3CGGA

Crystal structure of tehb-like sam-dependent methyltransferase (np_600671.1) from corynebacterium glutamicum atcc 13032 kitasato at 2.00 a resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
186
structure length
186
Chain Sequence
DNNPAHSENYAQRWRNLAAAGNDIYGEARLIDAMAPRGAKILDAGCGQGRIGGYLSKQGHDVLGTDLDPILIDYAKQDFPEARWVVGDLSVDQISETDFDLIVSAGNVMGFLAEDGREPALANIHRALGADGRAVIGFGAGRGWVFGDFLEVAERVGLELENAFESWDLKPFVQGSEFLVAVFTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of TehB-like SAM-dependent methyltransferase (NP_600671.1) from Corynebacterium glutamicum ATCC 13032 Kitasato at 2.00 A resolution
rcsb
source organism Corynebacterium glutamicum atcc 13032
molecule tags Transferase
molecule keywords SAM-dependent methyltransferase
total genus 60
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3cggA00
3KPWA 2VDWA 10MHA 3FTFA 3NW9A 1G8AA 5HZMA 1BKYA 1L9KA 5DRYA 3SSOA 2QRVA 2JHPA 4RTNA 3M4XA 2YX1A 3CJQA 3EVEA 4LWOA 4M7RA 1O9GA 3BUSA 4XUCA 2G1PA 3FUVA 4P7JA 4M38A 1D2CA 5FADA 3UJAA 3B3JA 2UZ4A 3UZUA 2PX5A 1UIRA 2JG3A 1FPQA 2XYRA 3CJRA 4RTKA 3M6VA 2C7RA 1XDSA 3A7EA 4RVHA 3SVZA 4RTOA 1ZGJA 1QAMA 3PS9A 3LPMA 2NP6A 4ZTBA 4RX1A 4R05A 5ICGA 4CTJA 2I62A 4PYJA 3FPGA 2OXTA 4QPNA 2OYRA 4E2YA 2BR5A 3FPJA 3RODA 2ZFUA 3SX0A 2P41A 3EGEA 3TPZA 3B3GA 1R8YA 2O57A 4HTFB 3NJRA 3EVDA 2FHPA 1IY9A 2Z6QA 1I9GA 4P7KA 5FHQA 5K8VA 1XCLA 1EJ0A 7MHTA 5KYGA 3KPYA 4X41A 4GF5A 4XUDA 5ERGB 2IPXA 3FRHA 4OQEA 4WXHA 3UBTA 2XBMA 4NECA 5K0BA 2AZTA 3GXOA 3O4FA 3TFWA 2CKDA 1AQJA 2AVDA 3HCEA 5KVAA 2H00A 1SVUA 1QANA 3LECA 3K0BA 3OFJA 4RVDA 2IBTA 1EG2A 3LKDA 3EMBA 4E31A 3CGGA 3MERA 3KQWA 2IH4A 1VP9A 1YFJA 3KQTA 5CIYA 2WA2A 1Q0SA 1R18A 3C3PA 2O06A 5H02A 5EZSA 5FHRA 1XDZA 4XCXA 1F3LA 1ZQ9A 2AOTA 4C03A 5LQRA 4RV9A 3GWZA 1VL5A 1IXKA 3R24A 5DM2A 1TPYA 5EMMA 4YMHA 3DUWA 3HVHA 3PFHA 5CVVA 5GWXA 2WK1A 4KW7A 5DM4A 1P91A 2EG5A 3G5TA 2B9EA 5EIWA 2Q41A 3D2LA 5FWDA 2BM9A 3GIWA 3VYWA 4GBED 1KIAA 5DM1A 2HTEA 2R3SA 5P8WA 1D2GA 2H1RA 3LCVB 2ADMA 3DMGA 1KP9A 5CUQA 3HCDA 4HSGA 4MTLA 5EHGA 3ELUA 3JWGA 4FT4A 5CVJA 3UWPA 3HTXA 2PXAA 3FYDA 2I6GA 5DTQA 2JH8A 3EPPA 4Y30A 3EVGA 5K09A 2YR0A 4QVKA 1UFKA 3LHDA 3KR1A 3BKWA 2PWPA 5DTRA 4QTUB 4E33A 3EVBA 3I64A 4F84A 4ER3A 4R8RA 2BH2A 4BLUA 1FP1D 2JJQA 1F38A 3KPJA 3PFGA 4PIPA 3THSA 3GGDA 1SUIA 3ER8A 4YMGA 3OU6A 5JR3A 3SGLA 3LCUA 2WA1A 3OZSA 2ERCA 3REOA 2BZGA 4E30A 3KQYA 4AX8A 3MTIA 1DCTA 2ZZMA 5K0NA 5E8JA 2IH5A 2P7IA 5BW4A 2FRXA 3G8AA 5HEKA 2NXCA 2IP2A 1G55A 1JSZA 1L3IA 3DXXA 1RI2A 3P2KA 3JWIA 4O29A 5DX1A 1KHHA 5EVJA 1YFLA 3MGGA 3AXTA 5DPMA 1NW5A 2B2CA 5LR6A 1WY7A 3LGAA 2P3QA 3BWBA 1Y8CA 2ZLBA 2C7OA 3ID6C 3L8DA 5E9QA 3FPEA 4MHTA 2IDJA 1X1AA 3T7RA 1EQAA 1QAOA 3QOWA 1NT2A 3E23A 4FGZA 4PGGA 4ER0A 3IV6A 2ZW9A 3CC8A 2BR3A 4QPPA 2GLUA 1RI4A 4X63A 4FZVA 1YB2A 5FUBA 1KR5A 2CL5A 3GRZA 3KR0A 5DLYA 1TW2A 1P1BA 2ZSUA 3AWIA 3CKKA 3E8SA 3OZTA 4PWYA 2B25A 2YUIA 3DMHA 5E8RA 3R3HA 1JG4A 2PV0A 5EMJA 2EJTA 2G8NA 3HNRA 3E05A 1WXXA 1UWVA 2FPOA 3KQMA 1XVAA 4A6EA 5C0OE 3SR4A 2OKCA 4C06A 2A14A 1L3CA 5E2BA 5HIIA 2ZWAA 1EAMA 1XDUA 2OPBA 3FPHA 3P2EA 4C4AA 3TKYA 4R6WA 2HNKA 2HR1A 1JG1A 3A26A 4V0RA 2VS1A 5CM2Z 4B17A 5T67A 3GRVA 2ZBPA 1R74A 2ESRA 3FRIA 1KPGA 3OCJA 3X0DA 1R6AA 4E2ZA 4PIMA 4QVGA 4FS8A 1PRYA 4CKBA 2FCAA 2QYOA 5K05A 3MQ2A 4GC9A 3F4KA 3GCZA 1SQGA 2UYQA 3HEMA 2IH2A 3DP7A 3P9CA 5E9JA 3MHTA 5K0FA 2I9KA 1INLA 2OB2A 3LSTA 2AOUA 5E1DA 1JQEA 1BC5A 4KIGA 5LQKA 3P9KA 4LG1A 4PYNA 3M6WA 2LD4A 5HOQA 1XCJA 2QE6A 5LQUA 3C6MA 3GJYA 4H0NA 2YTZA 3A7DA 4AZSA 5KQSA 2K4MA 2GA9A 3G2OA 4OBXA 4OA5A 2ZIFA 1WZNA 1G60A 3FZGA 5CD1A 5DXJA 1O9HA 4DKJA 3FPFA 3GRUA 1VIDA 2YXDA 3FUUA 1SQFA 3JWHA 3UA4A 4ER7A 2AVNA 3SSMA 4OA8A 5FQOA 3PLAE 4XUEA 3FTEA 2JHAA 2YVLA 1G6Q1 3UA3A 2ZWVA 3AY0A 3EVZA 1JTFA 2PWYA 3DLIA 1NW3A 3I58A 2Z6AA 5EEHA 4R8SA 3ME5A 3B7PA 3ANXA 5U4XA 5K0JA 3M6XA 2PKWA 2GH1A 3HA5A 1SKMA 3Q87B 5E2AA 1MJFA 5K01A 5GOZA 4AZWA 1AF7A 4RTPA 1AV6A 3M33A 3EEYA 1XJ5A 3M6UA 3P97A 3HCAA 3BWCA 5CVUA 1U2ZA 5FULA 4FP9A 4FT2A 1RJFA 3TMAA 3UJCA 4DF3A 2OB1A 1EJ6A 3DLCA 1NKVA 3GNLA 3GDHA 4YV1A 4U7PB 4QDJA 1M6YA 5EMLA 4A6DA 3A25A 4L7VA 4PNEA 4POOA 2XVMA 3R9XB 5MHTA 1XTPA 3G7UA 1FP2A 3KQVA 2DPMA 5DRTA 4IKPA 1RI5A 2Y1XA 4GUAA 3GO4A 4GOLD 4PYIA 2H11A 3SMQA 1WS6A 3P8ZA 4C04A 3KQSA 3B5IA 1X1BA 3A27A 4OX9Y 1HNNA 3AJDA 3UJ6A 4EQZA 2QRVB 5HFJA 5EKUA 3PX2A 5K0LA 2FYTA 3AXSA 1KYWA 3NTVA 3EVAA 5DTMA 5DX8A 1JSXA 5GM1A 2AN3A 4DZRA 2GAFA 4EMSA 5LQAA 5M5BA 5EMKA 4RVGA 2NXJA 3LBYA 3CBGA 5CVDA 1WG8A 5E9WA 3G8BA 3EGIA 1KXZA 3M70A 4ISCA 4IV8A 2CWWA 4P7FA 4YV0A 3P9NA 4P58A 3KQOA 3UJDA 3LL7A 3BT7A 3HM2A 1NW8A 4FR0A 3FTCA 4KDCA 3OZRA 2O07A 3B3FA 1O54A 4BP1A 5K0GA 5GM2A 3VC2A 2JH9A 1PJZA 1VPTA 2PT9A 3ELDA 3NDJA 5FA8A 3DR5A 1VLMA 3GU3A 4BLWA 4C07A 1I4WA 1NV8A 1I1NA 4YUZA 3IHTA 3KKZA 1ZG3A 1IM8A 4C08A 3I5UA 5E1MA 4DCMA 2ONYA 3PTAA 5D1HA 3RIEA 1FBNA 4E2XA 2PX8A 2V7EA 3EVCA 4RTJA 1T43A 2GS9A 3CJTA 1KYZA 5EEGA 1Z3CA 2PSSA 4RVFA 2G70A 2G72A 3WSTA 3MCTA 3KR2A 2PX2A 2UYHA 1Q0TA 1OR8A 2XVAA 3T7SA 4YV2A 2OBFA 2IDKA 2ZIEA 3DULA 2C7PA 4OBWA 4E2WA 5LQCA 3EEOA 3G2QA 4YUYA 1JR4A 4GC5A 3G2PA 4KVZA 3V8VA 4F86A 4QDKA 2P35A 2O0LA 3OU2A 4RTMA 1KPHA 1RI1A 1VBFA 4FSXA 2ZBRA 2PGXA 4ATNA 4KDRA 1N7IA 4DA4A 1H1DA 1R00A 1RJGA 2AOWA 2F8LA 2P40A 2FK8A 2QY6A 2QM3A 3DXYA 3TOSA 4LWPA 4EK9A 4RTRA 5F2OA 1G38A 4CTKA 2NXNA 3DXZA 4Z2YA 2ZZKA 1EIZA 2IFTA 1NW7A 3H2BA 5HIMA 4CKEA 5CCXA 3FYCA 3BGIA 1P39A 2EJUA 5EPEA 1HMYA 1JTEA 3TR6A 3LDGA 2C7QA 4K6MA 3LX6A 4PCLA 5DXAA 4PCAA 2ZVJA 4QQNA 5JUWA 1X1DA 3HCFA 5EG5A 4RTLA 3BGVA 2XYQA 3KU1A 4GQBA 4MQ4A 1M6EX 2PY6A 3EGVA 4X61A 4IV0A 1ORHA 3BWYA 5CVEA 5DSXA 4YUVA 5KS2A 2GB4A 3NWEA 4P7GA 1ZKDA 2Z6UA 5EHIA 3A4TA 3HVJA 2JHCA 5FQNA 1QYRA 5DWQA 3NWBA 2P1DA 2AOUB 3B89A 4HG2A 5T6BA 3GRYA 4PYLA 3NMUF 1G8SA 3T7TA 3DMFA 2I7CA 5D1NA 3UJBA 2VDVE 5E1BA 1P1CA 3E7PA 2VP3A 4F85A 2UYCA 2AS0A 3FUXA 2YXEA 4BLVA 2AN4A 4EKGA 3G2MA 3HVIA 1V39A 2IIPA 3ELWA 3QV2A 5F2NA 1ZHFA 3ER9A 1YZ3A 3MAGA 5C1IA 3R0QA 5LQJA 4GOOD 1NBIA 3BZBA 1N2XA 4DQ0A 3HCBA 4BP3A 1YF3A 2OZVA 4X1OA 3Q7EA 5HILA 4C05A 2FK7A 3C6KA 2B78A 4M37A 3UJ7A 3DH0A 5B1SA 2NNWB 3K6RA 4PYOA 3TLJA 1SG9A 4GEKA 3HA7A 4UOEA 4E32A 2HWKA 2ZTHA 3MB5A 4OQDA 3KQPA 4HC4A 1YZHA 2PX4A 2PVCA 3V97A 4PYQA 3VC1A 3OE5A 1VQ1A 2VZ9A 1R8XA 3FUWA 3G89A 2NP7A 5E1OA 3C0KA 5GIOE 4RTQA 5FCDA 3GRRA 5HIKA 3PX3A 3UJ8A 1TW3A 4DM3A 2BM8A 2BR4A 2YXLA 5EZQA 5T64A 1DL5A 3BXOA 3G88A 5EGSA 3SM3A 1X19A 5EC8A 2GPYA 3KR9A 5CCBA 3DTNA 3CCFA 5K0EA 3SSNA 4HH4A 4ER5A 3I53A 1FJXA 2ORED 3TRKA 3JWJA 5F2KA 4HRAA 1N7JA 2XYVA 2P7HA 3PVCA 3QOXA 5IH3A 2R6ZA 5EOVA 5EKXA 1VP3A 3G5LA 3P9IA 2PXXA 4M36A 2EX4A 3LDUA 3TQSA 3UFBA 5BXYA 5K0CA 1BOOA 3ERCA 3KPVA 2AR0A 4PINA 3I9FA 1L1EA 3MCZA 2ZULA 1JG3A 5LSAA 2PJDA 3PB3A 3OE4A 2YQZA 2UYOA 2AOTB 2PT6A 1M0EA 3DOUA 3FTDA 4X60A 4R6XA 4CXMA 1QAQA 3EMDA 1RJDA 2AOVA 5HIJA 3FUTA 1B42A 3IYLW 5EQJB 5EIFA 3RW9A 4Y2HA 4E70A 2IGTA 3TM4A 2CMHA 3LDFA 2OY0A 2B3TA 4DMGA 2NXEA 1QZZA 3ELYA 2AOXA 4IWNA 5GINE 5ICFA 2AN5A 4RTSA 2ZIGA 2N47A 4GOMD 1X1CA 2ONZA 3CVOA 3NVKI 3KHKA 4FSDA 2VDUE 5DM0A 5FA5A 3THRA 3IEIA 2OO3A 3LCCA 5BW5A 5BP7A 5DSTA 5KQRA 1YUBA 3C3YA 2P3OA 5DX0A 1AQIA 4QQKA 4ER6A 1RI3A 5C9ZA 1WXWA 3SXJA 1NBHA 5ICEA 2DULA 2E5WA 1KPIA 2NYUA 3BWMA 4PYKA 2IBSA 4RWZA 3MTEA 1BHJA 1NW6A 5IKMA 3HA3A 3VSEA 1ZGAA 3O31A 4MIKA 3KPUA 1NE2A 3NDIA 3OU7A 2CMGA 2ZBQA 3R6TA 4PGHA 1XXLA 3TM5A 9MHTA 4MWZA 3BGDA 4PONA 4YUXA 1JQ3A 1JQDA 2P3LA 3HCCA 4HGZA 2EFJA 2PBFA 1SUSA 4KIFA 4RYLA 4YUWA 3O7WA 3P2IA 4DCGA 2PXCA 4LECA 1L3BA 4GOND 5G02A 4CKCA 4BY9E 2P8JA 2O05A 3PT9A 4JXJA 5ICCA 1ORIA 3NVMB 4HGYA 4WVLA 4KWCA 3UJ9A 2HV9A 2HMYB 1NV9A 4V0QA 2G71A 2V74B 5DT2A 5GP1A 3KQQA 4AZTA 3TKAA 5LQNA 5K03A 5GIPE 3EVFA 2KW5A 4CWAA 4HTFA 4EVIA 3S68A 1D2HA 4KRGA 2PLWA 3P71T 1MHTA 3LBFA 1VE3A 4RSRA 4U7TB 4EKIA 1JG2A 3BKXA 3OFKA 2ZCJA 5FWAA 3LKZA 1DUSA 4QTTB 4PYMA 8MHTA 1RJEA 3HP7A 3ORHA 3HVKA 2ZZNA 3OPNA 2Y1WA 5FTWA 4AZVA 4AUKA 4G56A 3U81A 3T0IA
chains in the Genus database with same CATH superfamily
3KPWA 3X43A 1YA6A 4WOPA 4E14A 2ZJYA 1E6MA 3MYRA 1D0IA 1G8AA 4RPGA 3REQB 4E5KA 3CRVA 3U16A 2WDPA 4F46A 3MNFA 1XQYA 1N25A 3OA2A 3WYDA 4LWZA 1I2ZA 1UZLA 1JDJA 1ZRHA 3BWEA 4H1HA 1NUSA 3D8RA 3RC8A 4MQ5A 1P6QA 1T0UA 2GYWA 1JILA 4YAEA 4EHBA 1DQYA 5JZ9A 1QMPA 4HZUA 3HGMA 3KXDA 3DZJA 3WK8A 1IY1A 1Z22A 5AI9A 3HSSA 4EYGA 2XQIA 1R9JA 2PFKA 3Q8WA 1OFGA 4B6JA 2WJHA 9ATCA 2WF7A 1UBUS 2HA2A 2G9UA 3PS9A 4UHDA 5C5EA 1C3EA 3W2GA 4FOPA 4K1XA 1TO2E 4HQLA 3CZRA 3DONA 2UYYA 1FXUA 4COOA 3DOCA 4IH1A 1ZM7A 5JO0A 3HXMA 1YR3A 3SX0A 2P41A 1B8NA 2DLNA 2OR3A 2B0CA 3EGEA 2YXPX 4RY0A 3V8EA 3U4QB 4TKUB 1KZ9A 1DWQA 2JK1A 3AETB 2Z6QA 3PQ3A 3AK4A 3T38A 4JI4B 1JP7A 1LPAB 1XPJA 1BMQA 3K6JA 4LDJA 1FFBA 5LDGA 3AMVA 4WXHA 2DUUA 2V6IA 4GYKA 1TVKA 2NG1A 2PG3A 4AUNA 1VOTA 3FM9A 3RVLA 4NBRA 3TFWA 4N18A 1BS2A 1DDOA 1OBVA 2C3UA 2XCQA 4A2WA 3QVTA 3TGPA 2IBTA 3EPRA 5DGHA 3RDPA 1EG2A 5EIOA 1JQJC 4CM4B 3BN3A 5BQ5A 3DBLB 3IVRA 2QW1A 4CL8A 1LF0A 1LNSA 3M5WA 3CF4G 2VQ3A 1WPQA 2QQ5A 2W2MA 3ZU4A 1ZAYA 1B76A 3EJ6A 1R18A 2WHPB 1TYEB 1WVIA 4I55A 4JP8A 1H2ZA 1I80A 1P9OA 2YHBA 3AVQA 4H6WA 2ZVPX 4MVXA 2WNHA 4GFDA 4WFJA 4NIMA 4FMCB 1C9YA 1J09A 4HFRA 1FNNA 3NNDA 4ZZ1A 1EZ4A 5GWXA 4AK9A 1W29A 5EHQA 3P27A 2PH1A 3RYCA 2GEFA 1H6CA 1JHMA 1Z83A 2B9EA 2BTOA 2JIPA 2JLSA 2JFXA 1G6KA 1QH8B 3NHUA 2ID7A 4OSOA 4RF3A 2WSMA 3UK1A 2OQRA 4YX9A 1PO7A 3TDKA 1UBOS 1D2GA 1L7OA 3DLPX 3I8XA 4X6XA 5KHAA 1MLDA 4IZHA 5IN4A 1KP9A 1L4EA 2MSDB 4DGSA 2Y3IA 4QGAA 1KBOA 3CTPA 1E7RA 1RWQA 4HY3A 3AI2A 1NI5A 1YBAA 5LP6A 1TYZA 2WC1A 2P27A 1SKYB 2JI9A 4MYUA 3D1VA 3T5AA 1ISJA 5FL7D 4CKXA 1KH1A 2J7KA 2XIJA 3DAFA 3K96A 4V0OA 4BAGA 3NH6A 3QLVA 4F04A 1Z2OX 3MUNA 5KYWB 4B44A 4XCQA 3G5AA 5AKHA 2IIVA 3E6AA 3O8LA 5HM8A 5ITZA 5ALQA 2FN9A 2Y1OA 1RLTA 4XSHA 2XD9A 4AUEA 4AX8A 5E8JA 1XLTA 3QU7A 1Z4QA 4MH0R 4GS5A 5EVJA 3MAAC 2IUFA 2X9NA 5I5GA 3T3DA 1BDHA 2Q2QA 4UAUA 4Q21A 4LXHA 2J7PD 3MS7A 1BQEA 3CRQA 3MIIA 4I6EA 2G6TA 3C45A 5IJ9B 4QYIB 2IDJA 1KVQA 3V2GA 1NT2A 1QKJA 2Z5LA 1CDDA 3U48A 2JAXA 2BAGA 3IPYA 2XUOA 4HNQA 2BR3A 2P69A 2P6PA 5DH9A 3RU2A 5BWOA 5J1SB 5KTYA 3TJMA 4IUYA 2EJVA 3L0SA 4UMDA 4G81A 3O38A 4HDRB 3W2HA 1L1QA 5E8RA 2EWMA 2HRDA 2NO4A 4UDOA 2JFBA 1IQPA 1RYYA 5EMJA 3RIHA 3EWAA 5JRZA 4P0QB 1YIAA 4Z86A 2OCPA 5ALJA 3Q7RA 4WKPA 3H99A 3JCZA 3T8YA 3OF3A 3ZJVA 2ZIAA 3IOCA 1MX5A 3PFBA 1JXAA 3NJ4A 3P2EA 1ADFA 1V6CA 3WAJA 2VK2A 4DLVA 4DR4B 3WZMA 2IP4A 1N1DA 2I55A 1JKFA 1Y6JA 2VG8A 4HXFB 4PLHA 5BSTA 1GTRA 3JSXA 3BE4A 2QDXA 2ZBPA 1R74A 3M2PA 1L5ZA 4OYLA 2R00C 3RBZA 5HM6A 2QJTA 4II3A 4E2ZA 1QQTA 2CNBA 3H2KA 1PRYA 1QO9A 4C7MA 3LUJA 5A05A 1RRGA 2OKGA 2PQ6A 5FPYA 1JFFA 3OUZA 5AR1A 5FV7A 3S29A 2VTBB 3H1GA 5LWHA 2Q3MA 5DB4A 1Q5PA 1GGKA 2OB2A 3A9UA 3LSTA 2JEYA 2TMKA 2CFIA 2J9RA 3H5OA 3IELA 4ZCRA 3FHTA 4FYHA 4XB2A 4B81A 2C29D 1E2MA 2VRCD 3QPUA 4G0NA 5A62A 2GHRA 1OXKB 4MPRA 5F4ZA 4D56A 4CMAA 5HOQA 3K4QA 3V1TC 5KQSA 3LBIA 1XZJA 3ET4A 4GMFA 1QLJA 1JU3A 3L6CA 3EIHA 3IR6A 4D3ZA 3VJKA 4AJHA 5C3MA 4PRKA 4B2LA 1DEXA 5D3MB 2NUAA 4P86A 3PU6A 2W6CX 4M60A 5FQOA 4B3HA 3N6XA 4ENUA 4H4DA 3W8DA 3DMTC 1ORRA 1XZ8A 2Q2NA 3BCSA 3PIDA 2JI6A 4HB4A 2Z6AA 1RBMA 2INGX 2H4FA 4U3JB 1MA3A 2XT6A 3BRCA 4XZ3A 4K0RA 4Z5XA 1DGQA 4R98A 2UAGA 2QTMA 2YVQA 4W1SA 2Y27A 5IM5A 5K8LA 4ZANA 2G36A 1QRAA 3NHMA 2Z3ZA 3EQ8A 4U2CA 2R6R1 4EMBA 4IZOA 5K01A 4UD6A 2Z5GA 3CNBA 3DAYA 1ZUIA 2V5AA 3I2HA 2D2VA 3D31A 3HB9A 3O3OB 1M34B 1KFCB 3PI6A 4J16C 4EI2A 2APJA 4FT2A 4BNMA 3EXG1 4IWYA 4K8RB 3TW8B 3VUEA 4LDZA 3ISVA 3GDHA 2GLXA 2PLAA 4UZFA 2QTAA 4FMBB 5EMLA 1W30A 2C00A 2PM8A 4MICA 2C95A 2LTAA 4CDGA 1DCKA 3QNMA 3TOCA 3MJTA 4BO6A 3R9XB 1BFDA 4Y6PA 2HHLA 2RHCA 4GUAA 4CODB 5BRNA 4RH0A 3NQ41 4JJEA 4V03A 1N0WA 1X1BA 3DEZA 2B1IA 4QG7A 2Q5EA 4NBWA 1ZIYA 4NNPA 2DETA 1FW8A 1KEVA 1AKTA 3Q9UA 4G9BA 4M0LA 3LHKA 3LU1A 2J9FB 1C3VA 2W42A 1BVUA 3I9V6 3INNA 3FSRA 5AVOA 2BGGA 2YWHA 5TEVA 3U1BA 4ANFA 5GMOA 4FGWA 4DZRA 2EBHX 1A5ZA 1Q15A 1FRQA 1T6XA 1USKA 2BJHA 3PSHA 5CLQA 2NXJA 3C8DA 1NY6A 3CBGA 4JDUA 1WG8A 2AI2A 2Z57A 1U4SA 4ZQCB 4ZT5A 3ZH9B 2H1OA 1A9ZA 2OWEA 2XQFA 1GQRA 4XD7D 1ATIA 2A0XA 5J2TB 3D59A 2XNSA 4FR0A 1HR0B 4PNHA 2XXAA 1YI0A 2B94A 3TLBA 1E3DA 3I6YA 1R4MB 3GLVA 3OICA 4IHJA 4YH1A 4BP8A 1G9XA 5AUPB 4M2LA 2Q9BA 2FWPA 1LD3A 3I6QA 4WZAA 5J5AA 2A92A 3QW2A 2V8BA 1FNDA 1IWPB 4BNIA 2RCNA 1C30B 4F5DA 4FBGA 2QN2A 5CH3A 4IQ8A 2IHJA 4BNTA 5F7ZA 2CNOA 3NKFA 2OOKA 1JIVA 5ECDA 1E20A 2X1VA 1FUEA 2FZVA 1C50A 3F49S 4M0EA 4J0FA 4NK5A 3TB4A 5KQMA 1UJMA 4FJ2A 3FY4A 1CS0B 1S2DA 4ROTA 4FC6A 2EHJA 3QXGA 2OORC 3FYUB 5J2UF 3OQPA 1LS1A 1C1DA 2YV4A 3LGSA 2XVAA 3T7SA 2W37A 4BLTA 2B4YA 4X20B 3TZBA 2B5WA 3VU1A 3BXZA 1Z8NA 1LPPA 1LFAA 4I1VA 1KBZA 4JBXA 2PUJA 2PWZA 3FCEA 4YLGA 2QJOA 5IFLA 1RI1A 1H4QA 1F6WA 2E82A 1QX4A 1VJ0A 3ZGYA 4WK2B 1EDBA 5LU8A 2IF2A 1BNCA 3DXYA 2C57A 1XLTC 3LY7A 4BECA 1BYUA 3ZIAD 5KYUB 1U3VA 2E85A 3CWCA 3SQLA 3DCYA 3F2VA 2W70A 5KJ1A 3A4VA 3GMIA 1I1HA 2HXGA 4TLBA 3TOZA 1ACJA 4WPGA 4XTCS 3HJGA 4KBGA 1RQLA 2IYPA 4M0FA 2CLKB 1FYWA 5DNEA 3PNPA 1AZWA 4GG1A 2J32A 3DTYA 4XYGA 2C7QA 1XMOB 2GK3A 4IMPA 4Q1FA 4D9KA 4D96A 5TF0A 1K3UB 1N2HA 4HVLA 1YS1X 4IHQA 5HR5A 3PQ5A 1L7BA 3QBDA 4UBMA 3NT4A 2XDWA 3GLIB 1VL0A 5CJ2A 1PQUA 5EKDA 4M1TA 1VJDA 1M6EX 2DFPA 1NBMA 4LF8B 1YI1A 1A77A 5JU6A 2XITA 5KIAA 3RS3A 2B9VA 5JLAA 1NC1A 1IUNA 3HJAA 3MXTA 1R0BA 4KK4A 2ZYIA 1GZ4A 4Y7CA 3ZJTA 1DAKA 1ATZA 1PFGA 4YACA 4RM2A 1QPBA 2I7CA 4YQZA 3HWX1 2EZ4A 3H3FA 1P81A 4GI7A 2V7TA 1GN8A 2BM1A 1VIYA 2JGFA 3D6TB 4D44A 2GT1A 5CYGA 4I3FA 3THOA 3H5VA 2WHYA 2W22A 4HK4A 1QR6A 3GARA 1M8GA 1RIIA 4O8CA 4K8OA 1P1RA 1MU0A 4QEZA 2Q6IA 3RROA 3I9NA 5HKKA 1GTMA 1XD2B 1LI4A 2XF2A 3A3OA 3HRIA 1O4WA 3QLJA 4K6HA 2DZDA 4NBNA 5TMEA 1WUYA 2HYDA 3RTDA 3ZQ4A 4YXWA 4BGUA 4BQPA 4O3MA 1DC4A 3Q3JB 1LEHA 4ARSA 4ARUA 3FZYA 1WXHA 1HLDA 5KAMA 2VOJA 2I6QA 3C8HA 4BVLA 5TC4A 3VVCA 5HZKA 3UICA 4Y6LA 1EIWA 1VDZA 1XLUA 3EVNA 5IC4A 1CVLA 1T25A 3A6EA 5KNDH 2A9JA 3OPXA 4L2IB 4MI1A 4MNTA 4KR9A 2D4HA 5KOIA 4QHSA 1V1JA 5A1JA 1SHJA 3NBMA 3RUIA 3C0KA 4KMSA 1X42A 4NLLA 4FWIB 1O97C 1S5PA 4J6EA 4NZOA 1UOPA 1JZSA 3O2NA 5DTIA 4LHYA 1JH9A 4CUKA 2XVXA 4I0WB 4JB0A 3QG5A 4FN5A 3MS2A 1IBLB 4BFLA 5EZQA 2BFNA 3M3HA 3ANSA 1CFJA 3EWIA 5HYVA 2WU4A 1O97D 2FNAA 2IZ0A 5BWCA 3R41A 3TXXA 4NYJR 4GD3Q 2J85A 1MEEA 5CIWA 1QLHA 3M1AA 4QOEA 4HDNB 1SVNA 1M2HA 2R6ZA 3CN7A 3PQ2A 5AKLA 2A5JA 4O4JB 2DQ4A 2JGNA 3EIUA 3KQHA 3KPVA 1W8DA 5CK5A 5NLLA 2AG1A 5CB6A 2XGSA 3C3CA 3AU9A 4W5JA 4E7OA 4UULA 3T5BA 1HYEA 4P5PA 5IZCC 1XV5A 4MUXA 4RZUA 2WWGA 4BLPA 1SKQA 2I80A 3LUAA 1G64A 2PT6A 3JYOA 4PVCA 3HJFA 3RLIA 4LHEA 2HHJA 1FP6A 1W4ZA 2Y1CA 4ZU3A 3L49A 1QK3A 1UKCA 4E70A 2JCXA 3T34A 4DB4A 1EJ2A 3WLTA 1AHIA 1N57A 4GPTA 2GPTA 3L7AA 1W0JA 4UD2A 1UKVY 1YCFA 5AHWA 4ABYA 1FLVA 5JWHA 3F7NA 4UUOA 1FDRA 1WKCA 2R6DA 3OCUA 5FBVB 2RK4A 1GSAA 3NYIA 1MO4A 2C83A 1YKSA 2O2EA 2QT0A 3B1XA 4QT0A 1DLJA 1R7RA 2A84A 4ID9A 4RY2A 4UDYX 4H3SA 5CX4A 1RAFA 3U6KA 2GBCA 1M73E 3VKFA 1X13A 2JKYA 2IPOA 2A88A 2P2LA 2DT8A 4OUDB 1AQIA 4N5MA 1X1SA 4ER6A 5K6TA 2LE0A 4OLHA 2P4SA 3VPXA 4O4LB 1OASA 2YMLA 3BWMA 2BGUA 2BHRA 1O94A 3M0EA 4B09A 1V41E 3CNLA 1L5LA 1I13A 3JS5A 1CR0A 5JXHA 4X1IA 3TM5A 4JBIA 2QQ0A 3VJMA 3W6NA 4AO7A 1MPTA 2JBHA 4U7JA 1TK3A 3QKWA 3KOWA 1ONSA 1AA9A 4YRTA 4PXSA 4W99A 4EUSA 2WUGA 5JG7A 5JE8A 3LL4A 1C7RA 3QY0A 2EEZA 1XN4A 2X13A 3GZJA 4FQ7A 3MTAA 1V4VA 4IXMA 4LSWA 5EJIA 2ASVA 4CKCA 5CITA 1MX3A 1UJ5A 5BR8B 2A1IA 2JFYA 1RE0A 5KKCA 2GYVA 2V74B 2Z2YA 4K9PA 1EFHA 1NUPA 4EUNA 3WTBA 4KLAA 3QBVA 3T3HA 3TMYA 2PLWA 3R75A 1RM3A 3HL4A 2WYOA 4XARA 3U7IA 2H2HA 4LY3A 5K4HA 4RIIA 1A88A 4G24A 5JO9A 3Q5DA 4R83A 1P3DA 8MHTA 3T5PA 4GU5A 4MEJA 1BXGA 1HT1E 2FPGB 1Y5MA 1RRKA 1ZOSA 2CXRA 4GSYA 2CLOB 1F8GA 4JQZA 2JLVA 4S1OA 1SY7A 1S2MA 1XLVA 5A7GA 4RTNA 3FSEA 2JCYA 2DUMA 3ISJA 3CJQA 1KK1A 4JLUA 4YXWD 3C6XA 3ENZA 4M7RA 4AJJA 4QPDA 2E4ZA 3OIFA 2ZYDA 5BNFA 4LCBA 4BZXA 1Q3HA 1UP7A 2IU4A 4QGGA 1XD8A 2AT1A 3F8SA 2X2FA 3JAKB 1F1JA 2GRJA 1DEOA 1MEJA 2WLTA 2R4TA 3WLAA 4Y9TA 3SKXA 3FFBA 4IPTA 5G0WA 5I6DA 1WB9A 1NJ5A 2XI4A 3QMPA 3MLAA 5TRTA 4BVGA 1HE3A 3FWHA 3MT0A 4X9XA 1M5RA 3ENQA 5CTJA 4EFNA 2VDNB 4GXRA 1OZHA 4XB1A 4MRAA 1A7UA 4Q3AA 5FDFA 3WL6A 4DCOA 4GRDA 1ISRA 2R85A 5KYYB 1UANA 1L5GB 2PUBA 4C78A 4J0IA 4MV0A 2Z2IA 4U3JA 4PY2A 3WLPA 5B1IA 1IMOA 2Q99A 5KTRA 4QJBA 2B30A 7MHTA 4C4OA 2XCLA 2IPXA 5CRIA 1O94D 3W9BA 3EZ9A 3X1XA 2ZP1A 3PPVA 3K0KA 1AQJA 1TD9A 3HCEA 3IAEA 3CMCO 4LRUA 4ZGWA 1M34A 2ZJZA 3HJUA 4EVQA 5EERA 1CRWG 1ESZA 2NSLA 3HYNA 4JUBA 1Y1RA 4PTYA 4GEGA 4RGYA 5FBLB 3ZDQA 3ZDXB 1CRQA 3RYHB 3ZZMA 2ZSJA 3GFFA 1YFJA 2CY0A 3DKRA 2MIIA 1SXPA 1RZVA 3KQTA 5DWVA 3U44A 1KMNA 4E09A 3QWBA 4WDRA 2JGKA 2NVOA 3GXBA 4PFJA 4G6ZA 3ZDYB 5LQRA 3A36A 4HB2A 4KN9S 3VNSA 1W9MA 1PJTA 1X80A 3PFIA 4R81A 3MBKA 4QQFA 2ZYAA 5CVVA 1FNCA 1RVDA 2EBWA 2IYNA 4WD3A 4P4SB 1ZNZA 2J9FA 4ENWA 2ADFA 1U7DA 1T5LA 2YVAA 4I1YA 4OGFA 4C4RA 1OTHA 1C8KA 2RI1A 2WLSA 5HQTA 3TLGB 4GBED 1OCEA 4TMWA 1B8PA 2O5VA 4CRWB 1ZVQA 4J0EA 3O95A 1E1YA 1NRWA 1U3DA 2X9QA 4QRIA 3I3OA 1F17A 2AK3A 2BUCA 5IANA 3IJ5A 2ZQYA 3VYUB 2I6GA 1O8BA 4AQDA 1VLQA 1ZJ6A 1FLNA 1DVRA 3VHXB 4YRAA 5ECWA 1R15A 4HMPA 3M3DA 1EM8A 2ZRAA 3KR1A 4ZEXA 4IJ6A 4LZWA 3TIXB 3I64A 4RQTA 1H22A 4D4LA 4WZAB 2EV9A 1BE0A 1AXEA 1UXIA 2PUWA 3P0RA 3A9VA 3L7IA 4JKIA 3I12A 3WA7A 2LV8A 1QBKC 2FPIB 4IXWA 3KLNA 4ZCTA 1KVTA 3REOA 4CF6A 3ABSB 3MEQA 3KQYA 3NYWA 3MTIA 3MTJA 4IMJB 3UG6A 2IH5A 1XZEA 2YZMA 5HEKA 2VYFA 3VISA 1XWFA 4RZIA 1G55A 4EJFA 5CCDA 4DEXA 5SV2A 1IATA 1WAMA 5JHHB 2G77B 3NUGA 2I3BA 2IUTA 5TF4A 5FH9A 2VA9A 4YIKA 4LCJA 3UC9A 5KVCA 4F9TA 2G3YA 2P2CA 2VP4A 3KKKA 3WLJA 2GM4A 3EW9A 1IBSA 3V1NA 3J7AC 2HU7A 3TH5A 4NJMA 3T7RA 2OPHA 4BTEA 5AJZA 4X20A 2ZW9A 3Q15C 2GLUA 3TVYA 4X63A 4QPJC 1U0RA 2E3JA 3PUZA 4IIVA 1UJBA 3JQQA 4LZZA 3N8GA 1HTWA 2V4MA 3WKAA 1T0BA 4DLXA 1E9FA 1EAYA 2PDAA 3CXUA 3E27A 3SOPA 3K0AB 1HGXA 2FQYA 1JHYA 1PE0A 4PLVA 1UWVA 2E0IA 1WSWA 2F3QA 4FI3F 4DA0A 1VCOA 4UCQA 3LIIA 4BX0A 4J7AA 4MS1B 1X2BA 1O5IA 2PT5A 2I3ZA 2ANCA 1C7JA 1XEWY 2NVUA 2W43A 2EW2A 5EJFA 4QRHA 5H3HA 5EAIA 3OCXA 1XRMA 3EDQA 4B48A 1THGA 3DO8A 3HXPA 1TO1E 2O1XA 5EFZA 1JG1A 2RI0A 4PEVA 5ALKA 3IDOA 2R8RA 3MFYA 2H2IA 3ROXA 1GZ5A 3OT5A 5J4VA 3TS1A 1JW9B 1ZO8A 4C0BA 1KARA 1QDUA 3TQCA 4QOIA 4YVFA 3E03A 4FR5A 2FLVA 1RC1A 2QYOA 1UBEA 1AUOA 5LP6F 1YNSA 5AKKA 1R0XA 4BBAA 1ESMA 3KWMA 1RQNA 1KETA 3LNTA 3M4ZA 4FKBA 3UXHA 2ZEJA 5ESRA 1QHGA 3EHEA 4WLUA 3IUSA 3S2IA 3U26A 1GU0A 1NVUQ 2ZK7A 4Z4CA 2YY5A 4C30A 2CSXA 3C6MA 2ATVA 3NYRA 3CZ5A 3ON5A 3D6VA 4OBXA 1LSJA 1NVAA 2AXQA 3AKYA 1VKJA 2DAPA 4RADA 2RFLA 4WCDA 4L6AA 4BKQA 1QTNA 4IGKA 1GTSA 4KWEA 1M3SA 2OT3B 3OQVA 2AKAB 1X8KA 2I6XA 4KOEC 1TMGE 3UA4A 5HZHA 2MJLA 2ZM6B 1Z39A 1JKIA 4OHVA 4B82A 1COWA 1GGMA 3EVZA 3OTIA 4LOIA 2EARA 5DVZA 5F12A 1JGTA 4KP7A 2GAIA 4HYEA 1S7CA 3QLUC 1KJ9A 4XGQA 3ZV3A 3LXMA 4JLKA 1GCOA 2LBPA 4OM7A 5CU7A 5A5FA 3WMEA 2PQ0A 3IULA 3W90A 2BTEA 3SLGA 4BO1A 4N48A 4KV9A 3O9VA 1U9ZA 2X2OA 3E5NA 5SICE 5E38A 3WMXA 3ZXIA 1H6DA 3L06A 4R1QA 3EEYA 1XXHE 3M6UA 3U3JA 3KB1A 4HQ0A 1QOZA 1U2ZA 2SCUA 4FP9A 1GNQA 3T1OA 1M33A 3TMAA 2GJ8A 2A57A 3NBYC 4WA8A 1SUPA 5LVAA 5B3LA 3JQ7A 1SB8A 2XY4A 3BX1A 4AVYA 2OMEA 3OIVA 4ND8A 1E66A 1AX9A 2PJUA 1NF9A 2RIRA 5TQ2A 3UUFA 4D45A 1QM5A 1G2IA 5JSUA 4HLCA 3GO4A 3G5MA 1M5TA 5LMCA 3W79A 2NYVA 3V1UA 4BQRA 3EGOA 2XRZA 1OLUA 2XBLA 4U5XA 3IAFA 4HHEA 4KYIB 4XWAA 4Z8XA 4D6XA 4DIDA 2RHOA 2CEKA 3LXRA 1S2NA 4MB0A 3M7IA 4HTAA 3ESYA 5CJPA 1YJ8A 3CF2A 3WBJA 4B6QA 4JLVA 2EWWA 1QQBA 1GPKA 1MJGM 2GAFA 5KTPA 1GL9B 1CF4A 1K6MA 2F7SA 3WZ2A 4X62B 2NPFA 2QROA 1D4OA 1OC2A 2R6CA 1VE9A 4GBGA 4MKZA 2LR0A 1GPMA 2XMCA 4W9MC 4WLNA 1LBTA 1JF8A 1R0WA 1O4VA 1SQ5A 2GD0A 2QSUA 2VF5X 1ORWA 4XKJA 1R10A 4B3CA 4BN5A 3MWDB 5JTTA 2BI8A 3JPYA 4GZ3A 2B20A 1QZTA 2C3OA 1IAVA 2WV9A 1FFGA 3WICA 2QR5A 3SZ3A 4EG7A 5CLIA 2Q50A 4MDYA 4BVFA 3K5WA 5I3ZA 1JQAA 4YHHB 2Y93A 1TCUA 3K31A 5FFFA 4WUTA 1ZIDA 2OXCA 2VR1A 3AG6A 3F74A 1M66A 3GVPA 1DAGA 3K94A 4OHCA 4ZAWA 1P4RA 4ZYLA 2G4VA 1T43A 3GF4A 5BMVB 3V9PA 4H6VA 5AHXA 2IV2X 1KYZA 1ZMOA 1C9JA 3IKMB 3R0VA 3UNXA 1K7XB 5CA0F 3H9EO 3KJXA 3STYA 1RQ2A 3P96A 1P0MA 5AVSA 4XR4A 1UCFA 4X1IB 5K8IA 4OHMA 4BUCA 4MPJA 6LDHA 1C29B 1CYDA 3PQ4A 2ZYGA 3AVWA 1ORTA 1XZQA 2DH6A 1DHRA 1SO8A 1Y98A 2FMFA 2O0LA 2OV1A 3HB1A 3VH1A 4DMLA 5HWSA 3E1SA 1N7IA 1H1DA 2VXYA 2FK8A 3TOSA 2HPVA 2XVZA 2A94A 3N0RA 5F2OA 1DC6A 2EATA 5C51B 4L0CA 4L15A 2VJDA 1B00A 1EIZA 4W9NA 3TOVA 1HL3A 3DV0B 3ORFA 2O8FA 3VPCA 1Z7EA 3K9HA 2NTJA 4CQJA 4WI1A 4EKNB 1DBIA 1NHWA 3H5AA 3M83A 4Z51A 1NPTO 1IBMB 1L4UA 4UAGA 3WKBA 3IQXA 3CZ4A 4FEYA 4NCHA 1I3KA 4PCLA 4ZT6A 4D02A 3QELA 4X3PA 1T0IA 3DZHA 1FVHA 1ZA1A 1E60A 2Z0MA 1H0HA 4PCAA 5AW6A 5EWJA 3V55A 1RR6A 1T4CB 3S2SA 5CFZA 4J3NA 1TJ4A 2HRQA 1DMSA 3LW7A 4GQBA 1B41A 1VA4A 2IP1A 1MJ5A 3C4QA 4B6SA 3I4LA 5TGTA 1AK9A 4YUVA 1QH0A 1U3CA 1WQ1R 3WMGA 3PWTA 1T6BY 4G8BA 1TAHA 5KB3A 3SEFA 4WX2B 1YDHA 2F3SA 1I3LA 4H7FA 4Q3DA 1NN0A 1WP4A 1P9NA 3E9QA 3ZVLA 2CFOA 4UEWA 4LXXA 3VC3A 5T8KA 1QO7A 3H11A 5HHTA 2X0JA 3W2IA 3C5EA 3T06B 4FCTA 5D1NA 1FZTA 4II7A 4UEOA 1X7WB 4AZ3B 4CTMA 2FMTA 1QF6A 4TSKA 4ZRNA 4ZT3A 1E79A 5EE5B 5CW2A 3ANLA 4RORA 3WLQA 2CLEB 1UPCA 4DC9A 4DA8A 5BRJA 2I99A 4ZAXA 3KKEA 1IN5A 5BQ3A 2ZRDA 1JRLA 2GN2A 3DD5A 3DDUA 4I9FA 1DBPA 1F2TB 2Y77A 5CA1F 4HWTA 3VR3A 1QVWA 3FPKA 5HILA 4DA6A 1YXMA 2B78A 2FR0A 3S1AA 5EI5A 5JD5A 1EVJA 2BEWB 4GEKA 1K7SN 3HA7A 4E32A 4EGFA 2Q9UA 1CUXA 1XJWA 4UOEA 2XUPA 4MQMA 3S8YA 2ONJA 4ARZB 5EIXA 2XB2A 4FKMA 3H16A 4HC4A 3V97A 2J6BA 3UGJA 3OE5A 4IIDA 1IZ8A 2FG7C 4PZDA 1SUDA 3FSGA 2RHRA 3LY8A 1CUWA 3PV0A 1P31A 5AUQA 1GTZA 4PAQA 2B7BA 5FLYA 1UOEA 2ZJ5A 4OHBA 2VP2A 2ZSDA 1B1CA 3IRUA 1PDOA 2AC2A 3ZWKA 4O4HB 1RADA 1N32B 3A1UA 3B52X 3FAKA 4Q37A 4LXGA 5AW8A 4TLCA 4GYJA 4UEKA 1ZVKA 3PF8A 4BZQA 5FYQA 5FNVF 4B6RA 1DOZA 4ER5A 3KEMA 2I5PO 5B6JA 1MZVA 3OM1A 4O2BF 1WMEA 4A10A 2ZRPA 3ETGA 1B43A 2I71A 2PO7A 2OLEA 3RIMA 4E46A 4HD8A 4FUTA 2EL9A 3CZAA 3ERCA 3KCNA 3GLKA 3DG9A 5EZYA 4EBBA 5AM4A 1H2FA 4WOKA 2QQGA 5DBHX 3ITNA 3S55A 3LPAA 3U5TA 3PC4A 4JBLA 3UMCA 1HEYA 4JJKA 3I09A 1P2DA 2Z56A 4KTTE 2VJYA 4G5YA 3G8YA 2P9YA 4QLAA 5FLEX 1GAQA 4AT1A 3V00A 3LUFA 2I2FA 1USWA 1T8TA 3FHCB 4Y2GA 2ZJFA 5HIJA 1DG9A 4O1MA 2P8SA 1PQWA 3W9YA 5C80A 4B33A 3KT0A 4EO7A 3WGQA 3TWOA 2VTKA 4XEHA 5B2ZA 3TIIA 2V9PA 1U7WA 3EPLA 4LF9B 2IIBA 4LXUA 2OD9A 1LDEA 5ICFA 1EESA 2AN5A 2FLKA 2X1LA 4KODA 3TNJA 2H1HA 2IYAA 5C4GB 3IQIX 4RCZA 1PCXA 1J42A 4FIZA 1MGPA 4DV1B 1E69A 4IIXA 5TPWB 4BRSA 3QTTA 5DF1A 5DSTA 1YUBA 3IQHX 1K5PA 4EW2A 2PPLA 4C5AA 1CX9B 3H8WA 4BMDA 5ICEA 4TYPA 1HA3A 2QTGA 4BFTA 2Q46A 3NOVA 4Q19A 4QA9A 3U19A 3VC7A 4RZXA 2GN9A 2I6UA 4BEJA 2NSJA 1RAGA 2ATCA 4B6GA 1NE2A 1XMPA 1XXLA 4IEIA 4IICA 1U9IC 3H9UA 4NX2A 3IKTA 4YUXA 2Y6UA 1N2CA 2P3LA 3GLTA 3ITEA 3L7OA 1ODKA 3MCWA 4HGZA 4XOIA 1ISIA 3VZRA 1ZUD1 5INTA 1QS0B 1AMUA 2OCIA 2VKTA 5EHNA 5B7QA 1N36B 4TN1A 4NCAA 1OXVA 1T1EA 3DE0X 1JZTA 1AN9A 4C76A 1Q3KA 2JCBA 2WILA 3ESXA 3PT9A 5CXXA 5TS3A 3VX4A 5CFMA 5HP4A 1JA0A 1PEAA 4LGVA 3UQYS 4MVJE 3JVEA 4N40A 2HCBA 3UM9A 3W1VA 2G71A 3QA9A 5D85A 5GP1A 3KQQA 4OI0A 1MAAA 4V0KA 5LQNA 2FX3A 1QIKA 4URYR 4CWAA 1FNSA 1X3LA 3ZCVA 2XYHA 2CL7X 3AKCA 4A23A 5CAEA 1R5BA 3CUSA 3P71T 1UXJA 4URWR 3ZUPA 4B1FA 1FXSA 4DR1B 2QG9A 3WSWA 4UMEA 4DMCA 1SCAA 2PS1A 2NVUB 1FMJA 4FFWA 1NF2A 2XUZA 3UOWA 4BB0A 3UMMA 5LD2B 3AHEA 4JT8A 2QAGB 2WT9A 3K0EA 3R3JA 4JI1B 3U1VA 4CM6A 1QB7A 4L27A 1KRWA 4HGRA 3R23A 1QCYA 2TSYB 4FEGA 4RQUA 2WWHA 1WU8A 2YJTD 1OJLA 5JYDA 3QEJA 1TAUA 3I28A 3ICPA 5DRYA 3HSKA 2QRVA 4JOCA 4ZHQA 5F77A 5IEBA 2VDPB 4YTEA 3U40A 1YSCA 1H2XA 3CWZA 4QGFA 1WZUA 3HHPA 2AR9A 4MQLA 4TZ0A 4IIFA 1JR3A 1KO8A 1UJNA 2H8KA 2QUJA 1XVIA 4OHWA 4P7JA 4UVIA 2X9GA 3RUHA 4B9AA 3BD9A 1PFUA 3UZUA 4EPRA 1SCUB 3FAZA 2EKBA 2V45A 4Y6GB 2XB4A 4RPLA 5L4LA 3DL2A 4N39A 3A7EA 4C0AC 2FDCA 1K2VN 1E94E 4G1UC 4X90A 5HJ7A 1XNGA 2OCDA 3JQFA 2C2MA 1YMVA 5BR4A 4CQMB 3X1DA 4D1YA 4DY4A 3FYTA 2PGJA 2POQX 2Q4RA 5T7BA 3FPJA 4TZTA 2NTNA 2V3CC 4KXLA 1XVUA 1RMTA 2A9VA 4RAQA 3DE4X 3LZCA 2XBUA 1Z06A 3ANTA 3EVDA 5ECGC 2QLMA 2YW9A 1NVTA 3H9CA 2X0NA 2FJPA 3C15C 3I9MA 1ESNA 2V59A 3TZLA 3UWOA 5JTUA 2BZSA 4OI1A 2AZMA 3BMNA 3G0GA 3H6KA 1NF8A 3WNCA 3H1AA 2AFIB 4IF4A 4MQEA 5IXYA 3RRYA 3E7XA 2AZTA 3EDOA 4JROA 4OQYA 2QVXX 4P84A 2BHNA 2BFDB 5CEFA 2P11A 5L3VA 2PO5A 1KF0A 3F6BX 2ZVDA 2OP0A 2HV8A 3WRXA 3IMFA 3U9TA 3K0BA 2FH5B 3K32A 3BSFA 1TQ4A 5DW3A 4DBLC 2BLNA 5KWIA 1XDWA 1X2EA 3JQ7B 4R3WA 3WK5A 2CLIB 1ADYA 2JLAA 2Y71A 3AFIA 2Q6VA 3U80A 3W8EA 2M1XA 2RHJA 3SI7A 4ND8B 2ASEA 4I9HA 3TSWA 1XRLA 3ICOA 1DADA 4XCXA 2A9RA 1V5IA 2IU0A 3C97A 4MUIA 3R7AA 1LUAA 1FDWA 1FFXA 2FVXA 5J2UA 1TPYA 1O03A 2M9MA 2WSSD 3KHTA 4HVCA 3DUWA 2Q6LA 3ZWBA 3EZLA 3ZDFA 5FWYA 1YZFA 4O0LA 5E7IA 2V0GA 3FIJA 1U3FA 1OBCA 3EZFA 1VRWA 2BM9A 2IE8A 4CM1A 1GTL1 4QC2A 3IBGA 5BWBA 5DM1A 5CH5A 3M1YA 3H2ZA 3FYHA 3GY0A 4XIYA 1XZKA 2HCTA 2MR5A 2PGNA 1C7FA 2E5FA 2QZ9A 4HAWA 4KPEC 1XEXA 5KTNA 1Y5IA 1RM5A 3FYDA 1R0RE 1J2YA 1ZJWA 2YR0A 3UK7A 4HL6A 1ULHA 1UFKA 1E79D 2FWNA 3WSVA 5IT4A 1JYSA 5TMDA 1YHYA 1IVNA 1LRLA 3O9MA 3IIIA 2Y76A 2JJQA 4AJIA 1U0LA 1PJBA 3LF1A 1WV1A 3ET5A 3WL8A 4YLYA 2J0UB 2XJ9A 4WOJA 5F64A 3L6OO 3HACA 4GI1A 2H1IA 4PLZA 1NVVR 1TEVA 3H9JA 2F9FA 3B53X 3IVXA 3OLWA 1H1LB 4RZ3A 4ZVRA 2P7IA 4BNUA 3I6MA 5BW4A 2NXCA 2JA1A 1FYFA 4RMGA 5KYXA 1QIMA 3HY6A 1RI2A 1SC6A 4U4AA 4EKDA 2OK7A 2RH9B 3EEFA 3HZZA 1D0VA 1EFRA 1PNOA 1QC5B 1U0SY 2B1JA 2VUHB 3GQBB 3D6HA 1P5FA 2OCKA 3PEVA 2QUBA 4TLLB 2FWMX 1PR0A 5E9QA 5T6MA 1ZD8A 2YN4A 3C5CA 1IU9A 3FR7A 4H31A 3SJBA 2D3TA 3OZVA 5BNWA 5I7RA 3E23A 1JVBA 3HJHA 5K3BA 3FLMA 3ZK7A 1P6UA 2D5LA 2ORIA 2GM9A 1ZGGA 3BBLA 4Y67A 4JUFA 1D3AA 4RANA 2EKPA 2PPVA 3OZTA 3DW3X 3QEAZ 3BXHA 1PWHA 2B69A 4M1KA 1WZ2A 3ROZA 3G0IA 2GCOA 2TMDA 1YJXA 3E05A 4K9QA 1CTQA 3KQMA 1T15A 3TDNA 1K4KA 1Q21A 4HB3A 4NRDA 4QYTA 3HJCA 5DNCA 3SE7A 1RS0A 4CETA 3SVLA 2COEA 1S1CA 4TXHA 5HNKA 1N34B 1QQ6A 3ROEA 4GMHA 2AJDA 5TPZD 1EP2B 3O8OA 3PT5A 3N9IA 3RSCA 5CM2Z 3FOAA 5FI3A 1SBZA 1G3UA 2Q3LA 4JL5A 4IIGA 1X94A 3F4KA 4PFSA 4J4BA 3GEMA 2DBZA 2O3TA 4TT3D 1TT5B 1II9A 2WIFA 4Q4JA 4A03A 1KK3A 4EB8A 1IB6A 4EG8A 2J67A 5ARBA 3FSGD 4YT5A 4KQ9A 3D6JA 4B40A 1OLXB 2B1RA 2NIPA 5AFSA 4ENVA 3OURA 4DG8A 3WGIA 1YT5A 2QWXA 4I5FA 3RYTC 4RKWA 3G13A 4DV7B 3ROMA 3E61A 1YULA 3ESQA 4GLBA 4ZP1A 4UC0A 5DDIP 1NVBA 2GA9A 3HI4A 4JQYA 4AZSA 1TXGA 1XA3A 1G60A 2B4AA 4LZLA 4WNCA 5FI0B 3T9FA 5DXJA 4DNXA 2HMSA 2LP4Y 4L5IA 4MYSA 3IAHA 2BOVA 1C81A 4MZXA 4WL0A 5F1KA 4CIBA 3ZVNA 4OXQA 1UMBB 1DT3A 1P1JA 5JAHA 1ZESA 1CNFA 1NYLA 1YOVA 4FHCA 3EGDB 4I4TF 1ZVMA 4LV6A 5CFLA 2ZBGA 4W1QA 3VAYA 2X76A 4ZT4A 1U2GA 2OSVA 4KAJA 4DANA 3IUQA 2QY9A 1R27A 5KJEA 1H93A 4LN1A 5AI8A 4FDAA 1MJFA 1O96A 4ARAA 4AQ7A 4V02A 4CV0A 2Q1WA 1HF3A 5KTKA 1PZNA 4C22A 1F9AA 3ITDA 1RWKA 3N2GB 3RJMA 1C30A 2IY8A 1NI4A 1ZNQO 4MJLA 1AQ6A 2G4CA 2XXJA 1VHTA 3ZDRA 4PHHA 4RJ2A 5IJXA 2AF3C 1JAHA 1C0IA 2R79A 1K08A 4YQYA 1FTQA 2F1KA 1ZINA 3EASA 1KJNA 3NAGA 4E94A 1T3TA 2NUTB 4HWKA 3RVBA 1V9SA 4JJ8A 1XTZA 2IEYA 1OXSC 4B7XA 1PSZA 3FNQA 4QGBA 5CA1A 3U56A 3W7AA 1QFMA 3V7WA 4L0QA 4OEHA 2Y92A 1W52X 2HMTA 1P8AA 4JBWA 4NESA 3KOZA 2YWRA 5GZ6A 3S27A 4EPXA 1GUAA 5CDSA 1P2VA 3TQTA 3MMPA 3ZCXA 2ZRCA 4EEZA 3K0CA 2R1TA 3A28A 1IN8A 1RFGE 4DC1A 4MAAA 3EE6A 1YZUA 5EMKA 1DIHA 1XCGB 2ODTX 2P9HA 3JQ8B 3PQ7A 2OAQ1 4F92B 1N92A 4CG1A 1P1IA 3OTGA 1KXZA 3ZGNA 2IHTA 5G2OA 4AULA 4EEXA 2ISSD 1JR3E 3T35A 4BX3A 1PR5A 1V43A 3AHIA 1QLWA 3G8DA 2QV0A 3R7NA 3MLEA 5AOVA 4XX1A 1X1QA 3FMIA 1E1DA 4NCXA 2UV8A 3KB8A 3ELDA 1AHNA 1QGAA 1RLUA 1YQTA 2HA4A 1YVEI 1SU8A 1RAEA 1I1NA 1EBUA 2G4LA 3NKVA 4C08A 4JZKA 3N5CA 2FR8C 2P5TB 2ZRHA 1G6HA 1HZJA 1GR0A 1N6PA 2VCHA 1YS6A 3C39A 3TE7A 1AF4A 4GE3A 2HOQA 4FK8A 4QBIA 4RK4A 2D7DA 4JP2A 1NLMA 1FS6A 1FBNA 1GL7A 1ZBQA 1KERA 2O2IA 1N7GA 1OI7A 2QT1A 4U63A 5K6AA 4KNWA 1H65A 3H84A 1FL9A 2V7EA 3PR2B 4BO2A 3DCJA 2P9QA 4IJKA 1BEEA 4L4SA 1BHSA 4N6NA 4KIWA 3K70B 4WIAA 3TE6A 1XMQB 4D26A 1A8HA 3QPDA 1U7TA 3F4BA 1MFPA 5A71A 3FDFA 3LT2A 2G70A 2HF8A 3QKSA 1M2FA 3MCTA 4WNIA 2QD3A 4XD2A 4PLWA 2AX3A 2FEXA 2RBGA 1XNHA 3MGBA 1EFDN 2YKGA 2GVZC 4IDHA 3D2AA 4LIPD 1N2CB 4U2FA 1QV7A 4YECA 4MB2A 1K7FB 3T7KA 1O9BA 1NFFA 2HLNA 2Z98A 4EYQA 1NXXA 1ZJJA 2I2DA 3R74A 4JJ7A 1UODA 1P0PA 3KWLA 5EUMA 4UASA 2PXHA 3EISA 1ODCA 4M0PA 3PE3A 2F1RA 1J20A 1NW7A 3FLEA 1BMTA 2VHQA 2AIRA 3WIDA 4DIFA 1Y6ZA 1JTEA 1ULUA 1WTAA 2OV2A 2PT7A 1Y33E 4GR4A 2LCFA 2Q0QA 3C3WA 3F78A 4LI3X 4Y2JA 2BTQB 1UIMA 3OEWA 1PVDA 3I9V1 2W00A 4QQNA 4DLNA 5JUWA 2WUFA 2WWIA 4MINA 1PAUA 1R0YA 3UH0A 1ECFA 1F8YA 2Q7DA 2X8JB 3GH3A 2V03A 1Z6XA 2GB4A 4R41A 3W78A 3FDIA 2H5JA 5IM4F 3WIBA 1YJBA 3KKLA 5DWQA 3VV2A 4PYLA 1DWUA 1U9CA 2AD1A 2P0YA 1GFWA 3Q1KA 3TR0A 4YP6A 5C18A 3DBHA 2G8LA 1TUBA 2QGFA 2W6IA 3B6KA 2ZRQA 4G37A 4KQGA 1FU4A 4X85A 5COBA 1KMMA 4IUCS 2XLCA 3N3AC 4FYJA 4LVCA 1H69A 3ELWA 4XFJA 3H1FA 4KQ2A 2IELA 3KJFA 1Q0PA 1U1CA 3MAGA 4MUKA 3SM9A 1PS0A 3Q8MA 1UBJS 3I37X 4KQ1A 1T4MA 1DXHA 2JKZA 2DQKA 2QAGC 2VJCA 3F4LA 5AXCA 3QBEA 2IOYA 4I6JA 3UJ7A 2BFBA 4IEEA 2D1FA 1ZNXA 3QPWA 3TLJA 2DUJA 3ADDA 1LK5A 1Z25A 1PVVA 1QWSA 2HWKA 3SEQA 1P5RA 2W4MA 4N5HX 3VV3A 1LCIA 3A6PC 3GEDA 1R6BX 1QOPB 3VO2A 4UU7A 1IQUA 1XHEA 3GLSA 3JVUA 5I7UA 4XLTA 1R4NB 3NV7A 2XOKD 4Z99A 1G291 1FZQA 2I3GA 3O73A 5SZIA 5HIKA 3AB7A 1RPJA 5LR6A 3IBSA 3D4LA 4JJAA 3W8RA 3W5UA 4OMFG 1R4AA 3IR5A 1TEXA 5T64A 2PKYX 1ZZGA 1I0IA 4X64B 5EC8A 1RYDA 5FEUA 1WBJB 1U8FO 3F6RA 4RFVA 1ODIA 5CCBA 5BN4A 3UIEA 4DQXA 3H4IA 3SF8B 3IL2A 1I3MA 3X44A 3CVWA 3TRKA 4FYIA 3ZWYA 4BWVA 1Y7TA 4HRAA 4EI8A 1YJAA 2Q1XA 3I9OA 1USVA 1X39A 2P7HA 3GN1A 5ER9A 1RLJA 3W4IA 3URMA 3WISA 1SUBA 2KMLA 3L7CA 2WQ6A 1IM5A 3LDUA 3D1JA 1BH2A 1I24A 2WM9B 3CW8X 3MN1A 4HQOA 4I2NA 4YAUA 4JI6B 5IJAA 1TM7E 2FN3A 5KPDA 5A02A 2H9YA 3JTMA 1UAAA 1W48A 1L4GA 5A0VA 3OCYA 3H19A 2PEYA 1A9SA 4NVRA 3V6LA 2ZTSA 3GRCA 1JAXA 2PEZA 4Q4HB 1EUDA 4A92A 3LT0A 1N5DA 4WXPA 3DOOA 3EG5A 5KX5B 3KDAA 2EIHA 4YJ2A 3GJ4A 4K03A 2OY0A 5HDBB 1QQ5A 5E2IA 1NURA 1XVLA 5EXXA 1GADO 2H1FA 5CG1A 3PNBA 4IDQA 3LQ2A 3T12A 4Q03A 3TB6A 2CCKA 5ADVA 3Q3GE 5FLXA 2N47A 4I1OA 4R68A 4M7PA 2NXWA 4D9EA 1EYZA 2D06A 4NFLA 4J6FA 1QIEA 1YDFA 2IX9A 1SCNE 4GYYA 3T1NA 3BH6A 1KO1A 1VGRA 3CKMA 3J81A 3ZS9A 1ZEJA 2Y68A 4MWBA 3DOHA 5DX0A 4FC7A 4DNQA 3TTSA 5CLHA 5LA6F 4CM5A 2CDCA 4LVOA 4RWZA 5LB2A 3PR3A 4YHBA 1ACLA 2UUPA 4LJYA 1NW6A 4EVRA 3HKBB 5B55A 1N6HA 1LTHR 3QHAA 4CIXA 3VSEA 7YASA 1X1EA 3IUBA 2YHSA 3JQGA 4CMEC 2CFTA 2HHHB 4OKNA 1EINA 4GOKA 3D5TA 2OM2A 4RVUA 1A8SA 3LA8A 1EWTA 4YDHB 1BO6A 4L85A 3BAZA 4WZBA 4TRNA 3SNHA 1K6IA 1N8KA 2LRHA 2GUWA 4LECA 1E3TA 3ZJ4A 1DJOA 5F3WB 3KB2A 4JYBA 1E7QA 3FI9A 4PG6A 3NTOA 1TZBA 1M9NA 5KVSA 2HNAA 4RFSA 3UMRA 3UJ9A 2ZCUA 2HV9A 2REQB 3D02A 4JJ6A 3NHSA 4YAJA 1L5FA 4XFKA 4XJTA 5DT2A 3SD7A 1WZCA 1ZRNA 1Q77A 1OGJA 3ZEAA 4FHFA 2G76A 5FA6A 2XCUA 3KFVA 3CRNA 1DRUA 4Q48A 3DVLA 1KDYA 4E15A 1VE3A 1XZFA 4OQPA 4A0HA 5B57C 2QORA 2LXNA 3WGNA 2CDNA 2VPPA 1RWOA 3X2SA 3UN1A 2BELA 2YVKA 4S2UA 3ZLTA 4R0NA 4FQ5A 1P2TA 1HE2A 4UMVA 2ZT5A 3CM0A 1JJFA 4AZVA 5CXQA 4EB6A 4I19A 4JFRA 2XRYA 3Q5EA 2B8TA 5HTOA 2VDWA 1RQPA 1QWOA 2PZMA 3FTFA 5LNK1 4XSGA 1OWMA 3D8TA 1Z2NX 2C4KA 2PV7A 4JYCA 5HE9A 3VDQA 4BB9A 1PUXA 2W6JD 1R4MA 2I33A 4HX2A 4NATA 3VX3A 1N2EA 1VG0B 2K2QB 3AVPA 4E5DA 4EG6A 1IPFA 2GPSA 1TQHA 1MHPA 1Q2UA 1YK0A 4IRXA 4RKYA 2AE2A 2K87A 2NVBA 4HRYA 3RRJA 3OEED 5AK0A 4PZLA 3RIXA 3C5VA 3X1KA 1DX4A 1FRZA 1FMFA 3A4LA 3P19A 4D5GA 1HI9A 3IPXA 1V48A 1NVGA 4N82A 5IHPA 3AKEA 4UUAA 3SSAA 1DO0A 3HDVA 4W6ZA 1T3HA 1H94A 3MTGA 4GP7A 1Z2PX 3WGYA 1VA5A 2WU8A 4RF2A 2R11A 2D59A 3L7KA 5JY6A 1B16A 2A5FA 2VP5A 4L4ZA 4WDQA 3R76A 2DTDA 3EDRA 4N5LA 3VR6D 1EVQA 2J41A 3GCWA 4IZ6A 2PNFA 4LOJA 3CPEA 3S4YA 1HRKA 2RGGA 3EZ7A 1OYYA 2OV3A 3RS9A 3WWYA 3GRKA 1KZHA 3DEKA 5BSVA 2F8TA 3A4IA 1YU6A 5FWXB 5B3AA 4Y9UA 3VYTB 4QNMA 3ZI7A 3FLBA 3KJHA 2NTVA 1XJCA 5JFOA 1KFKB 3RGGA 5KWEA 1HDXA 4H35A 3HLYA 1BZYA 3QVJA 1O96B 2EYQA 4HQ6A 3EY9A 5IVPA 4HPWA 3OG9A 1U0OC 3IMEA 2ZIZA 5KOHB 2EFGA 3IHLA 5B36A 3T9AA 3OPYI 3R5TA 2FGJA 4LCEA 4ZCSA 3LT1A 5LWQA 3NVAA 4PIVA 3VOTA 4E07A 5LKRA 3KG2A 1GUZA 2X0KA 4IYJA 2CDBA 3KWFA 4LF7B 3T54A 4H7IA 3GWZA 1NXTA 4QODA 1NNSA 4LDRA 4D46A 1GWNA 1MO2A 2Z3WA 1U7HA 1EKXA 1OFVA 1JNXX 3HVHA 5DCWA 5HX7A 4B9EA 5G3ZA 4ZVSA 5G53C 1Z73A 3K1ZA 4LTNA 4L51A 5CW1A 4DXHA 4EGQA 2CYAA 4YRDA 1J25A 4QTYA 1ZD4A 4F1JA 1I3CA 4HWGA 1NX9A 2OORA 4NNOA 1AUQA 4YV7A 4KG7A 3THWA 1NNUA 1KAMA 3FTPA 4HNAA 2QN3A 5EGNA 3ZZNA 4RV5A 1BOFA 4HSGA 3HTXA 2W6MA 2RHDA 4L78A 1I1OA 4CF7A 1H5NA 3ABZA 4IJ5A 5K09A 1GNPA 1YQWA 4ONEA 5JPDA 2AGVA 5B12A 5F3DA 2OHHA 3BKWA 1HXHA 3CQ9A 1KC3A 1NVDA 4ER3A 2X6QA 3N0XA 3IDQA 1D2RA 3VDRA 4E12A 3K1AA 5AMXA 3SMVA 4AG6A 2BDEA 2QB5A 2OYSA 1GCAA 1MRZA 9GPBA 1EEXB 3OJOA 3P4YA 4JLMA 1CQWA 3CS3A 3QSGA 3GJ8A 3TZ6A 4YCCA 4B3RB 2FRXA 3SZLA 1A72A 5A03A 2IP2A 1JEAA 3SHFA 1T1IA 4U7FA 5K0SA 4IHAA 2H07A 3BG5A 1VCNA 2HK8A 2ZATA 5UKDA 3U37A 3IEVA 3CKYA 5JD4A 1Y8CA 3DW1X 4XIGS 2DYKA 2C42A 2ZLBA 3L8GA 4C4ZA 2C7OA 2XWSA 1GPWB 4HWOA 2ZUTA 5FOWA 2QTZA 3UOAB 2J6IA 2WQZA 2CLFB 2BE9A 3PJEA 3I0ZA 3IPAA 3I92A 2CZCA 1IHOA 5ENDA 4DJ5X 3ZE6A 3GLRA 3CC8A 4OXKA 4XPIB 2VSNA 4H7KA 2IVZA 1R5NA 5FUBA 5JYBA 2FZKA 1R0ZA 2RGNC 2OESA 4URHA 1VKZA 3RRMA 5EKTA 3VZPA 3RT7A 5BQXA 4HAIA 1CQIB 3P1JA 1MN6A 1Z37A 2R5FA 1IHDA 1IULA 2QP4A 3IA7A 4JVLA 4MI6A 4ZCPA 1W94A 4DM4A 1NMXA 3BK2A 5FNVB 2J5RA 3C3JA 4HBZA 3PXBA 3H7IA 5CTAA 3RBVA 4HS9A 1DC8A 2WMYA 4WT7A 1P4AA 3NC1C 4LE2A 4N3GA 3AY6A 4OQ4A 2MYNA 4MDHA 3UT0A 2YXBA 2P2DA 4W82A 2A14A 1KDRA 2Y1EA 4NPCA 2GRUA 3CUYA 3Q85A 3W4JA 1CJUC 1UPUA 4C4AA 3T4UA 1P8JA 1P18A 3PRKE 4IOJA 4JEHA 4MVCA 4KX3A 4LXIA 3GIDA 1OZGA 1ZONA 5T67A 4BHTA 4A91A 1JI3A 3GCDA 4N5NA 1RJWA 3Q7QA 4Q39A 3DDHA 1P5HA 5IYZA 1KE1A 2H59A 3L1UA 4TRJA 1UOQA 1SQGA 3SAJA 1M75A 4MWEA 5K0TA 1A5SB 2AMFA 3PHGA 4FMPA 3GLGE 1I2BA 2ES4A 5TT1A 3ZCTA 5E1DA 1TD1A 2PZAA 3WYGA 1W76A 2QM8A 3WGZA 4YCDA 3A6GA 3EXHC 4RZSA 4WN3A 2QE6A 4G63A 5LQUA 3BK1A 3CR7A 2JGMA 3ZY3A 5I9NA 5JSHA 4BN4A 1Q22A 1RZRA 4ARBA 1E8MA 4W8HA 1ZISA 2BY4A 2F4VB 3ZWNA 3JARA 4UTOA 1IG3A 1DKMA 3TZCA 3UW3A 4C1NA 2HEGA 2HADA 4QX6A 1N6RA 4H1UA 1NUTA 3JY6A 2PFGA 1X9HA 4MRSA 2M6KA 1W4RA 2PWYA 3ABOB 1ULAA 1IJFA 4M1QA 2FRDC 1E1MA 4JT2A 5EUQB 1UEJA 3ANXA 3OD5A 2DXIA 4F5WA 1E2FA 4DV2B 5EWMB 4E4TA 1L5SA 3PVZA 4R1PA 1MJGA 2VHCA 5GVRA 3IO3A 1QHIA 3E3NA 3K70D 1AGXA 5DN9A 1ZSVA 1B8OA 1P62B 4B2IA 1UZNA 1L7XA 2YYZA 1Z4NA 3IGFA 3ZE0B 3AF5A 2FW9A 2XQJA 5CVUA 1O6CA 2VDJA 4C3UA 4E6EA 2IHYA 4GZLA 1UQUA 1EJ6A 3NOQA 4RCYA 1OFTA 1NKVA 1JBKA 1J8YF 4LK2A 3WB2A 5CDYA 1B73A 3GBSA 1JR3D 3QMMA 3ZOZA 2QU7A 4WAUA 3A6LA 4RPKA 1E3IA 3FKJA 1TO6A 4MRMA 1N8NA 1AY0A 3FCUB 2ZS9A 4KFSA 4OH1A 2V5VA 5DTJA 4OCZA 13PKA 5AKZA 3CRMA 5H9VA 4G5XA 1GZ7A 2HF2A 3SICE 4DR3B 3AWDA 3A1DA 5EKUA 1WUJS 5CP8A 5JS6A 4HN9A 4WFIA 3AM1A 4MSUA 1VLHA 4EMSA 5KNDD 5LQAA 1QF7A 2ZCVA 3CURA 2B0JA 4I8XA 4MQFA 3L1VA 1CKEA 4E21A 2MMGA 2HU2A 2X7XA 4KXYA 4R7TA 3WGVA 3TGLA 3M70A 1PWEA 3P4XA 3DTVD 4HEJA 3TLXA 4Z4GA 1J70A 2ZPTX 1Q95A 4MUAA 5AM5A 3JQPA 3SJCA 4O25A 2NOAA 1DIAA 4XOUA 4OB6A 3ZKAA 4NJEA 4EY5A 3EQZA 4W8OA 5ELMA 3KAJA 2X0EA 2DF8A 4UJ3A 2W2VA 1LF5A 3CH7A 3DD1A 3L9WA 3WQHA 4IMRA 4WQMA 1WF6A 1DQNA 4P32A 2DBRA 4YS6A 2JIMA 1NG1A 3ONNA 2PYIA 1T3GA 3HKEA 4CEJB 3R7LA 1FQKA 4UM7A 1E4VA 4MWCA 2PX8A 4D7AA 2GWHA 4I1PA 4QGHA 3U17A 1DU4A 2VPTA 1KNXA 3GGJA 4FE7A 4YRFA 1H5UA 1FQOA 1ZD5A 4FFVA 2PZJA 1C3LA 1ZWKA 4IRMA 4B74A 2FWAA 2V7PA 4L08A 4RVFA 5BUZA 2FUNB 4EARA 1DC3A 4L8YA 4B3GA 3QFHA 4RY9A 3GGCA 2WPDA 4MV6A 3SZUA 2IHZA 4W1RA 3W5AA 2IDKA 2CMDA 2YS6A 2ZUDA 4MMXB 3GP8A 4OHZA 4EQ6A 2XZOA 4YO8A 1DARA 1LTKA 2DUWA 5LQCA 2ZB7A 2KQUA 4GC5A 3G2PA 4WZBB 4F86A 3PG5A 3QSYA 2FW7A 3FPSA 4AWXA 1MORA 3EXAA 1QV6A 3K3PA 4M1ZA 1MVLA 1PFVA 2F8LA 5J40A 4ZV4A 1V95A 2R25B 3N6RA 4I66A 3UGQA 5LMNB 1CIVA 2WIGA 1MV5A 4L6IA 4HUTA 5A2GA 3UB2A 3ETEA 3L7LA 2WWXA 4O1HA 4RLQA 2MYTA 5EPEA 3RSSA 4IDDA 4US2R 3L0OA 5EJ4A 2B4KA 2JLWA 3RVMA 1TYBE 1JQ5A 1LVGA 4GMKA 5DISB 2JD0A 5EE0A 5SYMA 4OXYA 5TMBA 5C4MA 4K2AA 2IZ6A 4GRAA 5CFNA 1LU9A 3VSBA 4DCCA 5HIIA 1HNZB 3QVKA 2VUIB 1EFUA 3ZNPA 3EOAI 5T41A 1XDGA 4UE2A 4Z6KA 1EFLA 3NBAA 2B6NA 2QTRA 4EY7A 4JP1A 2I3AA 3F2IA 3JQDA 2HCJB 9LDTA 1NN3A 2ANBA 1SK9A 1QYRA 2VHVA 4I4IA 4DMMA 3E3MA 3PEYA 4HG2A 4TT8A 2H16A 3NMUF 4G2TA 1ZGZA 5IDWA 2NV0A 4WCVA 2KLBA 3NDRA 3RVOA 2JIOA 4PSUA 4R1UA 2QMOA 5I8PA 3D4PA 5C8YF 3IE2A 1Q7EA 4KIJA 1YBVA 4OGGA 5KC8A 4ZTZB 4JUCA 4L0DA 3FR8A 1W44A 1YZ3A 3PENA 1DX9A 1C2TA 2WFLA 1Q16A 1Z5WA 3FN4A 3NBUA 2GJSA 5E6SA 5K3FB 3UK6A 1PK7A 3P45A 2H9IA 2IPLA 3Q8XB 4S04A 4CGYA 2W6ID 5G0VA 3LP8A 5JJIA 3KTAA 4M37A 2HU5A 3DH0A 2PLNA 5B1SA 3K6RA 2GZHA 1TIPA 2F8MA 3EA0A 3FDXA 3SYNA 1U7ZA 1HTBA 3M3PA 3RFVA 2OA0A 3GN2A 2BSXA 2XT0A 3NG1A 2C1EA 1SBHA 4M8NE 2VZ9A 4OFZA 4CQMD 5EMNA 4PZYA 1TMKA 3OE1A 4UNPA 3GUHA 3QE3A 5D00A 4DLPA 3JATA 5ALOA 3BQ9A 3L41A 2Q5JA 5KOHA 1MCZA 1UAYA 4OJKA 4X8LA 3U4QA 2X3YA 1M1YE 4JFAA 2OWDA 1YIDA 4KJZA 1UJ4A 1GJRA 3ZXUB 1U65A 3I62A 2Q2VA 1YQQA 2I6SA 5JS7A 1DLIA 7AT1A 5KHOC 1CVRA 2EW8A 4QQ8A 5F51A 4MR7B 1A2BA 3SJ7A 4HSEA 2IW3A 2OEPA 2GEUA 3RF7A 2DHDA 2B6HA 2VEOA 2XYVA 4RPCA 4WMLA 2C9MA 3N5KA 1L5NA 3A6FA 1JMKC 4OAQA 5IH3A 4E5SA 4A1OA 1NMEA 2P9FA 2OM6A 3DAPA 3N8HA 1KS2A 4N41A 2GWRA 2AR0A 2VNHA 1ND6A 3DMTA 5THKA 1ZOOA 5JV5A 2EX1A 3NEPX 4OJTA 4AKSA 4DUGA 3B82A 3E9DA 1XNRB 4B8WA 2QTLA 1K9VF 1JFSA 4AP9A 3PC7A 4HEA1 3RW9A 1W87A 4ZICA 1DIOB 2C2OA 3RYCB 3N0VA 2XUDA 3Q3EA 4I1UA 5E4FA 5H5JA 4IDGA 5JPIA 5C1PA 3EG9A 1UADA 1WUTA 3ELYA 2BEUA 2O50A 3WADA 1FFWA 4QDTA 3PXGA 3Q7TA 4DXDA 3AJRA 1NT4A 3L2OB 5GINE 2ID9A 3F46A 5JALA 4M9XA 2AG8A 4TUYF 5B7GA 1SVSA 2CVZA 4TYMA 4HNTA 2NYRA 4EJSC 1GYPA 1JU4A 1BD3A 3WJAA 1EVIA 2E7ZA 4DJJA 1G2PA 2YFHA 2VAMA 4ITRC 3DLHA 1XDBA 3ROKA 2QRGA 3NLLA 4EOGA 1MNAA 4JC8A 3IDSA 1NBHA 1U9JA 2BMFA 4P83A 4EPTA 3BIXA 1AN0A 4Q0MA 1BHJA 1X15A 3K5PA 4U5QA 5EYPA 3RK4A 3X1YA 5IKMA 2ZTVA 4WTOA 1T9DA 1YR2A 3G9XA 5A1TA 2ZAOA 3ZHQA 3RYFA 4F97A 5JCZA 2HPHA 1ZJZA 4O1IA 4PONA 4QD3A 1E9DA 1M2GA 3KCQA 1N2CE 2EGGA 4RZQA 1O6BA 2EFJA 1VPWA 4GOJA 3ZQJA 5FOSA 3O3NB 4BU0A 4ZI3A 1J2EA 4L4YA 2H2DA 5K20A 1MPXA 3G23A 2R5NA 1WCIA 3DUFB 4FZJA 3K2EA 6PFKA 3VO8A 1VSUA 1S2LA 3DEJA 3SF0A 3N2ZB 2BH9A 1E5QA 3WLNA 2ZJ7A 1JT2A 3BL8A 5ULLA 1IN7A 1UEIA 3PFFA 4UHJA 4XTRA 4ZI7A 4V0QA 3WV4A 1FB5A 4MEAA 3D8BA 5K03A 1LWNA 4WLVA 2SKCA 2ZR9A 3WGLA 1RKUA 3JYLA 3IP3A 2D7CA 2PKRA 3CUVA 3NM6B 1CUEA 3C3MA 4MVJH 1GQ2A 3HUFA 2ERXA 1OU0A 2LGJA 3EYAA 1QZUA 4BUZA 4UTVA 1DAHA 2RSLA 2AFIA 4XLZA 3ZU2A 4MA4A 5IT9A 2XH8A 2Q7XA 2X8AA 3UHFA 3AERB 1NC3A 4DDTA 1XJ0A 3CEAA 5T3YA 2B36A 1NXWA 2O9JA 2PKCA 2JAQA 1FC0A 4LRTB 5IC5A 5A9RA 3R5XA 1VRVA 3VMFA 2IYTA 4DV6B 2Q3CA 3PFCA 3TSYA 1BKYA 4XWWA 4DRXB 1AKEA 3GW8A 2V0NA 3PC6A 4XVRA 1R9GA 3TIGA 3ICVA 4DARA 1C7IA 4ZK6A 5LN1A 3DHNA 2V7QD 4LHVA 4Z3KA 2WUWE 4YJGA 1PV1A 1KOFA 2CKMA 2Q3FA 2X4GA 3E9YA 4HAUA 4WESA 3F98A 4M55A 3O82A 1T1JA 3PHCA 2TMGA 4IHJF 2JLRA 2OLKA 2E4VA 2VTBA 2O3RA 1TDJA 2NQ8A 2VJMB 4R2JA 3WOVA 5IVHA 2OXRA 4QBFA 4ITVA 4O6VA 1Y3DE 4BEBA 1OT3A 4K9MA 2PRIA 2BWJA 2ZANA 3MTDA 5DIZA 3SY8A 5KOYA 1T4DA 1OAKA 4DV3B 1TTQB 3FPGA 5H4HA 3P20A 1C4WA 3AJ9A 4W4TA 4WY5A 2XCSB 1J2RA 2YV3A 2C7BA 3ZDDA 2SICE 3OT1A 4WLOA 1E0KA 1I32A 1YR8A 3AEKB 3BQMB 1KE2A 2GDJA 2QN9A 4A0QA 3W5SA 1CK4A 1XCLA 3DTVA 2VRCA 1T1SA 3GYBA 3KPYA 4Z3OA 2EFCB 4OQEA 2R68A 2D0OB 3KXIA 2JJ1A 1PU2A 2ET6A 2FEPA 3F71A 1KWKA 4U2EA 2PQMA 4N3CA 4EHNA 2V7UA 3WIEA 2A9FA 4IL5A 4MV3A 2NUAB 2FV8A 3DZCA 2R6FA 3LBAA 1J6UA 5BT8A 5L7TA 3OFJA 1SCIA 1YZQA 3OO1A 4MCHA 3DV0A 2ERYA 1HFKA 3NCHA 3ASYA 4NPHA 3G82C 1Q0QA 3H6HA 4D8VA 3STUA 2AEFA 3GGOA 2JBAB 3DT9A 3N8IA 4M9QA 2WA2A 1A1VA 1DS6A 4RWEA 2IEZA 1W75A 2A9PA 2C99A 4ZO6A 1W49A 4AZ0B 1HG1A 4XVHA 4YRBA 5HKKD 2XWBF 4G36A 5BYKA 2PJZA 4H2DA 2F9LA 3DWFA 5U4QA 2QENA 3KHSA 1PBTA 1YS9A 2WJ4A 2DX7A 2YIJA 3K9NA 4RACA 5DM4A 1ARZA 1NXPA 1GGEA 2HKIA 2Y99A 3G5TA 3JWPA 1NQVA 4UVDA 4WXRA 3DEAA 3IJRA 1CJCA 3D2BA 1TVMA 3GIWA 2FUG1 4PAGA 4QLBA 1KZGB 4B5KA 2BUAA 2XGJA 2V6FA 3VPHA 2G82A 2GAAA 5A5EA 1J1ZA 4KU4A 3BHJA 2B1QA 4XM2A 1FNMA 1N5MA 1UL1X 4Z9AA 4AZ3A 5I7SA 1C1XA 1NU8A 4WK6A 4D3DA 4R51A 2I4RA 5C7YA 1NATA 1E3WB 1I3NA 2H2AA 3EPPA 3EVTA 4Y30A 5IJ0A 2IS6A 4QYMA 4ZYVA 4PPNA 1XTSA 3MHPA 5DP1A 1SU4A 2WMOB 1V7PC 2CXOA 2ZS8A 4UMFA 2X23A 5JNVA 1NONA 1PFWA 1T0JB 1T9BA 2A59A 2XB6A 5EJ2A 5FUMA 2JFZA 1P3JA 1C9EA 1JXQA 3RWMB 3THSA 3OU6A 5G40A 2QV7A 3FMFA 1VYVA 4KO4S 4H1VA 4IJMA 1TA0A 2BZGA 1V16B 1QP4A 1CRLA 4JKOA 4ZO8A 1SKUA 4CIDA 2WD9A 3KIPA 3GROA 5IZ4A 1TEZA 3CLKA 1UC4B 3OSUA 4I50B 5ED4A 1U6JA 1NMQA 3LO5A 3NTXA 3Q5GA 2AE1A 3ETHA 4G4SO 5M3BA 4YMVA 2OV6A 5ITWA 1KZ6A 2HEIA 5ALMA 3WV5A 1OX6A 2BMDA 4MHTA 4TKVB 2X14A 3EA5A 3JWEA 4IIYA 4BZPA 4IQ4A 3IUJA 1ZN2A 4PGGA 4BRZA 1H8ED 3BCHA 3IP5A 3LQRA 5HKLA 1PSDA 3TD6A 3D6NB 4A0SA 1A98A 3EK2A 1ZCBA 3OOYA 5DP2A 5BT9A 3K9WA 2AUMA 5G1NA 5K3CA 2XMQA 1ZH8A 1GL6A 1K7CA 3K2QA 4RDHA 2PV0A 3DCNA 4BVHA 2QLLA 4NK4A 1NU6A 3PVSA 5AUNB 5JDCC 2OGTA 1UMBA 1YRHA 3N05A 3BHMA 1R2QA 5CNKA 3SLKA 1KJIA 2JCSA 2QRPA 4TSFD 4UHBA 3MF4A 5E6UB 5C0OE 4BQEA 4XRGA 4DDVA 1T34A 3IJPA 2FDRA 4MKGA 2WUEA 2RD2A 1ECGA 4P92A 1M10A 2QZPA 1GVHA