA 2R0PA 4LIIA 2B76A 2WDVA 4XXGA 3UKQA 4C3XA 2BABA 4K2XA 5U25A 1ZK7A 3URHA 4EM3A 2FJBA 3AD8B 2RGHA 3GDPA 1PBCA 1VRQB 3QSEA 5KVHA 3PG6A 3DK4A 4Z26A 2XFNA 4IVMB 2BS4A 4H4YA 2VZ2A 2UZZA 4II3A 2GR1A 4H4UA 4XWRA 1ONFA 2YG5A 3VR8A 4YSZA 3M0OA 1E7PA 4H4WA 3SZ0A 4YTNA 2FJDA 4JN9A 4EMWA 4AP1A 5J7XA 2O9ZA 3CNJA 3GRSA 3NT6A 2X99A 3QFAA 4ZCCA 4U8NA 2ZZ0A 4B69A 2YQUA 2JB2A 3K7QX 3EPTA 4GR1A 3F8DA 1GSNA 3AWIA 2YWLA 3ICTA 4ADWA 2BK3A 2BYBA 2GEWA 3REDA 4AOSA 5M0ZA 2WOVA 3NYEA 1D7YA 5TR3A 2C4CA 3HYVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CGD A;  4H4Z A;  2V3B A;  1SEZ A;  3UKA A;  3ABV A;  1UKV G;  2BS2 A;  4O5Q A;  3T37 A;  4CCQ A;  3DME A;  3FIM B;  4USR A;  3Q6J A;  2YM2 A;  3KKJ A;  1GRT A;  3NYF A;  4YXD A;  1GEU A;  3KA7 A;  4X9M A;  3ISH A;  4H2Q A;  4A6N B;  4U8J A;  1EBD A;  4I59 A;  3AEF A;  3KD9 A;  5BRT A;  1LVL A;  2IID A;  2JK6 A;  1L9D A;  3NN6 X;  4OPU A;  3NRN A;  1CC2 A;  2ZBW A;  1K0I A;  2WET A;  4TM1 A;  3ALM A;  5EBK A;  4NTD A;  5BVA A;  5HHF A;  3BHK A;  2WDR A;  3CND A;  2OAL A;  1CC6 A;  4B65 A;  2R46 A;  1N4U A;  1IUS A;  2JKC A;  2WES A;  1GRF A;  3P4R A;  3AEE A;  1PBF A;  5HXI A;  2Z5X A;  4TM0 A;  2CFY A;  4USQ A;  2BCG G;  3LXD A;  3QVR A;  4UDQ A;  4YSX A;  3CGE A;  4TM4 A;  4Z44 A;  3LOV A;  1P2E A;  3NK2 X;  4LU6 A;  4Z2U A;  2V61 A;  2XLS A;  3CNP A;  3KPF A;  1GTH A;  4GCM A;  4IA6 A;  1BGJ A;  3AE1 A;  4NTE A;  4U2L A;  3RP6 A;  4J33 A;  2BCP A;  3DH9 A;  3UOV A;  5JCI A;  4J57 A;  1LQU A;  1KSU A;  2WU5 A;  2B9W A;  2BAC A;  3GYI A;  3ICS A;  1XPQ A;  2YLS A;  1H7W A;  2GF3 A;  4Z43 A;  1O5W A;  4OPC A;  1BZL A;  1NHP A;  3GWF A;  3DJD A;  3DGH A;  4GDP A;  3COX A;  4J56 A;  4YTP A;  3AE6 A;  3SFE A;  4EQS A;  3ITJ A;  2WPE A;  2BC1 A;  1TDO A;  2CVJ A;  2YR6 A;  4H7U A;  3ZDN A;  1F8S A;  4K22 A;  3P4Q A;  3P4S A;  1S2Q A;  3CTY A;  4PAB A;  3ATQ A;  2YLX A;  1GV4 A;  1VQW A;  1QJD A;  4LA1 A;  3EF6 A;  2C7G A;  1OJT A;  2OLO A;  2X3N A;  3L1R A;  2GR0 A;  1GOS A;  2IVD A;  1LPF A;  2WU2 A;  1TRB A;  4A5L A;  1E1M A;  4NEW A;  3NK0 X;  3GMB A;  2H89 A;  1XHC A;  2XLP A;  4GUV A;  4BK2 A;  2QA1 A;  2XVE A;  4EMI A;  2Q0L A;  2R4J A;  2XFU A;  3AYI A;  4DSH A;  2GH5 A;  3SM8 A;  3DK9 A;  4J34 A;  1FOH A;  2JB3 A;  4DSG A;  4PAA A;  1IUW A;  3BNM A;  1JRX A;  1GET A;  3AD7 B;  2EQ8 A;  1JU2 A;  3UP4 A;  2Y6R A;  2QA2 A;  2ZZC A;  3CPI G;  3LJP A;  4BK3 A;  1BGN A;  2QAE A;  3ATR A;  5IQ1 A;  2BC0 A;  2B7R A;  2YG6 A;  4A65 A;  1GER A;  3CGB A;  1BKW A;  1D4E A;  1S2Y A;  4U8M A;  3UCL A;  5DBJ A;  3DJJ A;  2C3D A;  4K5R A;  4A79 A;  4BJY A;  3PS9 A;  3IHM A;  2X8H A;  1VDC A;  2RAB A;  2FBW A;  3NYC A;  4OPD A;  4AP3 A;  2C66 A;  4EQR A;  2C72 A;  1CJ4 A;  1PJ7 A;  1GRA A;  1TYT A;  1K4Q A;  2X8G A;  3AEC A;  4C5O A;  1ZDL A;  1NAA A;  2XFQ A;  1GND A;  4ZN0 A;  4Y4N A;  4CY6 A;  3RP8 A;  1N4V A;  3NKS A;  1P2H A;  2BXS A;  3UOZ A;  2V6O A;  2XCG A;  1V59 A;  4JNA A;  1XAN A;  2VVM A;  2OLN A;  2JBV A;  3M13 A;  4GRT A;  2TPR A;  2ZZB A;  2FJA A;  2IVE A;  2C76 A;  2CDU A;  2XDO A;  3UOX A;  4B63 A;  4EIQ A;  1GRG A;  3JSK A;  5HYM A;  2GR2 A;  3CPJ G;  3PO7 A;  1NHS A;  1ZOY A;  3F8R A;  5U63 A;  4JQ9 A;  1KDG A;  2Q7V A;  1KF6 A;  1BWC A;  5KOX A;  3ADA B;  3OC4 A;  3GRT A;  5LV9 A;  2YR4 A;  2WBA A;  3DGZ A;  1IUV A;  5J60 A;  2R45 A;  3DJG X;  1YY5 A;  5JCL A;  4D03 A;  2CUL A;  3H4K A;  1PXA A;  4OPL A;  3BHF A;  4ICY A;  1DXL A;  1B8S A;  1F8R A;  2VVL A;  1GES A;  1HYU A;  4CY8 A;  1FCD A;  2I0Z A;  1KNR A;  3RHA A;  3L8K A;  1D4D A;  4YKG A;  4B1B A;  2VRL A;  2VQ7 A;  5EB4 A;  1X31 B;  1ZMD A;  3K7M X;  1H82 A;  4H4R A;  4Z24 A;  3UOY A;  3GD3 A;  3AD9 B;  2GR3 A;  1BF3 A;  2YVF A;  1NEN A;  2C64 A;  4Z25 A;  3ZYX A;  4GF7 A;  4XWZ A;  3E1T A;  3V3O A;  1S3B A;  3FPZ A;  4AOX A;  3D8X A;  3G5S A;  1LV0 A;  2C70 A;  3FBS A;  1KFY A;  4A6N A;  4H4Q A;  1NG3 A;  3M12 A;  2X8C A;  2XVJ A;  2YAU A;  4I58 A;  2BK5 A;  1RSG A;  2F5Z A;  1TDN A;  2TMD A;  3HZL A;  2W0H A;  4IA5 A;  5JCM A;  4U8O A;  5KOW A;  1Q1R A;  1NDA A;  3UKF A;  3KLJ A;  2YLZ A;  1EL8 A;  3SGL A;  1H84 A;  1B5Q A;  4D04 A;  3UKL A;  1LQT A;  5CKU A;  1MO9 A;  1Y56 B;  4H2P A;  4C3Y A;  1NHR A;  1ZOV A;  2EQ6 A;  2GQF A;  2HQM A;  4TLZ A;  4NZH A;  4Y4L A;  5GSN A;  5IPY A;  3CNT A;  3VRB A;  4UDR A;  4H4P A;  1ELI A;  1PXC A;  5FS6 A;  1PS9 A;  1TDF A;  3GMC A;  4J31 A;  5ER0 A;  2WP9 A;  4U2S A;  4KX6 A;  4U8I A;  4CNJ A;  3I6D A;  1DOC A;  4BUR A;  3IF9 A;  3H8I A;  2R9Z A;  2J3N A;  1N4W A;  1EL7 A;  3GSI A;  3B3R A;  4Z2T A;  3Q9T A;  1IUX A;  3R9U A;  2WHD A;  4A7A A;  1VG9 A;  2R4E A;  2WQY A;  3G5R A;  5U1O A;  1JOA A;  2WP5 A;  2DKH A;  1L9C A;  4RG3 A;  3BI4 A;  4ECH A;  3NNE A;  3NIX A;  3NGC X;  2Q6U A;  1KSS A;  1XDI A;  4EMJ A;  2ARD A;  2PYX A;  3CN8 A;  3IHG A;  4UDP A;  1L0V A;  1JNR A;  2XLR A;  1JRZ A;  1PBD A;  4RSL A;  4H4S A;  2NPX A;  1K0L A;  3I3L A;  3IWA A;  2V5Z A;  3O0H A;  3VQR A;  3VRA A;  4JNQ A;  1JEH A;  1ZKQ A;  1W4X A;  2GQW A;  3IC9 A;  1EL9 A;  4H4T A;  1E1N A;  1PJ6 A;  2FJE A;  1D4C A;  2A89 A;  4C77 A;  4KPR A;  1F6M A;  2E1M A;  3AE8 A;  1NG4 A;  4NEV A;  1S3E A;  1FEA A;  2OA1 A;  4H4X A;  2BK4 A;  3NH3 X;  3P9U A;  1CBO A;  1IJH A;  1CJ3 A;  3GWD A;  2V60 A;  3AEB A;  1D7L A;  2DKI A;  1AOG A;  3AE9 A;  2BA9 A;  1CJC A;  1NPX A;  4YKF A;  2E4G A;  3LB8 A;  3AEA A;  5BUL A;  5C2T A;  3QSS A;  5C3J A;  3NTD A;  4OVI A;  3QJ4 A;  1O94 A;  4WX1 A;  5FS7 A;  3AED A;  3II4 A;  2E5V A;  3P4P A;  4X4J A;  2NVK X;  4APN A;  1Y0P A;  1YKJ A;  2WOI A;  4AT0 A;  1DJQ A;  1B4V A;  3AYJ A;  3NN0 X;  4REK A;  2GMH A;  5M10 A;  4EM4 A;  1GT8 A;  1KNP A;  4X9N A;  1NHQ A;  1CC4 A;  2GB0 A;  2B7S A;  2WDQ A;  2Y6Q A;  3GYJ A;  3UP5 A;  3RNM A;  3EAO A;  2WOW A;  1E6E A;  4K7Z A;  4O5U A;  3LAD A;  3GD4 A;  1H7X A;  4H50 A;  3AE7 A;  1E1K A;  1RP0 A;  4FDC B;  1ZP0 A;  2YM1 A;  3S61 A;  4BK1 A;  2B9Y A;  4YWO A;  4AT2 A;  3P1W A;  2PHH A;  2RGO A;  3G5Q A;  4JDR A;  2X50 A;  1O95 A;  3H8L A;  1MOK A;  3CGC A;  3NLC A;  2Z5Y A;  1TYP A;  2B9X A;  4B66 A;  4M52 A;  3AYL A;  4FX9 A;  4YSH A;  5KVI A;  4N9X A;  3UTG A;  1IUU A;  1LTX R;  4HB9 A;  4CBQ A;  4E0V A;  1E39 A;  1H86 A;  2YG7 A;  5FS8 A;  1PBE A;  5FMH A;  3UKH A;  4C74 A;  1H83 A;  4TLX A;  3ICR A;  1DOE A;  1Q1W A;  2WS3 A;  4YTM A;  3DK8 A;  3F8P A;  3UTF A;  1FEB A;  2XVF A;  1B37 A;  1CHU A;  1IUT A;  1JRY A;  4J36 A;  4B67 A;  1E1L A;  2H88 A;  4Z2R A;  2VQB A;  3BI2 A;  2GRT A;  4EQX A;  2GVC A;  2YLT A;  3DA1 A;  2JB1 A;  2YLR A;  5FS9 A;  4JY3 A;  2VRM A;  4DNA A;  3NG7 X;  4OPI A;  3FMW A;  1GRE A;  2WEU A;  3NK1 X;  2WPC A;  4U8P A;  3B6D A;  4UP3 A;  3UTE A;  3UTH A;  1H81 A;  2GV8 A;  2AQJ A;  1PHH A;  1GRH A;  3V3N A;  2XVI A;  4U2T A;  3QFB A;  1YQ4 A;  1LJ1 A;  1Y56 A;  2C75 A;  4K8D A;  2XVH A;  2YLW A;  4WCT A;  1ZX9 A;  3V76 A;  4Y4M A;  3VRD B;  2AAQ A;  1GPE A;  1K0J A;  4OCG A;  4DGK A;  1ZY8 A;  1NEK A;  4EIP A;  2GAH B;  5KRQ A;  2C73 A;  2YVG A;  2QCU A;  5IQ4 A;  3OZ2 A;  1PXB A;  4U8L A;  2A87 A;  5EB5 A;  4FK1 A;  3C4N A;  1GXF A;  2YG4 A;  1TDK A;  1GAL A;  3AB1 A;  3KVE A;  4B68 A;  2V3A A;  5BUK A;  5L46 A;  3CIR A;  3NTA A;  2APG A;  4B64 A;  1QO8 A;  3AXB A;  2WP6 A;  1F8W A;  1M6I A;  3AE5 A;  3AE4 A;  4IVO B;  1F3P A;  2EQ9 A;  1N1P A;  2XYO A;  4FK1 C;  3C4A A;  3WE0 A;  4CRT A;  2XLT A;  2XFO A;  4BJZ A;  4OPT A;  4MJW A;  2GAG B;  3QVP A;  2A8X A;  4HA6 A;  1DJN A;  3GDN A;  3C96 A;  4ZCD A;  4H4V A;  2C67 A;  4OPG A;  3UKK A;  3CNS A;  1PDH A;  3PVC A;  3S5W A;  1H6V A;  2BS3 A;  2GMJ A;  3D1C A;  4J2W A;  4IV9 A;  3ALJ A;  1GRB A;  1OJD A;  3CPH G;  1FEC A;  5KXJ A;  4YT0 A;  5HY5 A;  5JCK A;  3K7T A;  3EAN A;  1DOD A;  4GDE A;  3AE2 A;  4K5S A;  2VVL G;  2XFP A;  1CF3 A;  5JCN A;  2Q0K A;  4BV6 A;  1TDE A;  4H2N A;  1COY A;  2YR5 A;  4YSY A;  1QLB A;  1JNZ A;  4RG4 A;  3NHO X;  2YVJ A;  3ALL A;  1DNC A;  5CQF A;  2YG3 A;  2RGJ A;  3BI5 A;  1Z6L A;  3QSM A;  2C65 A;  3VR9 A;  1PN0 A;  3AE3 A;  1DOB A;  2AR8 A;  3DJE A;  1CL0 A;  2VOU A;  1GTE A;  1YQZ A;  1OJA A;  1Q9I A;  3BNU A;  4JY2 A;  4P9S A;  1L9E A;  2JAE A;  4TM3 A;  2EQ7 A;  5KWF A;  1YQ3 A;  2C3C A;  2WPF A;  2R0C A;  3SFD A;  1VG0 A;  2XLU A;  1ZMC A;  4EQW A;  2OAM A;  5GRT A;  3LZX A;  2R0G A;  1FL2 A;  1RYI A;  3LZW A;  4CCR A;  1CJ2 A;  3SQP A;  2BXR A;  1OJC A;  1D5T A;  4A9W A;  4CNK A;  5EOW A;  2ACZ A;  3AEG A;  4NTC A;  3RP7 A;  1MXT A;  1EL5 A;  4U8K A;  4A99 A;  3FG2 P;  1OJ9 A;  3KU9 A;  1PBB A;  1REO A;  1M64 A;  3K30 A;  4H2R A;  1PJ5 A;  3UKP A;  2R0P A;  4LII A;  2B76 A;  2WDV A;  4XXG A;  3UKQ A;  4C3X A;  2BAB A;  4K2X A;  5U25 A;  1ZK7 A;  3URH A;  4EM3 A;  2FJB A;  3AD8 B;  2RGH A;  3GDP A;  1PBC A;  1VRQ B;  3QSE A;  5KVH A;  4Z26 A;  3DK4 A;  2XFN A;  4IVM B;  2BS4 A;  4H4Y A;  2VZ2 A;  2UZZ A;  2GR1 A;  4H4U A;  4XWR A;  1ONF A;  2YG5 A;  3VR8 A;  4YSZ A;  3M0O A;  1E7P A;  4H4W A;  4YTN A;  2FJD A;  4JN9 A;  4EMW A;  4AP1 A;  5J7X A;  2O9Z A;  3CNJ A;  3GRS A;  3NT6 A;  2X99 A;  3QFA A;  4ZCC A;  4U8N A;  2ZZ0 A;  4B69 A;  2YQU A;  2JB2 A;  3K7Q X;  3EPT A;  4GR1 A;  3F8D A;  1GSN A;  3AWI A;  2YWL A;  3ICT A;  4ADW A;  2BK3 A;  2BYB A;  2GEW A;  3RED A;  4AOS A;  5M0Z A;  2WOV A;  3NYE A;  1D7Y A;  5TR3 A; 
#chains in the Genus database with same CATH topology
 4MGG A;  2BS2 A;  3K1G A;  2POD A;  3DME A;  4USR A;  2YM2 A;  1GEU A;  4FI4 A;  4X9M A;  1PDZ A;  3R07 C;  4H2Q A;  3HW2 A;  3KD9 A;  1L9D A;  3NN6 X;  3BHK A;  2OAL A;  4B65 A;  3TOY A;  3N4E A;  1GRF A;  5HXI A;  4A35 A;  4G74 A;  2MNR A;  3QVR A;  3CGE A;  3MKC A;  4LU6 A;  3CNP A;  4NTE A;  4J33 A;  2BCP A;  2B9W A;  3ICS A;  1P43 A;  2XH0 A;  3GWF A;  4HYR A;  3JZU A;  3AE6 A;  3ITJ A;  2PP1 A;  1EBH A;  4E4F A;  3ZDN A;  1F8S A;  1S2Q A;  3CTY A;  2PCE A;  1GV4 A;  1OJT A;  2OLO A;  1P48 A;  4H2H A;  1E1M A;  3GMB A;  2XLP A;  2XVE A;  2P0I A;  3DG3 A;  3DES A;  2PGE A;  3SM8 A;  3GYX A;  1JRX A;  3AD7 B;  2EQ8 A;  2Y6R A;  2DW6 A;  3LJP A;  4BK3 A;  2QAE A;  2BC0 A;  3UCL A;  5DBJ A;  3DJJ A;  2C3D A;  4K5R A;  3R0K A;  4A79 A;  4G73 A;  1MNS A;  2X8H A;  4OPD A;  1TYT A;  1K4Q A;  4E5T A;  1P2H A;  2BXS A;  2XCG A;  2VVM A;  2JBV A;  4GRT A;  2IVE A;  2FJA A;  2C76 A;  1R0M A;  2CDU A;  2E5A A;  3PO7 A;  1KDG A;  3ADA B;  3V5F A;  2WBA A;  1IUV A;  2O56 A;  3DJG X;  2CUL A;  3H4K A;  1F8R A;  4YKG A;  4DHG A;  3GD3 A;  1X2G A;  3GD6 A;  4X2P A;  3T8Q A;  4GF7 A;  3E1T A;  2FKP A;  3I6T A;  4GFI A;  3FPZ A;  2C70 A;  3FBS A;  2QDD A;  4H4Q A;  1NG3 A;  2YAU A;  4U8O A;  3KLJ A;  1EL8 A;  3SGL A;  1B5Q A;  5CKU A;  2E3T A;  4NZH A;  3CNT A;  3S5S A;  4UDR A;  4U8I A;  4U2S A;  4CNJ A;  3B3R A;  2ONE A;  2PS2 A;  2WQY A;  4RG3 A;  3BSM A;  3SQS A;  3NNE A;  1KSS A;  4EMJ A;  3GO2 A;  3VC5 A;  3T14 A;  1KKO A;  1PBD A;  1K0L A;  2V5Z A;  2RDX A;  4JNQ A;  1JEH A;  2GQW A;  3IC9 A;  4H4T A;  2FJE A;  1D4C A;  2A89 A;  3NH3 X;  2BK4 A;  3ZLH A;  1IJH A;  3D46 A;  3GWD A;  5FJT A;  1AOG A;  3AE9 A;  3QLD A;  5C2T A;  3AEA A;  3QSS A;  1O94 A;  4AT0 A;  2MUC A;  5M10 A;  1GT8 A;  1CC4 A;  3IK4 A;  2B7S A;  1MRA A;  3CXB A;  4HPN A;  4DX3 A;  3GD4 A;  3PWI A;  3VA8 A;  4EWJ A;  1E1K A;  3P1W A;  3CGC A;  3BJS A;  1TYP A;  2Z5Y A;  3TWB A;  3PK7 A;  5KVI A;  3UTG A;  1IUU A;  2YG7 A;  3UKH A;  4TLX A;  1KKR A;  3NVY B;  2XH4 A;  1B37 A;  1IUT A;  4DXK A;  3T2K A;  1SJC A;  2GVC A;  2YLT A;  3CMM A;  3QN3 A;  3ZVI A;  3NK1 X;  2WPC A;  4UP3 A;  3QFB A;  1YQ4 A;  2HXU A;  1Y56 A;  4K8D A;  2XGZ A;  2XVH A;  3T0K A;  4WCT A;  1ZX9 A;  3VRD B;  1K0J A;  4H19 A;  2GAH B;  4HCL A;  2QCU A;  1GXF A;  3OPS A;  2APG A;  1F3P A;  1BKH A;  3C4A A;  4CRT A;  3H70 A;  2GAG B;  1DJN A;  3C96 A;  4H4V A;  4OPG A;  3IJI A;  2BS3 A;  1GRB A;  1RVK A;  4YT0 A;  3TCS A;  3DFY A;  3B97 A;  4GDE A;  3K7T A;  3AE2 A;  2VVL G;  3NZG A;  1COY A;  1X2H A;  4YSY A;  2YVJ A;  4KPL A;  2YG3 A;  3VR9 A;  3FXG A;  1RM6 B;  2VOU A;  1GTE A;  1YQZ A;  3BNU A;  2OX4 A;  2C3C A;  2XLU A;  4EQW A;  3LZX A;  1RYI A;  4CCR A;  3R10 A;  2HZG A;  1D5T A;  3RP7 A;  1MXT A;  4A99 A;  3PFR A;  3KU9 A;  4C3X A;  2BAB A;  5U25 A;  3URH A;  4KWS A;  3GDP A;  3AMZ A;  4Z26 A;  3T9P A;  3NVV B;  3VR8 A;  1ONF A;  2OZT A;  1E7P A;  4YTN A;  3U9I A;  4IHC A;  5J7X A;  2O9Z A;  3CNJ A;  3NT6 A;  2X99 A;  2ZZ0 A;  4IP5 A;  2YQU A;  3ICT A;  3CYJ A;  2YWL A;  2BK3 A;  2GEW A;  5TR3 A;  3CGD A;  4H4Z A;  1SEZ A;  3UKA A;  3ABV A;  1N60 C;  3T37 A;  4CCQ A;  3FIM B;  3NVW B;  3KA7 A;  3KUM A;  1EBD A;  4I59 A;  5BRT A;  1LVL A;  2IID A;  2JK6 A;  4OPU A;  3NRN A;  1CC2 A;  1K0I A;  3B9J B;  5BVA A;  4H83 A;  3P4R A;  3T31 A;  5KNL A;  4USQ A;  2QVH A;  4TM4 A;  4YSX A;  1EC9 A;  2GL5 A;  4IA6 A;  2AL2 A;  4U2L A;  6ENL A;  3UOV A;  1LQU A;  2YLS A;  4Z43 A;  4OPC A;  1T3Q C;  4GDP A;  3CAW A;  3H7V A;  4YTP A;  3SY4 A;  2BC1 A;  2CVJ A;  3UJ2 A;  4H7U A;  3HYX A;  2YLX A;  3SZF A;  3L1R A;  2GR0 A;  2WU2 A;  2PPG A;  1TRB A;  4A5L A;  3NK0 X;  2GH5 A;  3DK9 A;  4PAA A;  1DTN A;  3BNM A;  4MKS A;  3UP4 A;  2QA2 A;  3P93 A;  1BGN A;  3ATR A;  5IQ1 A;  4A65 A;  1BKW A;  1D4E A;  2OVL A;  2QQ6 A;  2FBW A;  3NRZ B;  2C66 A;  2C72 A;  1KCZ A;  1ZDL A;  4Y4N A;  2HXT A;  1ONE A;  3UOZ A;  2V6O A;  4JNA A;  2ZZB A;  3UOX A;  4B63 A;  1JDF A;  4IZG A;  3RIT A;  1ZOY A;  5U63 A;  1BWC A;  5LV9 A;  2YR4 A;  4GAV A;  2R45 A;  4ICY A;  1B8S A;  3D9X A;  5FJR A;  1HYU A;  2I0Z A;  1KNR A;  2GDQ A;  3RHA A;  4B1B A;  5EB4 A;  1X31 B;  1ZMD A;  1FFU C;  3MSY A;  3AD9 B;  1MDL A;  1BF3 A;  1NEN A;  3VDG A;  3ZYX A;  3SN1 A;  3HPF A;  1KFY A;  4A6N A;  2BK5 A;  1RSG A;  1TDN A;  2TMD A;  1Q1R A;  3UKF A;  2YLZ A;  4HCD A;  1H84 A;  4D04 A;  4ENL A;  1LQT A;  1Y56 B;  4H2P A;  3N4F A;  2PGW A;  2FYM A;  1JPD X;  2HQM A;  5GSN A;  4BJY A;  4EIP A;  1PS9 A;  3GMC A;  3ES7 A;  3IF9 A;  3R9U A;  1ECQ A;  4A7A A;  2R4E A;  2QJM A;  1FHU A;  2ARD A;  1XDI A;  3CN8 A;  2QJJ A;  2W3S A;  1JNR A;  2XLR A;  1JRZ A;  4ZA0 A;  3O0H A;  3VQR A;  1E1N A;  1F6M A;  1NG4 A;  1S3E A;  2OA1 A;  3AEB A;  3OZY A;  1CJC A;  4YKF A;  5BUL A;  1WUE A;  3NTD A;  4OVI A;  5FS7 A;  2E5V A;  1Y0P A;  4G8T A;  4APN A;  1FO4 A;  1DJQ A;  1B4V A;  4G7F A;  3NN0 X;  4EM4 A;  2WOW A;  4K7Z A;  4O5U A;  1H7X A;  3S61 A;  2B9Y A;  2PHH A;  3UJF A;  3G5Q A;  4JDR A;  3H8L A;  3NLC A;  4M52 A;  4FX9 A;  4N9X A;  4C74 A;  1PBE A;  2HNE A;  3UCC A;  3DIP A;  2P8C A;  3ICR A;  1DOE A;  1Q1W A;  3DK8 A;  3F8P A;  1JPM A;  4Z1Y A;  3ZVH B;  2H88 A;  4Z2R A;  3BI2 A;  2GRT A;  4JY3 A;  2YLR A;  2VRM A;  2PSN A;  3FV9 A;  3NO1 A;  1PHH A;  3V3N A;  3DG6 A;  2XVI A;  4U2T A;  2C75 A;  2AAQ A;  1GPE A;  5G5G B;  5EB5 A;  4FK1 A;  2W3R A;  3A7R A;  2V3A A;  5BUK A;  5L46 A;  3CIR A;  1N1P A;  4FK1 C;  2XFO A;  5J04 A;  3QVP A;  4J3Z A;  4HA6 A;  3GDN A;  3SBF A;  4IP4 A;  4ZCD A;  3UKK A;  3FCP A;  3S5W A;  3D1C A;  3QKE A;  4NNJ A;  1FEC A;  5HY5 A;  3EAN A;  1DOD A;  4K5S A;  1W6T A;  5JCN A;  4BV6 A;  2PTX A;  5IDZ A;  3A7A A;  4GGB A;  4RG4 A;  1DNC A;  2GSH A;  4GGH A;  4A6G A;  3BI5 A;  3QSM A;  3AE3 A;  2OQY A;  1DOB A;  1CL0 A;  4DYE A;  2P88 A;  3DG7 A;  4JY2 A;  1MUC A;  1L9E A;  2EQ7 A;  5KWF A;  2WPF A;  2R0C A;  2OAM A;  2QDE A;  5GRT A;  2R0G A;  1FL2 A;  3QTP A;  3SQP A;  1CJ2 A;  2BXR A;  4CNK A;  3CK5 A;  2ACZ A;  4E8G A;  3S47 A;  3FG2 P;  4H2R A;  1PBB A;  3K30 A;  1PJ5 A;  2WDV A;  4K2X A;  5FJO A;  2GGG A;  2FJB A;  3N6J A;  3QSE A;  1PBC A;  1VRQ B;  3NVZ B;  3PG6 A;  3DK4 A;  5KVH A;  2VZ2 A;  1N5X A;  3M0O A;  2FJD A;  2PTY A;  3QFA A;  4ZCC A;  4U8N A;  4B69 A;  1PDY A;  4GR1 A;  1GSN A;  2BYB A;  5M0Z A;  4E6M A;  2V3B A;  1UKV G;  1WUF A;  3Q6J A;  1GRT A;  1N63 C;  1BQG A;  3ISH A;  5KMR A;  1WYG A;  3AEF A;  1VDV A;  3N6H A;  4GAP A;  4K1W A;  4IL0 A;  2ZBW A;  4TM1 A;  5EBK A;  4NTD A;  3UJR A;  3NXL A;  3CND A;  1CC6 A;  2R46 A;  1N4U A;  1IUS A;  2JKC A;  2WES A;  3AEE A;  1PBF A;  3SJN A;  2Z5X A;  4TM0 A;  2CFY A;  2BCG G;  3LXD A;  3Q4D A;  4K8G A;  3LOV A;  3NK2 X;  4Z2U A;  2V61 A;  2XLS A;  3ES8 A;  1GTH A;  3SR6 B;  1SJB A;  3AE1 A;  3RP6 A;  5JCI A;  3GYI A;  2BAC A;  1XPQ A;  2GF3 A;  2XH7 A;  3IJQ A;  1NHP A;  3DJD A;  3DGH A;  4GIR A;  4J56 A;  3SFE A;  4EQS A;  2WPE A;  5KMS A;  4K22 A;  3P4Q A;  3ATQ A;  2C7G A;  2X3N A;  1GOS A;  2IVD A;  1LPF A;  1V97 A;  3TQP A;  4NEW A;  2H89 A;  1XHC A;  4BK2 A;  3P0W A;  2Q0L A;  2R4J A;  2XFU A;  4DSH A;  5FJP A;  2JB3 A;  3Q45 A;  1GET A;  1JU2 A;  4GIS A;  4M0X A;  4KEM A;  2ZZC A;  3CPI G;  1KD0 A;  3MZN A;  2B7R A;  1GER A;  3CGB A;  4U8M A;  1S2Y A;  2GGJ A;  3PS9 A;  1VDC A;  2RAB A;  4AP3 A;  3CXO A;  4EQR A;  1PJ7 A;  1GRA A;  3AEC A;  4C5O A;  1NAA A;  4ZN0 A;  1GND A;  4CY6 A;  2QJN A;  3NKS A;  1XAN A;  2OLN A;  3M13 A;  2TPR A;  2XDO A;  1GRG A;  3JSK A;  2GR2 A;  3CPJ G;  3MY9 A;  4H1Z A;  3F8R A;  4JQ9 A;  2Q7V A;  1KF6 A;  3FJ4 A;  3GRT A;  5J60 A;  1H2I A;  1YY5 A;  2OKT A;  2VVL A;  3R0U A;  1EBG A;  3ETR B;  3L8K A;  1D4D A;  5FJU A;  2VRL A;  2VQ7 A;  5G5H B;  3UCD A;  3EKG A;  1H82 A;  2P8B A;  2YVF A;  2C64 A;  4Z25 A;  4XWZ A;  3V3O A;  3MQT A;  3D8X A;  1LV0 A;  2X8C A;  4IA5 A;  1SB3 B;  1NDA A;  4J1O A;  4C3Y A;  1MO9 A;  3TJ4 A;  1NHR A;  2BRY A;  2EQ6 A;  2PU1 A;  4Y4L A;  5IPY A;  3VRB A;  4DWD A;  4H4P A;  2ZC8 A;  4CBQ A;  5FS6 A;  1TDF A;  4KX6 A;  3I6D A;  1DOC A;  4BUR A;  3H8I A;  2J3N A;  1EL7 A;  4DN1 A;  2I5Q A;  3G5R A;  5U1O A;  3DEQ A;  1JOA A;  4ECH A;  3NGC X;  2Q6U A;  3R25 A;  2PYX A;  4UDP A;  1L0V A;  2NPX A;  3I3L A;  3VRA A;  3EEZ A;  1W4X A;  1EL9 A;  4C77 A;  3AE8 A;  4NEV A;  1FEA A;  3P9U A;  3AN1 A;  2V60 A;  1D7L A;  2DKI A;  2AKM A;  1NPX A;  2E4G A;  3LB8 A;  1SJA A;  3AED A;  3II4 A;  4X4J A;  3UXK A;  3R1Z A;  1YKJ A;  2WOI A;  3AYJ A;  3SX6 A;  4X9N A;  2GB0 A;  2WDQ A;  3UP5 A;  3RNM A;  1L8P A;  1E6E A;  3LAD A;  3OTR A;  3V5C A;  1FIQ B;  2YM1 A;  4BK1 A;  4YWO A;  2X50 A;  1O95 A;  2PTZ A;  3FVD A;  3V4B A;  1TE6 A;  4YSH A;  4HB9 A;  1H86 A;  1FFV C;  3HYW A;  4TVW A;  3UTF A;  1FEB A;  4GME A;  2PA6 A;  4EQX A;  5BOE A;  4YWS A;  4DNA A;  4OPI A;  3FMW A;  1EC8 A;  4U8P A;  3B6D A;  3UTE A;  3UTH A;  2OO6 A;  1H81 A;  2GV8 A;  4FP1 A;  3ZVH A;  1GRH A;  2W55 A;  1LJ1 A;  2XH2 A;  2YLW A;  2OPJ A;  3V76 A;  4Y4M A;  4OCG A;  4DGK A;  1NEK A;  3NS1 B;  3OZ2 A;  4U8L A;  2A87 A;  3VFC A;  2YG4 A;  1TDK A;  3AB1 A;  3KVE A;  4E4U A;  3NTA A;  4B64 A;  3AXB A;  2WP6 A;  1M6I A;  2EQ9 A;  2XYO A;  2XLT A;  4BJZ A;  4MJW A;  2AL2 B;  2POZ A;  1PDH A;  3PVC A;  3UJE A;  2GMJ A;  1OJD A;  1FHV A;  3CPH G;  3UGV A;  3STP A;  2XFP A;  1CF3 A;  3ZLF A;  1TDE A;  4G6G A;  4HCH A;  2OZ3 A;  3L5O A;  1Z6L A;  2C65 A;  1PN0 A;  2PU0 A;  2CHR A;  1OJA A;  3VCN A;  1YQ3 A;  3SFD A;  1ZMC A;  3LZW A;  4A9W A;  5EOW A;  3AEG A;  3SZC A;  1E9I A;  3ZLG A;  2B76 A;  4K2S A;  4EM3 A;  3EUB 3;  3DER A;  3CT2 A;  3SN4 A;  4IVM B;  4H4Y A;  1F9C A;  4H4U A;  4XWR A;  2YG5 A;  3DFH A;  4H4W A;  3SZ0 A;  3OP2 A;  3H12 A;  4JN9 A;  4AP1 A;  2OQH A;  3GRS A;  3JW7 A;  1NU5 A;  4JN8 A;  2JB2 A;  1ZXI C;  3K7Q X;  3EPT A;  4ADW A;  4AOS A;  2WOV A;  1D7Y A;  2C4C A;  3HYV A;  4KT2 A;  4M6U A;  4JHM A;  3SZW A;  3DGB A;  4O5Q A;  3KKJ A;  3NYF A;  3U4F A;  4YXD A;  1R6W A;  1TKK A;  4A6N B;  4U8J A;  4II2 A;  1SJD A;  3SXI A;  2WET A;  3ALM A;  5HHF A;  2WDR A;  5BOF A;  4UDQ A;  4Z44 A;  1P2E A;  3KPK A;  3KPF A;  4GCM A;  3I4K A;  1BGJ A;  3A7U A;  3DH9 A;  4J57 A;  1KSU A;  2WU5 A;  4HN8 A;  1H7W A;  1O5W A;  1BZL A;  3COX A;  1TDO A;  2YR6 A;  3T6C A;  3P4S A;  2GGH A;  4PAB A;  4ZOH B;  1QJD A;  2AL1 A;  1VQW A;  4LA1 A;  3EF6 A;  2P3Z A;  3BOX A;  1MDR A;  2OLA A;  1VQZ A;  2OFJ A;  4GUV A;  2QA1 A;  4EMI A;  1NEL A;  3AYI A;  3VCC A;  4J34 A;  1FOH A;  4DSG A;  3TWA A;  1IUW A;  5KMQ A;  2YG6 A;  1IYX A;  2DW7 A;  3RRA A;  3IHM A;  1N62 C;  3NYC A;  1CJ4 A;  1N61 C;  2X8G A;  2XFQ A;  3RP8 A;  1N4V A;  1V59 A;  2PP3 A;  3P3B A;  1XS2 A;  1JCT A;  4GYP C;  1EC7 A;  4EIQ A;  2W54 A;  5HYM A;  1NHS A;  3GY1 A;  4HNL A;  5KOX A;  3OC4 A;  3DGZ A;  1XPY A;  2XSX A;  5JCL A;  4D03 A;  4JN7 A;  1PXA A;  4OPL A;  3BHF A;  1DXL A;  4Z17 A;  1GES A;  4CY8 A;  1FCD A;  3PWG A;  3OZM A;  3RO6 A;  4Z24 A;  3K7M X;  4H4R A;  3UOY A;  2GR3 A;  3SN0 A;  1S3B A;  4AOX A;  3G5S A;  4IT1 A;  3H8A A;  3M12 A;  2XVJ A;  4I58 A;  5EU9 A;  2F5Z A;  3HZL A;  2W0H A;  5JCM A;  1JRP A;  3UKL A;  1TZZ A;  1ZOV A;  2NQL A;  2GQF A;  4TLZ A;  3THU A;  1PXC A;  1ELI A;  4J31 A;  5ER0 A;  2WP9 A;  2R9Z A;  1N4W A;  3GSI A;  4Z2T A;  3Q9T A;  1IUX A;  2WHD A;  1VG9 A;  3MUC A;  2WP5 A;  2DKH A;  1L9C A;  3BI4 A;  3NIX A;  3IHG A;  2OZ8 A;  4MMW A;  4RSL A;  4H4S A;  3IWA A;  1ZKQ A;  3JVA A;  1PJ6 A;  4KPR A;  2E1M A;  4H4X A;  1CBO A;  1CJ3 A;  4G9K A;  2BA9 A;  5JRB A;  3UXL A;  3RCY A;  5C3J A;  4A3R A;  3QJ4 A;  4ROP A;  4WX1 A;  3P4P A;  2BRA A;  2NVK X;  3D47 A;  4REK A;  2GMH A;  3I6E A;  1KNP A;  1NHQ A;  3GYJ A;  2Y6Q A;  3EAO A;  4ZCW A;  4H50 A;  3AE7 A;  1RP0 A;  4FDC B;  1ZP0 A;  4AT2 A;  2RGO A;  1MOK A;  4TVY A;  2B9X A;  1YEY A;  4B66 A;  1STZ A;  3AYL A;  3TTE A;  1LTX R;  4E0V A;  2GGE A;  1E39 A;  5FS8 A;  3ENL A;  5FMH A;  1H83 A;  3NFU A;  2WS3 A;  4YTM A;  1N5W C;  2XVF A;  1CHU A;  1JRY A;  3DDM A;  4J36 A;  4B67 A;  1E1L A;  2VQB A;  5KOW A;  3DA1 A;  2JB1 A;  5FS9 A;  3NG7 X;  1JRO A;  1GRE A;  2WEU A;  3GC2 A;  3SYI A;  5ENL A;  2AQJ A;  1KN0 A;  3TW9 A;  4F4R A;  1ZY8 A;  4HNC A;  2QGY A;  5KRQ A;  7ENL A;  2C73 A;  2YVG A;  2AKZ A;  3AM9 A;  5IQ4 A;  1PXB A;  3C4N A;  1GAL A;  3T2Z A;  4B68 A;  2ZAD A;  1QO8 A;  1ELS A;  1F8W A;  3AE4 A;  3AE5 A;  4IVO B;  3WE0 A;  4NWZ A;  4OPT A;  2A8X A;  2C67 A;  3CNS A;  1H6V A;  4J2W A;  4IV9 A;  3IJL A;  3ALJ A;  3QPE A;  2PMQ A;  5KXJ A;  3RGT A;  3UJS A;  5JCK A;  3MWC A;  3TJI A;  2Q0K A;  4IL2 A;  4H2N A;  2PTW A;  2YR5 A;  1QLB A;  1JNZ A;  3R11 A;  3NHO X;  3ALL A;  5CQF A;  2RGJ A;  3FYY A;  2AR8 A;  3DJE A;  2GGI A;  1Q9I A;  4P9S A;  2JAE A;  4TM3 A;  3HRD C;  1S7M A;  3OW1 A;  1VG0 A;  3T2Y A;  3SSZ A;  3VC6 A;  1OJC A;  4NTC A;  5KMP A;  4U8K A;  1EL5 A;  1OJ9 A;  1REO A;  1M64 A;  3UKP A;  2R0P A;  4LII A;  4XXG A;  3UKQ A;  1ZK7 A;  3AD8 B;  2RGH A;  2XFN A;  2BS4 A;  2UZZ A;  4II3 A;  2PP0 A;  2GR1 A;  3CB3 A;  4YSZ A;  3V3W A;  4EMW A;  3RR1 A;  4GYP A;  3T4W A;  3F8D A;  3AWI A;  3RED A;  3NYE A;  1OEP A;  2OG9 A;  4G6H A; 
#chains in the Genus database with same CATH homology
 3CGD A;  4H4Z A;  2V3B A;  1SEZ A;  3UKA A;  3ABV A;  3SZW A;  1UKV G;  2BS2 A;  4O5Q A;  3T37 A;  4CCQ A;  3DME A;  3FIM B;  4USR A;  3Q6J A;  2YM2 A;  3KKJ A;  1GRT A;  3NYF A;  4YXD A;  1GEU A;  3KA7 A;  4X9M A;  3ISH A;  4H2Q A;  4A6N B;  5KMR A;  4U8J A;  1EBD A;  4I59 A;  4II2 A;  3AEF A;  3KD9 A;  4GAP A;  5BRT A;  1LVL A;  2IID A;  2JK6 A;  1L9D A;  3NN6 X;  4OPU A;  3NRN A;  1CC2 A;  2ZBW A;  1K0I A;  2WET A;  4TM1 A;  3ALM A;  5EBK A;  3SXI A;  4NTD A;  5BVA A;  5HHF A;  3BHK A;  2WDR A;  3CND A;  2OAL A;  1CC6 A;  4B65 A;  2R46 A;  1N4U A;  1IUS A;  2JKC A;  2WES A;  1GRF A;  3P4R A;  3AEE A;  1PBF A;  3T31 A;  4G74 A;  5HXI A;  2Z5X A;  5KNL A;  4TM0 A;  2CFY A;  4USQ A;  2BCG G;  3LXD A;  3QVR A;  4UDQ A;  4YSX A;  3CGE A;  4TM4 A;  4Z44 A;  3LOV A;  1P2E A;  3NK2 X;  3KPK A;  4LU6 A;  4Z2U A;  2V61 A;  2XLS A;  3CNP A;  3KPF A;  1GTH A;  4GCM A;  4IA6 A;  1BGJ A;  3AE1 A;  4NTE A;  4U2L A;  3RP6 A;  4J33 A;  2BCP A;  3DH9 A;  3UOV A;  5JCI A;  4J57 A;  1LQU A;  1KSU A;  2WU5 A;  2B9W A;  2BAC A;  3GYI A;  3ICS A;  1XPQ A;  2YLS A;  1H7W A;  2GF3 A;  4Z43 A;  1O5W A;  4OPC A;  1BZL A;  1NHP A;  3GWF A;  3DJD A;  3DGH A;  4GDP A;  3COX A;  4J56 A;  4YTP A;  3AE6 A;  3SFE A;  4EQS A;  3ITJ A;  3SY4 A;  2WPE A;  2BC1 A;  1TDO A;  2CVJ A;  2YR6 A;  5KMS A;  4H7U A;  3ZDN A;  1F8S A;  4K22 A;  3P4Q A;  3P4S A;  1S2Q A;  3HYX A;  3CTY A;  4PAB A;  3ATQ A;  2YLX A;  3SZF A;  1GV4 A;  1VQW A;  1QJD A;  4LA1 A;  3EF6 A;  2C7G A;  1OJT A;  2OLO A;  2X3N A;  3L1R A;  2GR0 A;  1GOS A;  2IVD A;  1LPF A;  2WU2 A;  1TRB A;  4A5L A;  1E1M A;  4NEW A;  3NK0 X;  3GMB A;  2H89 A;  1XHC A;  2XLP A;  4GUV A;  4BK2 A;  2QA1 A;  2XVE A;  4EMI A;  2Q0L A;  2R4J A;  2XFU A;  3AYI A;  4DSH A;  2GH5 A;  3SM8 A;  3DK9 A;  4J34 A;  3GYX A;  1FOH A;  2JB3 A;  4DSG A;  4PAA A;  1IUW A;  3BNM A;  1JRX A;  1GET A;  3AD7 B;  2EQ8 A;  1JU2 A;  5KMQ A;  3UP4 A;  2Y6R A;  2QA2 A;  2ZZC A;  3CPI G;  3LJP A;  4BK3 A;  1BGN A;  2QAE A;  3ATR A;  5IQ1 A;  2BC0 A;  2B7R A;  2YG6 A;  4A65 A;  1GER A;  3CGB A;  1BKW A;  1D4E A;  1S2Y A;  4U8M A;  3UCL A;  5DBJ A;  3DJJ A;  2C3D A;  4K5R A;  4A79 A;  4BJY A;  3PS9 A;  3IHM A;  4G73 A;  2X8H A;  1VDC A;  2RAB A;  2FBW A;  3NYC A;  4OPD A;  4AP3 A;  4G6H A;  2C66 A;  4EQR A;  2C72 A;  1CJ4 A;  1PJ7 A;  1GRA A;  1TYT A;  1K4Q A;  2X8G A;  3AEC A;  4C5O A;  1ZDL A;  1NAA A;  2XFQ A;  1GND A;  4ZN0 A;  4Y4N A;  4CY6 A;  3RP8 A;  1N4V A;  3NKS A;  1P2H A;  2BXS A;  3UOZ A;  2V6O A;  2XCG A;  1V59 A;  4JNA A;  1XAN A;  2VVM A;  2OLN A;  2JBV A;  3M13 A;  4GRT A;  2TPR A;  2ZZB A;  2FJA A;  2IVE A;  2C76 A;  2CDU A;  2XDO A;  3UOX A;  4B63 A;  4EIQ A;  1GRG A;  3JSK A;  5HYM A;  2GR2 A;  3CPJ G;  3PO7 A;  1NHS A;  1ZOY A;  3F8R A;  5U63 A;  4JQ9 A;  1KDG A;  2Q7V A;  1KF6 A;  1BWC A;  5KOX A;  3ADA B;  3OC4 A;  3GRT A;  5LV9 A;  2YR4 A;  2WBA A;  3DGZ A;  1IUV A;  4GAV A;  5J60 A;  2R45 A;  1H2I A;  3DJG X;  1YY5 A;  5JCL A;  4D03 A;  2CUL A;  3H4K A;  1PXA A;  4OPL A;  3BHF A;  4ICY A;  1DXL A;  1B8S A;  1F8R A;  3D9X A;  1GES A;  1HYU A;  2VVL A;  4CY8 A;  1FCD A;  2I0Z A;  1KNR A;  3RHA A;  3L8K A;  1D4D A;  4YKG A;  4B1B A;  2VRL A;  2VQ7 A;  5EB4 A;  1X31 B;  1ZMD A;  3K7M X;  1H82 A;  4H4R A;  4Z24 A;  3UOY A;  3GD3 A;  3AD9 B;  2GR3 A;  1BF3 A;  2YVF A;  1NEN A;  2C64 A;  4Z25 A;  3ZYX A;  4GF7 A;  4XWZ A;  3E1T A;  3V3O A;  1S3B A;  3FPZ A;  4AOX A;  3D8X A;  3G5S A;  1LV0 A;  2C70 A;  3FBS A;  1KFY A;  4A6N A;  4H4Q A;  1NG3 A;  3M12 A;  2X8C A;  2XVJ A;  2YAU A;  4I58 A;  2BK5 A;  1RSG A;  2F5Z A;  1TDN A;  2TMD A;  3HZL A;  2W0H A;  4IA5 A;  5JCM A;  4U8O A;  5KOW A;  1Q1R A;  1NDA A;  3UKF A;  3KLJ A;  2YLZ A;  1EL8 A;  3SGL A;  1H84 A;  1B5Q A;  4D04 A;  3UKL A;  1LQT A;  5CKU A;  1MO9 A;  1Y56 B;  4H2P A;  4C3Y A;  1NHR A;  1ZOV A;  2BRY A;  2EQ6 A;  2GQF A;  2HQM A;  4TLZ A;  4NZH A;  4Y4L A;  5GSN A;  5IPY A;  3CNT A;  3VRB A;  4UDR A;  4H4P A;  1ELI A;  1PXC A;  5FS6 A;  1PS9 A;  1TDF A;  3GMC A;  4J31 A;  5ER0 A;  2WP9 A;  4U2S A;  4KX6 A;  4U8I A;  4CNJ A;  3I6D A;  1DOC A;  4BUR A;  3IF9 A;  3H8I A;  2R9Z A;  2J3N A;  1N4W A;  1EL7 A;  3GSI A;  3B3R A;  4Z2T A;  3Q9T A;  1IUX A;  3R9U A;  2WHD A;  4A7A A;  1VG9 A;  2R4E A;  2WQY A;  3G5R A;  5U1O A;  1JOA A;  2WP5 A;  2DKH A;  1L9C A;  4RG3 A;  3BI4 A;  4ECH A;  3NNE A;  3NIX A;  3NGC X;  2Q6U A;  1KSS A;  1XDI A;  4EMJ A;  2ARD A;  2PYX A;  3CN8 A;  3IHG A;  4UDP A;  1L0V A;  1JNR A;  3T14 A;  2XLR A;  1JRZ A;  1PBD A;  4RSL A;  4H4S A;  2NPX A;  1K0L A;  3I3L A;  3IWA A;  2V5Z A;  3O0H A;  3VQR A;  3VRA A;  4JNQ A;  1JEH A;  1ZKQ A;  1W4X A;  2GQW A;  3IC9 A;  1EL9 A;  4H4T A;  1E1N A;  1PJ6 A;  2FJE A;  1D4C A;  2A89 A;  4C77 A;  4KPR A;  1F6M A;  2E1M A;  3AE8 A;  1NG4 A;  4NEV A;  1S3E A;  1FEA A;  2OA1 A;  4H4X A;  2BK4 A;  3NH3 X;  3P9U A;  1CBO A;  1IJH A;  1CJ3 A;  4G9K A;  3GWD A;  2V60 A;  3AEB A;  1D7L A;  2DKI A;  1AOG A;  3AE9 A;  2BA9 A;  5JRB A;  1CJC A;  1NPX A;  4YKF A;  2E4G A;  3LB8 A;  3AEA A;  5BUL A;  5C2T A;  3QSS A;  5C3J A;  3NTD A;  4OVI A;  3QJ4 A;  1O94 A;  4WX1 A;  5FS7 A;  3AED A;  3II4 A;  2E5V A;  3P4P A;  4X4J A;  2BRA A;  2NVK X;  4APN A;  1Y0P A;  1YKJ A;  2WOI A;  4AT0 A;  1DJQ A;  1B4V A;  3AYJ A;  3NN0 X;  4REK A;  2GMH A;  5M10 A;  4EM4 A;  1GT8 A;  3SX6 A;  1KNP A;  4X9N A;  1NHQ A;  1CC4 A;  2GB0 A;  2B7S A;  2WDQ A;  2Y6Q A;  3GYJ A;  3UP5 A;  3RNM A;  3EAO A;  2WOW A;  1E6E A;  4K7Z A;  4O5U A;  3LAD A;  3GD4 A;  1H7X A;  4H50 A;  3AE7 A;  1E1K A;  1RP0 A;  4FDC B;  1ZP0 A;  2YM1 A;  3S61 A;  4BK1 A;  2B9Y A;  4YWO A;  4AT2 A;  3P1W A;  2PHH A;  2RGO A;  3G5Q A;  4JDR A;  2X50 A;  1O95 A;  3H8L A;  1MOK A;  3CGC A;  3NLC A;  2Z5Y A;  1TYP A;  2B9X A;  4B66 A;  4M52 A;  3AYL A;  4FX9 A;  4YSH A;  5KVI A;  4N9X A;  3UTG A;  1IUU A;  1LTX R;  4HB9 A;  4CBQ A;  4E0V A;  1E39 A;  1H86 A;  2YG7 A;  5FS8 A;  1PBE A;  5FMH A;  3UKH A;  4C74 A;  1H83 A;  4TLX A;  3HYW A;  3ICR A;  1DOE A;  1Q1W A;  2WS3 A;  4YTM A;  3DK8 A;  3F8P A;  3UTF A;  1FEB A;  2XVF A;  1B37 A;  1CHU A;  1IUT A;  1JRY A;  4J36 A;  4B67 A;  1E1L A;  2H88 A;  4Z2R A;  2VQB A;  3T2K A;  3BI2 A;  2GRT A;  4EQX A;  2GVC A;  2YLT A;  3DA1 A;  2JB1 A;  2YLR A;  5FS9 A;  3CMM A;  2VRM A;  4JY3 A;  4DNA A;  3NG7 X;  4OPI A;  3FMW A;  1GRE A;  2WEU A;  3NK1 X;  2WPC A;  4U8P A;  3SYI A;  3B6D A;  4UP3 A;  3UTE A;  3UTH A;  1H81 A;  2GV8 A;  2AQJ A;  1PHH A;  1GRH A;  3V3N A;  2XVI A;  4U2T A;  3QFB A;  1YQ4 A;  1LJ1 A;  1Y56 A;  2C75 A;  4K8D A;  3T0K A;  2XVH A;  2YLW A;  4WCT A;  1ZX9 A;  3V76 A;  4Y4M A;  3VRD B;  2AAQ A;  1KN0 A;  1GPE A;  1K0J A;  4OCG A;  4DGK A;  1ZY8 A;  1NEK A;  4EIP A;  2GAH B;  5KRQ A;  2C73 A;  2YVG A;  2QCU A;  5IQ4 A;  3OZ2 A;  1PXB A;  4U8L A;  2A87 A;  5EB5 A;  4FK1 A;  3C4N A;  1GXF A;  2YG4 A;  1TDK A;  1GAL A;  3AB1 A;  3KVE A;  3T2Z A;  4B68 A;  2V3A A;  5BUK A;  5L46 A;  3CIR A;  3NTA A;  2APG A;  4B64 A;  1QO8 A;  3AXB A;  2WP6 A;  1F8W A;  1M6I A;  3AE5 A;  3AE4 A;  4IVO B;  1F3P A;  2EQ9 A;  1N1P A;  2XYO A;  4FK1 C;  3C4A A;  4NWZ A;  3WE0 A;  4CRT A;  2XLT A;  2XFO A;  4BJZ A;  4OPT A;  4MJW A;  2GAG B;  3QVP A;  2A8X A;  4HA6 A;  1DJN A;  3GDN A;  3C96 A;  4ZCD A;  4H4V A;  2C67 A;  4OPG A;  3UKK A;  3CNS A;  1PDH A;  3PVC A;  3S5W A;  1H6V A;  2BS3 A;  2GMJ A;  3D1C A;  4J2W A;  4IV9 A;  3ALJ A;  1GRB A;  1OJD A;  4NNJ A;  3CPH G;  1FEC A;  5KXJ A;  4YT0 A;  5HY5 A;  5JCK A;  3K7T A;  3EAN A;  1DOD A;  4GDE A;  3AE2 A;  4K5S A;  2VVL G;  2XFP A;  1CF3 A;  5JCN A;  2Q0K A;  4BV6 A;  1TDE A;  4H2N A;  4G6G A;  1COY A;  2YR5 A;  4YSY A;  1QLB A;  1JNZ A;  4RG4 A;  3NHO X;  2YVJ A;  3ALL A;  1DNC A;  5CQF A;  2YG3 A;  2RGJ A;  3BI5 A;  3L5O A;  1Z6L A;  3QSM A;  2C65 A;  3VR9 A;  1PN0 A;  3AE3 A;  1DOB A;  2AR8 A;  3DJE A;  1CL0 A;  2VOU A;  1GTE A;  1YQZ A;  1OJA A;  1Q9I A;  3BNU A;  4JY2 A;  4P9S A;  1L9E A;  2JAE A;  4TM3 A;  2EQ7 A;  5KWF A;  1YQ3 A;  2C3C A;  2WPF A;  2R0C A;  1S7M A;  1VG0 A;  3SFD A;  2XLU A;  1ZMC A;  4EQW A;  2OAM A;  5GRT A;  3LZX A;  2R0G A;  1FL2 A;  1RYI A;  3LZW A;  3T2Y A;  4CCR A;  1CJ2 A;  3SQP A;  2BXR A;  1OJC A;  1D5T A;  4A9W A;  4CNK A;  5EOW A;  2ACZ A;  3AEG A;  4NTC A;  5KMP A;  3RP7 A;  1MXT A;  1EL5 A;  4U8K A;  4A99 A;  3SZC A;  3FG2 P;  1OJ9 A;  3KU9 A;  1PBB A;  1REO A;  1M64 A;  3K30 A;  4H2R A;  1PJ5 A;  3UKP A;  2R0P A;  4LII A;  2B76 A;  2WDV A;  4XXG A;  3UKQ A;  4C3X A;  2BAB A;  4K2X A;  5U25 A;  1ZK7 A;  3URH A;  4EM3 A;  2FJB A;  3AD8 B;  2RGH A;  3GDP A;  1PBC A;  1VRQ B;  3QSE A;  5KVH A;  3PG6 A;  3DK4 A;  4Z26 A;  2XFN A;  4IVM B;  2BS4 A;  4H4Y A;  2VZ2 A;  2UZZ A;  4II3 A;  2GR1 A;  4H4U A;  4XWR A;  1ONF A;  2YG5 A;  3VR8 A;  4YSZ A;  3M0O A;  1E7P A;  4H4W A;  3SZ0 A;  4YTN A;  2FJD A;  4JN9 A;  4EMW A;  4AP1 A;  5J7X A;  2O9Z A;  3CNJ A;  3GRS A;  3NT6 A;  2X99 A;  3QFA A;  4ZCC A;  4U8N A;  2ZZ0 A;  4B69 A;  2YQU A;  2JB2 A;  3K7Q X;  3EPT A;  4GR1 A;  3F8D A;  1GSN A;  3AWI A;  2YWL A;  3ICT A;  4ADW A;  2BK3 A;  2BYB A;  2GEW A;  3RED A;  4AOS A;  5M0Z A;  2WOV A;  3NYE A;  1D7Y A;  5TR3 A;  2C4C A;  3HYV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...