3CGZA

Crystal structure of salmonella sensor kinase phoq catalytic domain
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
157
structure length
143
Chain Sequence
b'SVLLSRELHPVAPLLDNLISALNKVYQRKGVNISMDISPEISFVGEQNDFVEVMGNVLDNACKYCLEFVEISARQTDDHLHIFVEDDGPGIPHTLRPGQGVGLAVAREITEQYAGQIIASDSLLGGARMEVVFGRQHPTQKEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Virulence sensor histidine kinase phoQ
publication title The Hsp90 inhibitor radicicol interacts with the ATP-binding pocket of bacterial sensor kinase PhoQ.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 36
structure length 143
sequence length 157
chains with identical sequence B, C
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3cgzA00
1KZNA 4E02A 3RLRA 4W7TA 3HYYA 2HKJA 1UYKA 3CRKA 2BU2A 3QTFA 1Y4UA 1YC3A 2IWXA 2ESAA 2YEGA 2CCUA 5IDJA 1S14A 2YEEA 3R92A 4EEHA 2ZKJA 3OMUA 2Q8GA 4O04A 3R4MA 2ZBKB 4EFUA 5M4PA 5FNCA 4NH7A 1UYGA 4XC0A 2YE4A 4CE1A 1I5DA 2YEHA 2XHTA 1AM1A 3PEHA 3A0YA 4HXZA 2BU5A 4V26A 3D36A 2BTZA 3FT8A 1AJ6A 4GFNA 2XJGA 4NH8A 2VCIA 3KE6A 1MX0A 3B27A 2XX5A 3WQ9A 3A0WA 4MB9A 1YT1A 2XJJA 1THNA 1UYIA 1BGQA 1Y4SA 1U2OA 4GGLA 3RLPA 4LWIA 3G7EA 3K97A 4XCLA 2O1WA 2WI1A 4E00A 2CG9A 2AKPA 4YKYA 3INXA 4P8OA 3G75A 3BMYA 4CE2A 2O1VA 4ASAA 2E0AA 4BQJA 1ZXMA 3A0TA 4CWFA 3VHAA 1AMWA 2BYHA 3OW6A 4YKZA 2YE3A 4ZKIA 4YKTA 5C93A 4X9LA 1YESA 5J6AA 1YS3A 2YE8A 2CCSA 2XX2A 5FWKA 2VCJA 4H7QA 5F5RA 4K4OA 3K60A 1A4HA 2UWDA 1NHHA 1Z59A 1TC0A 5D7DA 2BSMA 2YE2A 4KTNA 5GGZA 2XX4A 3DGEA 4MOTA 2YGEA 2XHRA 4U93A 3CWVA 2YEDA 2VWCA 2BYIA 2K5BA 4BIUA 4YKRA 1YT0A 4WUDA 4URLA 4ASBA 2CGFA 5M4KA 2YKIA 4R3MA 4CWTA 3T10A 1TBWA 3Q5JA 4HZ5A 1I5BA 2YJXA 4KQVA 4AS9A 2WI4A 3G7BA 2O1UA 4I5SA 1US7A 4HZ0A 4V25A 4XIQA 2C2AA 1UYFA 4XCJA 3EKOA 2YKEA 2BU8A 4MP7A 4PU9A 4QPKA 4WUBA 3GIEA 1B63A 2IWUA 2BU6A 3K98A 3TTZA 1BYQA 4HYPA 4DUHA 3A0XA 4ASFA 1AH8A 2WI2A 2XD6A 5M4EA 1Z5CA 1R62A 5CTYA 2YEJA 4YKQA 4XE2A 5M4MA 4HXWA 4PRXA 2HCHA 4CWQA 4BAEA 2WEQA 3EHGA 4GQTA 1I5AA 2Q8FA 1UY6A 3FT5A 4NH9A 2YKJA 4I3HA 3ZKDA 4DZYA 4CWPA 2YKCA 1UY9A 4O07A 2XDKA 4URMA 4XTJA 5J71A 5BODA 2QG0A 4U7NA 1UYDA 2YEFA 3TUHA 4E01A 2BT0A 3HZ5A 4XD8A 2FYPA 2YI6A 4AWQA 5IN9A 3R4PA 3GIFA 2YE6A 4GCZA 1UYHA 3A0ZA 4YKXA 2YEBA 1AH6A 4KSGA 2XK2A 2ZDXA 2IWSA 1UY7A 4LP0A 4PL9A 4JASA 4GT8A 5BOCA 2Q2EB 2YECA 3GIGB 2HG1A 5D6PA 3T1KA 4O0BA 2YEAA 3O0IA 4JQLA 5CPHA 1YERA 4EMVA 2FWZA 3ZKBA 2YGFA 4L94A 3ZM7A 3B26A 3D2RA 1UYLA 5F3KA 4YKUA 3EKRA 3PEJA 4ASGA 1YETA 4O05A 3HYZA 2YI5A 4JAUA 3OPDA 4BQGA 1Y8PA 2BREA 1ID0A 2BU7A 2EXLA 1NHJA 4L91A 3NMQA 4L93A 3H80A 3HZ1A 2JJCA 3C11A 3VHDA 4R3AA 4HYMA 4MP2A 4YKWA 4L8ZA 4U7OA 2FWYA 1Y8NA 4EM7A 4URNA 2PNRA 2IORA 1I59A 3U67A 2YEIA 3LNUA 1GJVA 4H85A 4KSHA 5FNDA 3EHJA 2FXSA 1UYMA 3WHAA 2WEPA 4XKOA 3INWA 3SL2A 1QY8A 2WI3A 3CGYA 5D6QA 1H7SA 2IOPA 4CE3A 1U0ZA 4JAVA 1EI1A 3HEKA 4CWOA 2GQPA 3IEDA 4AWOA 2YI0A 2QG2A 3CRLA 3Q5LA 4FCQA 4L90A 3TZ4A 2ZDYA 2XHXA 5CTWA 5M4NA 3TZ0A 1Y8OA 3D0BA 3H4LA 4BIZA 2XABA 3CGZA 3TZ5A 4QPJA 2QF6A 4LWGA 4KP4A 2H55A 4MPEA 3RLQA 1PVGA 2WI6A 1I5CA 4P7AA 2XDXA 3R4OA 3O2FA 3RKZA 4Q20A 2CH4A 2YKBA 1ZWHA 1QYEA 3EHFA 4EGHA 4XKAA 3FV5A 3B28A 4MPCA 4FMTA 4LWHA 3JZ3A 3B25A 4O09A 3GIGA 4B7PA 2YE9A 2YE5A 5L3JA 2JKIA 4WUCA 3QDDA 2YK9A 4CWRA 1UYEA 2XDLA 2WI7A 3OWBA 4AWPA 4XIRA 1B3QA 1BKNA 3U2DA 2XCMA 1YSRA 2XDSA 1YC4A 1KIJA 4B6CA 1TC6A 4PRVA 3OWDA 1YT2A 4MPNA 3LPSA 4H81A 1MU5A 1OSFA 4EGIA 5CTXA 1B62A 3MNRP 2Q8HA 3ZXQA 4XITA 1YC1A 2IOQA 4UROA 2H8MA 2QFOA 4FCPA 5M4HA 2YE7A 1TIDA 4XDMA 4EGKA 3K99A 1S16A 1ZW9A 5D7RA 3T0HA 1EA6A 5IDMA 2YGAA 3T2SA 5CTUA 1NHIA 1YSZA 1QZRA 4XKKA 4MBCA 2YJWA 4ZVIA 4FCRA 1H7UA 4LWEA 1I58A 4LPBA 5D7CA 3VADA 3U2KA 5CF0A 1GKXA 1TILA 2BRCA 1Z5AA 4KFGA 2VW5A 2BZ5A 1L0OA 2YI7A 3EHHA 4BXIA 3C0EA 2CCTA 3TZ2A 3VHCA 1GKZA 4CWSA 2XDUA 5FNFA 1JM6A 4XIPA 3O6OA 1Z5BA 3B24A 1ZXNA 3R91A 4R1FA 1BXDA 2GFDA 2YK2A 4HY6A 1UY8A 3HHUA 3Q5KA 3T0ZA 3ZXOA 4GEEA 4HY1A 2Q8IA 2XJXA 4EFTA 3BM9A 3R4NA 4FPPA 1TH8A 4LWFA 2WI5A 1UYCA 2WERA 4CWNA 3A0RA
chains in the Genus database with same CATH superfamily
1KZNA 4E02A 3RLRA 4W7TA 3HYYA 2HKJA 1UYKA 3CRKA 2BU2A 3QTFA 1Y4UA 1YC3A 2IWXA 2ESAA 2YEGA 2CCUA 5IDJA 1S14A 2YEEA 3R92A 4EEHA 2ZKJA 3OMUA 2Q8GA 4O04A 3R4MA 2ZBKB 4EFUA 5M4PA 5FNCA 4NH7A 1UYGA 4XC0A 2YE4A 4CE1A 1I5DA 2YEHA 2XHTA 1AM1A 3PEHA 3A0YA 4HXZA 2BU5A 4V26A 3D36A 2BTZA 3FT8A 1AJ6A 4GFNA 2XJGA 4NH8A 2VCIA 3KE6A 1MX0A 3B27A 2XX5A 3WQ9A 3A0WA 4MB9A 1YT1A 2XJJA 1THNA 1UYIA 1BGQA 1Y4SA 1U2OA 4GGLA 3RLPA 4LWIA 3G7EA 3K97A 4XCLA 2O1WA 2WI1A 4E00A 2CG9A 2AKPA 4YKYA 3INXA 4P8OA 3G75A 3BMYA 4CE2A 2O1VA 4ASAA 2E0AA 4BQJA 1ZXMA 3A0TA 4CWFA 3VHAA 1AMWA 2BYHA 3OW6A 4YKZA 2YE3A 4ZKIA 4YKTA 5C93A 4X9LA 1YESA 5J6AA 1YS3A 2YE8A 2CCSA 2XX2A 5FWKA 2VCJA 4H7QA 5F5RA 4K4OA 3K60A 1A4HA 2UWDA 1NHHA 1Z59A 1TC0A 5D7DA 2BSMA 2YE2A 4KTNA 5GGZA 2XX4A 3DGEA 4MOTA 2YGEA 2XHRA 4U93A 3CWVA 2YEDA 2VWCA 2BYIA 2K5BA 4BIUA 4YKRA 1YT0A 4WUDA 4URLA 4ASBA 2CGFA 5M4KA 2YKIA 4R3MA 4CWTA 3T10A 1TBWA 3Q5JA 4HZ5A 3CYGA 1IXMA 1I5BA 2YJXA 4KQVA 4AS9A 2WI4A 3G7BA 2O1UA 4I5SA 1US7A 4HZ0A 4V25A 4XIQA 2C2AA 1UYFA 4XCJA 3EKOA 2YKEA 2BU8A 4MP7A 4PU9A 4QPKA 4WUBA 3GIEA 1B63A 2IWUA 2BU6A 3K98A 3TTZA 1BYQA 4HYPA 4DUHA 3A0XA 4ASFA 1AH8A 2WI2A 2XD6A 5M4EA 1Z5CA 1R62A 5CTYA 2YEJA 4YKQA 4XE2A 5M4MA 4HXWA 4PRXA 2HCHA 4CWQA 4BAEA 2WEQA 3EHGA 4GQTA 1I5AA 2Q8FA 1UY6A 3FT5A 4NH9A 2YKJA 4I3HA 3ZKDA 4DZYA 4CWPA 2YKCA 1UY9A 4O07A 2XDKA 4URMA 4XTJA 5J71A 5BODA 2QG0A 4U7NA 1UYDA 2YEFA 3TUHA 4E01A 2BT0A 3HZ5A 4XD8A 2FYPA 2YI6A 4AWQA 5IN9A 3R4PA 3GIFA 2YE6A 4GCZA 1UYHA 3A0ZA 4YKXA 2YEBA 1AH6A 4KSGA 2XK2A 2ZDXA 2IWSA 1UY7A 4LP0A 4PL9A 4JASA 4GT8A 5BOCA 2Q2EB 2YECA 3GIGB 2HG1A 5D6PA 3T1KA 2C1GA 4O0BA 2YEAA 3O0IA 4JQLA 5CPHA 1YERA 4EMVA 2FWZA 3ZKBA 2YGFA 4L94A 3ZM7A 3B26A 3D2RA 1UYLA 5F3KA 4YKUA 3EKRA 3PEJA 4ASGA 1YETA 1F51A 4O05A 3HYZA 2YI5A 4JAUA 4E72A 3OPDA 3LMMA 4BQGA 1Y8PA 2BREA 1ID0A 2BU7A 2EXLA 1NHJA 4L91A 3NMQA 4L93A 3H80A 3HZ1A 2JJCA 3C11A 3VHDA 4R3AA 4HYMA 4MP2A 4YKWA 4L8ZA 4U7OA 2FWYA 1Y8NA 4EM7A 4URNA 2PNRA 2IORA 1I59A 3U67A 2YEIA 3LNUA 1GJVA 4H85A 4KSHA 5FNDA 3EHJA 2FXSA 1UYMA 3WHAA 2WEPA 4XKOA 3INWA 3SL2A 1QY8A 2WI3A 3CGYA 5D6QA 1H7SA 2IOPA 4CE3A 1U0ZA 4JAVA 1EI1A 3HEKA 4CWOA 2GQPA 3IEDA 4AWOA 2YI0A 2QG2A 3CRLA 3Q5LA 4FCQA 4L90A 3TZ4A 5JENA 2ZDYA 2XHXA 5CTWA 5M4NA 3TZ0A 1Y8OA 3D0BA 3H4LA 4BIZA 2XABA 3CGZA 3TZ5A 4QPJA 2QF6A 4LWGA 4KP4A 2H55A 4MPEA 3RLQA 1PVGA 2WI6A 1I5CA 4P7AA 2XDXA 3R4OA 3O2FA 3RKZA 4Q20A 2CH4A 2YKBA 1ZWHA 1QYEA 3EHFA 4EGHA 4XKAA 3FV5A 3B28A 4MPCA 4FMTA 4LWHA 3S5TA 3JZ3A 3B25A 4O09A 3GIGA 4B7PA 2YE9A 2YE5A 5L3JA 2JKIA 4WUCA 3QDDA 2YK9A 4CWRA 1UYEA 2XDLA 2WI7A 3OWBA 4AWPA 4XIRA 1B3QA 1BKNA 3U2DA 2XCMA 1YSRA 2XDSA 1YC4A 1KIJA 4B6CA 1TC6A 4PRVA 3OWDA 1YT2A 4MPNA 3LPSA 4H81A 1MU5A 1OSFA 4EGIA 5CTXA 1B62A 3MNRP 2Q8HA 3ZXQA 4XITA 2C1IA 1YC1A 2IOQA 4UROA 2H8MA 2QFOA 4FCPA 2HHIA 2YE7A 5M4HA 1TIDA 4XDMA 4EGKA 3K99A 1S16A 1ZW9A 5D7RA 3T0HA 1EA6A 5IDMA 2YGAA 3T2SA 5CTUA 1NHIA 1YSZA 1QZRA 4XKKA 4MBCA 2YJWA 4ZVIA 4FCRA 1H7UA 4LWEA 1I58A 4LPBA 5D7CA 3VADA 3U2KA 5CF0A 1GKXA 1TILA 2BRCA 1Z5AA 4KFGA 2VW5A 2BZ5A 1L0OA 2YI7A 3EHHA 4BXIA 3C0EA 2CCTA 3TZ2A 3VHCA 1GKZA 4CWSA 2XDUA 5FNFA 1JM6A 4XIPA 3O6OA 1Z5BA 3B24A 1ZXNA 3R91A 4R1FA 1BXDA 2GFDA 2YK2A 4HY6A 1UY8A 3HHUA 3Q5KA 3T0ZA 3ZXOA 4GEEA 4HY1A 2FTKA 2XJXA 2Q8IA 4EFTA 3BM9A 3R4NA 4FPPA 1TH8A 4LWFA 2WI5A 1UYCA 2WERA 4CWNA 3A0RA
chains in the Genus database with same CATH topology
1KZNA 4E02A 3RLRA 4W7TA 3HYYA 2HKJA 1UYKA 3CRKA 2BU2A 3QTFA 1Y4UA 1YC3A 2IWXA 2ESAA 2YEGA 2CCUA 5IDJA 1S14A 2YEEA 3R92A 4EEHA 2ZKJA 3OMUA 2Q8GA 4O04A 3R4MA 2ZBKB 4EFUA 5M4PA 5FNCA 4NH7A 1UYGA 4XC0A 2YE4A 4CE1A 1I5DA 2YEHA 2XHTA 1AM1A 3PEHA 3A0YA 4HXZA 2BU5A 4V26A 3D36A 2BTZA 3FT8A 1AJ6A 4GFNA 2XJGA 4NH8A 2VCIA 3KE6A 1MX0A 3B27A 2XX5A 3WQ9A 3A0WA 4MB9A 1YT1A 2XJJA 1THNA 1UYIA 1BGQA 1Y4SA 1U2OA 4GGLA 3RLPA 4LWIA 3G7EA 3K97A 4XCLA 2O1WA 2WI1A 4E00A 2CG9A 2AKPA 4YKYA 3INXA 4P8OA 3G75A 3BMYA 4CE2A 2O1VA 4ASAA 2E0AA 4BQJA 1ZXMA 3A0TA 4CWFA 3VHAA 1AMWA 2BYHA 3OW6A 4YKZA 2YE3A 4ZKIA 4YKTA 5C93A 4X9LA 1YESA 5J6AA 1YS3A 2YE8A 2CCSA 2XX2A 5FWKA 2VCJA 4H7QA 5F5RA 4K4OA 3K60A 1A4HA 2UWDA 1NHHA 1Z59A 1TC0A 5D7DA 2BSMA 2YE2A 4KTNA 5GGZA 2XX4A 3DGEA 4MOTA 2YGEA 2XHRA 4U93A 3CWVA 2YEDA 2VWCA 2BYIA 2K5BA 4BIUA 4YKRA 1YT0A 4WUDA 4URLA 4ASBA 2CGFA 5M4KA 2YKIA 4R3MA 4CWTA 3T10A 1TBWA 3Q5JA 4HZ5A 1I5BA 2YJXA 4KQVA 4AS9A 2WI4A 3G7BA 2O1UA 4I5SA 1US7A 4HZ0A 4V25A 4XIQA 2C2AA 1UYFA 4XCJA 3EKOA 2YKEA 2BU8A 4MP7A 4PU9A 4QPKA 4WUBA 3GIEA 1B63A 2IWUA 2BU6A 3K98A 3TTZA 1BYQA 4HYPA 4DUHA 3A0XA 4ASFA 1AH8A 2WI2A 2XD6A 5M4EA 1Z5CA 1R62A 5CTYA 2YEJA 4YKQA 4XE2A 5M4MA 4HXWA 4PRXA 2HCHA 4CWQA 4BAEA 2WEQA 3EHGA 4GQTA 1I5AA 2Q8FA 1UY6A 3FT5A 4NH9A 2YKJA 4I3HA 3ZKDA 4DZYA 4CWPA 2YKCA 1UY9A 4O07A 2XDKA 4URMA 4XTJA 5J71A 5BODA 2QG0A 4U7NA 1UYDA 2YEFA 3TUHA 4E01A 2BT0A 3HZ5A 4XD8A 2FYPA 2YI6A 4AWQA 5IN9A 3R4PA 3GIFA 2YE6A 4GCZA 1UYHA 3A0ZA 4YKXA 2YEBA 1AH6A 4KSGA 2XK2A 2ZDXA 2IWSA 1UY7A 4LP0A 4PL9A 4JASA 4GT8A 5BOCA 2Q2EB 2YECA 3GIGB 2HG1A 5D6PA 3T1KA 4O0BA 2YEAA 3O0IA 4JQLA 5CPHA 1YERA 4EMVA 2FWZA 3ZKBA 2YGFA 4L94A 3ZM7A 3B26A 3D2RA 1UYLA 5F3KA 4YKUA 3EKRA 3PEJA 4ASGA 1YETA 4O05A 3HYZA 2YI5A 4JAUA 3OPDA 4BQGA 1Y8PA 2BREA 1ID0A 2BU7A 2EXLA 1NHJA 4L91A 3NMQA 4L93A 3H80A 3HZ1A 2JJCA 3C11A 3VHDA 4R3AA 4HYMA 4MP2A 4YKWA 4L8ZA 4U7OA 2FWYA 1Y8NA 4EM7A 4URNA 2PNRA 2IORA 1I59A 3U67A 2YEIA 3LNUA 1GJVA 4H85A 4KSHA 5FNDA 3EHJA 2FXSA 1UYMA 3WHAA 2WEPA 4XKOA 3INWA 3SL2A 1QY8A 2WI3A 3CGYA 5D6QA 1H7SA 2IOPA 4CE3A 1U0ZA 4JAVA 1EI1A 3HEKA 4CWOA 2GQPA 3IEDA 4AWOA 2YI0A 2QG2A 3CRLA 3Q5LA 4FCQA 4L90A 3TZ4A 2ZDYA 2XHXA 5CTWA 5M4NA 3TZ0A 1Y8OA 3D0BA 3H4LA 4BIZA 2XABA 3CGZA 3TZ5A 4QPJA 2QF6A 4LWGA 4KP4A 2H55A 4MPEA 3RLQA 1PVGA 2WI6A 1I5CA 4P7AA 2XDXA 3R4OA 3O2FA 3RKZA 4Q20A 2CH4A 2YKBA 1ZWHA 1QYEA 3EHFA 4EGHA 4XKAA 3FV5A 3B28A 4MPCA 4FMTA 4LWHA 3JZ3A 3B25A 4O09A 3GIGA 4B7PA 2YE9A 2YE5A 5L3JA 2JKIA 4WUCA 3QDDA 2YK9A 4CWRA 1UYEA 2XDLA 2WI7A 3OWBA 4AWPA 4XIRA 1B3QA 1BKNA 3U2DA 2XCMA 1YSRA 2XDSA 1YC4A 1KIJA 4B6CA 1TC6A 4PRVA 3OWDA 1YT2A 4MPNA 3LPSA 4H81A 1MU5A 1OSFA 4EGIA 5CTXA 1B62A 3MNRP 2Q8HA 3ZXQA 4XITA 1YC1A 2IOQA 4UROA 2H8MA 2QFOA 4FCPA 5M4HA 2YE7A 1TIDA 4XDMA 4EGKA 3K99A 1S16A 1ZW9A 5D7RA 3T0HA 1EA6A 5IDMA 2YGAA 3T2SA 5CTUA 1NHIA 1YSZA 1QZRA 4XKKA 4MBCA 2YJWA 4ZVIA 4FCRA 1H7UA 4LWEA 1I58A 4LPBA 5D7CA 3VADA 3U2KA 5CF0A 1GKXA 1TILA 2BRCA 1Z5AA 4KFGA 2VW5A 2BZ5A 1L0OA 2YI7A 3EHHA 4BXIA 3C0EA 2CCTA 3TZ2A 3VHCA 1GKZA 4CWSA 2XDUA 5FNFA 1JM6A 4XIPA 3O6OA 1Z5BA 3B24A 1ZXNA 3R91A 4R1FA 1BXDA 2GFDA 2YK2A 4HY6A 1UY8A 3HHUA 3Q5KA 3T0ZA 3ZXOA 4GEEA 4HY1A 2Q8IA 2XJXA 4EFTA 3BM9A 3R4NA 4FPPA 1TH8A 4LWFA 2WI5A 1UYCA 2WERA 4CWNA 3A0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KZN A;  4E02 A;  3RLR A;  4W7T A;  3HYY A;  2HKJ A;  1UYK A;  3CRK A;  2BU2 A;  3QTF A;  1Y4U A;  1YC3 A;  2IWX A;  2ESA A;  2YEG A;  2CCU A;  5IDJ A;  1S14 A;  2YEE A;  3R92 A;  4EEH A;  2ZKJ A;  3OMU A;  2Q8G A;  4O04 A;  3R4M A;  2ZBK B;  4EFU A;  5M4P A;  5FNC A;  4NH7 A;  1UYG A;  4XC0 A;  2YE4 A;  4CE1 A;  1I5D A;  2YEH A;  2XHT A;  1AM1 A;  3PEH A;  3A0Y A;  4HXZ A;  2BU5 A;  4V26 A;  3D36 A;  2BTZ A;  3FT8 A;  1AJ6 A;  4GFN A;  2XJG A;  4NH8 A;  2VCI A;  3KE6 A;  1MX0 A;  3B27 A;  2XX5 A;  3WQ9 A;  3A0W A;  4MB9 A;  1YT1 A;  2XJJ A;  1THN A;  1UYI A;  1BGQ A;  1Y4S A;  1U2O A;  4GGL A;  3RLP A;  4LWI A;  3G7E A;  3K97 A;  4XCL A;  2O1W A;  2WI1 A;  4E00 A;  2CG9 A;  2AKP A;  4YKY A;  3INX A;  4P8O A;  3G75 A;  3BMY A;  4CE2 A;  2O1V A;  4ASA A;  2E0A A;  4BQJ A;  1ZXM A;  3A0T A;  4CWF A;  3VHA A;  1AMW A;  2BYH A;  3OW6 A;  4YKZ A;  2YE3 A;  4ZKI A;  4YKT A;  5C93 A;  4X9L A;  1YES A;  5J6A A;  1YS3 A;  2YE8 A;  2CCS A;  2XX2 A;  5FWK A;  2VCJ A;  4H7Q A;  5F5R A;  4K4O A;  3K60 A;  1A4H A;  2UWD A;  1NHH A;  1Z59 A;  1TC0 A;  5D7D A;  2BSM A;  2YE2 A;  4KTN A;  5GGZ A;  2XX4 A;  3DGE A;  4MOT A;  2YGE A;  2XHR A;  4U93 A;  3CWV A;  2YED A;  2VWC A;  2BYI A;  2K5B A;  4BIU A;  4YKR A;  1YT0 A;  4WUD A;  4URL A;  4ASB A;  2CGF A;  5M4K A;  2YKI A;  4R3M A;  4CWT A;  3T10 A;  1TBW A;  3Q5J A;  4HZ5 A;  1I5B A;  2YJX A;  4KQV A;  4AS9 A;  2WI4 A;  3G7B A;  2O1U A;  4I5S A;  1US7 A;  4HZ0 A;  4V25 A;  4XIQ A;  2C2A A;  1UYF A;  4XCJ A;  3EKO A;  2YKE A;  2BU8 A;  4MP7 A;  4PU9 A;  4QPK A;  4WUB A;  3GIE A;  1B63 A;  2IWU A;  2BU6 A;  3K98 A;  3TTZ A;  1BYQ A;  4HYP A;  4DUH A;  3A0X A;  4ASF A;  1AH8 A;  2WI2 A;  2XD6 A;  5M4E A;  1Z5C A;  1R62 A;  5CTY A;  2YEJ A;  4YKQ A;  4XE2 A;  5M4M A;  4HXW A;  4PRX A;  2HCH A;  4CWQ A;  4BAE A;  2WEQ A;  3EHG A;  4GQT A;  1I5A A;  2Q8F A;  1UY6 A;  3FT5 A;  4NH9 A;  2YKJ A;  4I3H A;  3ZKD A;  4DZY A;  4CWP A;  2YKC A;  1UY9 A;  4O07 A;  2XDK A;  4URM A;  4XTJ A;  5J71 A;  5BOD A;  2QG0 A;  4U7N A;  1UYD A;  2YEF A;  3TUH A;  4E01 A;  2BT0 A;  3HZ5 A;  4XD8 A;  2FYP A;  2YI6 A;  4AWQ A;  5IN9 A;  3R4P A;  3GIF A;  2YE6 A;  4GCZ A;  1UYH A;  3A0Z A;  4YKX A;  2YEB A;  1AH6 A;  4KSG A;  2XK2 A;  2ZDX A;  2IWS A;  1UY7 A;  4LP0 A;  4PL9 A;  4JAS A;  4GT8 A;  5BOC A;  2Q2E B;  2YEC A;  3GIG B;  2HG1 A;  5D6P A;  3T1K A;  4O0B A;  2YEA A;  3O0I A;  4JQL A;  5CPH A;  1YER A;  4EMV A;  2FWZ A;  3ZKB A;  2YGF A;  4L94 A;  3ZM7 A;  3B26 A;  3D2R A;  1UYL A;  5F3K A;  4YKU A;  3EKR A;  3PEJ A;  4ASG A;  1YET A;  4O05 A;  3HYZ A;  2YI5 A;  4JAU A;  3OPD A;  4BQG A;  1Y8P A;  2BRE A;  1ID0 A;  2BU7 A;  2EXL A;  1NHJ A;  4L91 A;  3NMQ A;  4L93 A;  3H80 A;  3HZ1 A;  2JJC A;  3C11 A;  3VHD A;  4R3A A;  4HYM A;  4MP2 A;  4YKW A;  4L8Z A;  4U7O A;  2FWY A;  1Y8N A;  4EM7 A;  4URN A;  2PNR A;  2IOR A;  1I59 A;  3U67 A;  2YEI A;  3LNU A;  1GJV A;  4H85 A;  4KSH A;  5FND A;  3EHJ A;  2FXS A;  1UYM A;  3WHA A;  2WEP A;  4XKO A;  3INW A;  3SL2 A;  1QY8 A;  2WI3 A;  3CGY A;  5D6Q A;  1H7S A;  2IOP A;  4CE3 A;  1U0Z A;  4JAV A;  1EI1 A;  3HEK A;  4CWO A;  2GQP A;  3IED A;  4AWO A;  2YI0 A;  2QG2 A;  3CRL A;  3Q5L A;  4FCQ A;  4L90 A;  3TZ4 A;  2ZDY A;  2XHX A;  5CTW A;  5M4N A;  3TZ0 A;  1Y8O A;  3D0B A;  3H4L A;  4BIZ A;  2XAB A;  3CGZ A;  3TZ5 A;  4QPJ A;  2QF6 A;  4LWG A;  4KP4 A;  2H55 A;  4MPE A;  3RLQ A;  1PVG A;  2WI6 A;  1I5C A;  4P7A A;  2XDX A;  3R4O A;  3O2F A;  3RKZ A;  4Q20 A;  2CH4 A;  2YKB A;  1ZWH A;  1QYE A;  3EHF A;  4EGH A;  4XKA A;  3FV5 A;  3B28 A;  4MPC A;  4FMT A;  4LWH A;  3JZ3 A;  3B25 A;  4O09 A;  3GIG A;  4B7P A;  2YE9 A;  2YE5 A;  5L3J A;  2JKI A;  4WUC A;  3QDD A;  2YK9 A;  4CWR A;  1UYE A;  2XDL A;  2WI7 A;  3OWB A;  4AWP A;  4XIR A;  1B3Q A;  1BKN A;  3U2D A;  2XCM A;  1YSR A;  2XDS A;  1YC4 A;  1KIJ A;  4B6C A;  1TC6 A;  4PRV A;  3OWD A;  1YT2 A;  4MPN A;  3LPS A;  4H81 A;  1MU5 A;  1OSF A;  4EGI A;  5CTX A;  1B62 A;  3MNR P;  2Q8H A;  3ZXQ A;  4XIT A;  1YC1 A;  2IOQ A;  4URO A;  2H8M A;  2QFO A;  4FCP A;  5M4H A;  2YE7 A;  1TID A;  4XDM A;  4EGK A;  3K99 A;  1S16 A;  1ZW9 A;  5D7R A;  3T0H A;  1EA6 A;  5IDM A;  2YGA A;  3T2S A;  5CTU A;  1NHI A;  1YSZ A;  1QZR A;  4XKK A;  4MBC A;  2YJW A;  4ZVI A;  4FCR A;  1H7U A;  4LWE A;  1I58 A;  4LPB A;  5D7C A;  3VAD A;  3U2K A;  5CF0 A;  1GKX A;  1TIL A;  2BRC A;  1Z5A A;  4KFG A;  2VW5 A;  2BZ5 A;  1L0O A;  2YI7 A;  3EHH A;  4BXI A;  3C0E A;  2CCT A;  3TZ2 A;  3VHC A;  1GKZ A;  4CWS A;  2XDU A;  5FNF A;  1JM6 A;  4XIP A;  3O6O A;  1Z5B A;  3B24 A;  1ZXN A;  3R91 A;  4R1F A;  1BXD A;  2GFD A;  2YK2 A;  4HY6 A;  1UY8 A;  3HHU A;  3Q5K A;  3T0Z A;  3ZXO A;  4GEE A;  4HY1 A;  2Q8I A;  2XJX A;  4EFT A;  3BM9 A;  3R4N A;  4FPP A;  1TH8 A;  4LWF A;  2WI5 A;  1UYC A;  2WER A;  4CWN A;  3A0R A; 
#chains in the Genus database with same CATH topology
 1KZN A;  4E02 A;  3RLR A;  4W7T A;  3HYY A;  2HKJ A;  1UYK A;  3CRK A;  2BU2 A;  3QTF A;  1Y4U A;  1YC3 A;  2IWX A;  2ESA A;  2YEG A;  2CCU A;  5IDJ A;  1S14 A;  2YEE A;  3R92 A;  4EEH A;  2ZKJ A;  3OMU A;  2Q8G A;  4O04 A;  3R4M A;  2ZBK B;  4EFU A;  5M4P A;  5FNC A;  4NH7 A;  1UYG A;  4XC0 A;  2YE4 A;  4CE1 A;  1I5D A;  2YEH A;  2XHT A;  1AM1 A;  3PEH A;  3A0Y A;  4HXZ A;  2BU5 A;  4V26 A;  3D36 A;  2BTZ A;  3FT8 A;  1AJ6 A;  4GFN A;  2XJG A;  4NH8 A;  2VCI A;  3KE6 A;  1MX0 A;  3B27 A;  2XX5 A;  3WQ9 A;  3A0W A;  4MB9 A;  1YT1 A;  2XJJ A;  1THN A;  1UYI A;  1BGQ A;  1Y4S A;  1U2O A;  4GGL A;  3RLP A;  4LWI A;  3G7E A;  3K97 A;  4XCL A;  2O1W A;  2WI1 A;  4E00 A;  2CG9 A;  2AKP A;  4YKY A;  3INX A;  4P8O A;  3G75 A;  3BMY A;  4CE2 A;  2O1V A;  4ASA A;  2E0A A;  4BQJ A;  1ZXM A;  3A0T A;  4CWF A;  3VHA A;  1AMW A;  2BYH A;  3OW6 A;  4YKZ A;  2YE3 A;  4ZKI A;  4YKT A;  5C93 A;  4X9L A;  1YES A;  5J6A A;  1YS3 A;  2YE8 A;  2CCS A;  2XX2 A;  5FWK A;  2VCJ A;  4H7Q A;  5F5R A;  4K4O A;  3K60 A;  1A4H A;  2UWD A;  1NHH A;  1Z59 A;  1TC0 A;  5D7D A;  2BSM A;  2YE2 A;  4KTN A;  5GGZ A;  2XX4 A;  3DGE A;  4MOT A;  2YGE A;  2XHR A;  4U93 A;  3CWV A;  2YED A;  2VWC A;  2BYI A;  2K5B A;  4BIU A;  4YKR A;  1YT0 A;  4WUD A;  4URL A;  4ASB A;  2CGF A;  5M4K A;  2YKI A;  4R3M A;  4CWT A;  3T10 A;  1TBW A;  3Q5J A;  4HZ5 A;  3CYG A;  1IXM A;  1I5B A;  2YJX A;  4KQV A;  4AS9 A;  2WI4 A;  3G7B A;  2O1U A;  4I5S A;  1US7 A;  4HZ0 A;  4V25 A;  4XIQ A;  2C2A A;  1UYF A;  4XCJ A;  3EKO A;  2YKE A;  2BU8 A;  4MP7 A;  4PU9 A;  4QPK A;  4WUB A;  3GIE A;  1B63 A;  2IWU A;  2BU6 A;  3K98 A;  3TTZ A;  1BYQ A;  4HYP A;  4DUH A;  3A0X A;  4ASF A;  1AH8 A;  2WI2 A;  2XD6 A;  5M4E A;  1Z5C A;  1R62 A;  5CTY A;  2YEJ A;  4YKQ A;  4XE2 A;  5M4M A;  4HXW A;  4PRX A;  2HCH A;  4CWQ A;  4BAE A;  2WEQ A;  3EHG A;  4GQT A;  1I5A A;  2Q8F A;  1UY6 A;  3FT5 A;  4NH9 A;  2YKJ A;  4I3H A;  3ZKD A;  4DZY A;  4CWP A;  2YKC A;  1UY9 A;  4O07 A;  2XDK A;  4URM A;  4XTJ A;  5J71 A;  5BOD A;  2QG0 A;  4U7N A;  1UYD A;  2YEF A;  3TUH A;  4E01 A;  2BT0 A;  3HZ5 A;  4XD8 A;  2FYP A;  2YI6 A;  4AWQ A;  5IN9 A;  3R4P A;  3GIF A;  2YE6 A;  4GCZ A;  1UYH A;  3A0Z A;  4YKX A;  2YEB A;  1AH6 A;  4KSG A;  2XK2 A;  2ZDX A;  2IWS A;  1UY7 A;  4LP0 A;  4PL9 A;  4JAS A;  4GT8 A;  5BOC A;  2Q2E B;  2YEC A;  3GIG B;  2HG1 A;  5D6P A;  3T1K A;  2C1G A;  4O0B A;  2YEA A;  3O0I A;  4JQL A;  5CPH A;  1YER A;  4EMV A;  2FWZ A;  3ZKB A;  2YGF A;  4L94 A;  3ZM7 A;  3B26 A;  3D2R A;  1UYL A;  5F3K A;  4YKU A;  3EKR A;  3PEJ A;  4ASG A;  1YET A;  1F51 A;  4O05 A;  3HYZ A;  2YI5 A;  4JAU A;  4E72 A;  3OPD A;  3LMM A;  4BQG A;  1Y8P A;  2BRE A;  1ID0 A;  2BU7 A;  2EXL A;  1NHJ A;  4L91 A;  3NMQ A;  4L93 A;  3H80 A;  3HZ1 A;  2JJC A;  3C11 A;  3VHD A;  4R3A A;  4HYM A;  4MP2 A;  4YKW A;  4L8Z A;  4U7O A;  2FWY A;  1Y8N A;  4EM7 A;  4URN A;  2PNR A;  2IOR A;  1I59 A;  3U67 A;  2YEI A;  3LNU A;  1GJV A;  4H85 A;  4KSH A;  5FND A;  3EHJ A;  2FXS A;  1UYM A;  3WHA A;  2WEP A;  4XKO A;  3INW A;  3SL2 A;  1QY8 A;  2WI3 A;  3CGY A;  5D6Q A;  1H7S A;  2IOP A;  4CE3 A;  1U0Z A;  4JAV A;  1EI1 A;  3HEK A;  4CWO A;  2GQP A;  3IED A;  4AWO A;  2YI0 A;  2QG2 A;  3CRL A;  3Q5L A;  4FCQ A;  4L90 A;  3TZ4 A;  5JEN A;  2ZDY A;  2XHX A;  5CTW A;  5M4N A;  3TZ0 A;  1Y8O A;  3D0B A;  3H4L A;  4BIZ A;  2XAB A;  3CGZ A;  3TZ5 A;  4QPJ A;  2QF6 A;  4LWG A;  4KP4 A;  2H55 A;  4MPE A;  3RLQ A;  1PVG A;  2WI6 A;  1I5C A;  4P7A A;  2XDX A;  3R4O A;  3O2F A;  3RKZ A;  4Q20 A;  2CH4 A;  2YKB A;  1ZWH A;  1QYE A;  3EHF A;  4EGH A;  4XKA A;  3FV5 A;  3B28 A;  4MPC A;  4FMT A;  4LWH A;  3S5T A;  3JZ3 A;  3B25 A;  4O09 A;  3GIG A;  4B7P A;  2YE9 A;  2YE5 A;  5L3J A;  2JKI A;  4WUC A;  3QDD A;  2YK9 A;  4CWR A;  1UYE A;  2XDL A;  2WI7 A;  3OWB A;  4AWP A;  4XIR A;  1B3Q A;  1BKN A;  3U2D A;  2XCM A;  1YSR A;  2XDS A;  1YC4 A;  1KIJ A;  4B6C A;  1TC6 A;  4PRV A;  3OWD A;  1YT2 A;  4MPN A;  3LPS A;  4H81 A;  1MU5 A;  1OSF A;  4EGI A;  5CTX A;  1B62 A;  3MNR P;  2Q8H A;  3ZXQ A;  4XIT A;  2C1I A;  1YC1 A;  2IOQ A;  4URO A;  2H8M A;  2QFO A;  4FCP A;  2HHI A;  2YE7 A;  5M4H A;  1TID A;  4XDM A;  4EGK A;  3K99 A;  1S16 A;  1ZW9 A;  5D7R A;  3T0H A;  1EA6 A;  5IDM A;  2YGA A;  3T2S A;  5CTU A;  1NHI A;  1YSZ A;  1QZR A;  4XKK A;  4MBC A;  2YJW A;  4ZVI A;  4FCR A;  1H7U A;  4LWE A;  1I58 A;  4LPB A;  5D7C A;  3VAD A;  3U2K A;  5CF0 A;  1GKX A;  1TIL A;  2BRC A;  1Z5A A;  4KFG A;  2VW5 A;  2BZ5 A;  1L0O A;  2YI7 A;  3EHH A;  4BXI A;  3C0E A;  2CCT A;  3TZ2 A;  3VHC A;  1GKZ A;  4CWS A;  2XDU A;  5FNF A;  1JM6 A;  4XIP A;  3O6O A;  1Z5B A;  3B24 A;  1ZXN A;  3R91 A;  4R1F A;  1BXD A;  2GFD A;  2YK2 A;  4HY6 A;  1UY8 A;  3HHU A;  3Q5K A;  3T0Z A;  3ZXO A;  4GEE A;  4HY1 A;  2FTK A;  2XJX A;  2Q8I A;  4EFT A;  3BM9 A;  3R4N A;  4FPP A;  1TH8 A;  4LWF A;  2WI5 A;  1UYC A;  2WER A;  4CWN A;  3A0R A; 
#chains in the Genus database with same CATH homology
 1KZN A;  4E02 A;  3RLR A;  4W7T A;  3HYY A;  2HKJ A;  1UYK A;  3CRK A;  2BU2 A;  3QTF A;  1Y4U A;  1YC3 A;  2IWX A;  2ESA A;  2YEG A;  2CCU A;  5IDJ A;  1S14 A;  2YEE A;  3R92 A;  4EEH A;  2ZKJ A;  3OMU A;  2Q8G A;  4O04 A;  3R4M A;  2ZBK B;  4EFU A;  5M4P A;  5FNC A;  4NH7 A;  1UYG A;  4XC0 A;  2YE4 A;  4CE1 A;  1I5D A;  2YEH A;  2XHT A;  1AM1 A;  3PEH A;  3A0Y A;  4HXZ A;  2BU5 A;  4V26 A;  3D36 A;  2BTZ A;  3FT8 A;  1AJ6 A;  4GFN A;  2XJG A;  4NH8 A;  2VCI A;  3KE6 A;  1MX0 A;  3B27 A;  2XX5 A;  3WQ9 A;  3A0W A;  4MB9 A;  1YT1 A;  2XJJ A;  1THN A;  1UYI A;  1BGQ A;  1Y4S A;  1U2O A;  4GGL A;  3RLP A;  4LWI A;  3G7E A;  3K97 A;  4XCL A;  2O1W A;  2WI1 A;  4E00 A;  2CG9 A;  2AKP A;  4YKY A;  3INX A;  4P8O A;  3G75 A;  3BMY A;  4CE2 A;  2O1V A;  4ASA A;  2E0A A;  4BQJ A;  1ZXM A;  3A0T A;  4CWF A;  3VHA A;  1AMW A;  2BYH A;  3OW6 A;  4YKZ A;  2YE3 A;  4ZKI A;  4YKT A;  5C93 A;  4X9L A;  1YES A;  5J6A A;  1YS3 A;  2YE8 A;  2CCS A;  2XX2 A;  5FWK A;  2VCJ A;  4H7Q A;  5F5R A;  4K4O A;  3K60 A;  1A4H A;  2UWD A;  1NHH A;  1Z59 A;  1TC0 A;  5D7D A;  2BSM A;  2YE2 A;  4KTN A;  5GGZ A;  2XX4 A;  3DGE A;  4MOT A;  2YGE A;  2XHR A;  4U93 A;  3CWV A;  2YED A;  2VWC A;  2BYI A;  2K5B A;  4BIU A;  4YKR A;  1YT0 A;  4WUD A;  4URL A;  4ASB A;  2CGF A;  5M4K A;  2YKI A;  4R3M A;  4CWT A;  3T10 A;  1TBW A;  3Q5J A;  4HZ5 A;  1I5B A;  2YJX A;  4KQV A;  4AS9 A;  2WI4 A;  3G7B A;  2O1U A;  4I5S A;  1US7 A;  4HZ0 A;  4V25 A;  4XIQ A;  2C2A A;  1UYF A;  4XCJ A;  3EKO A;  2YKE A;  2BU8 A;  4MP7 A;  4PU9 A;  4QPK A;  4WUB A;  3GIE A;  1B63 A;  2IWU A;  2BU6 A;  3K98 A;  3TTZ A;  1BYQ A;  4HYP A;  4DUH A;  3A0X A;  4ASF A;  1AH8 A;  2WI2 A;  2XD6 A;  5M4E A;  1Z5C A;  1R62 A;  5CTY A;  2YEJ A;  4YKQ A;  4XE2 A;  5M4M A;  4HXW A;  4PRX A;  2HCH A;  4CWQ A;  4BAE A;  2WEQ A;  3EHG A;  4GQT A;  1I5A A;  2Q8F A;  1UY6 A;  3FT5 A;  4NH9 A;  2YKJ A;  4I3H A;  3ZKD A;  4DZY A;  4CWP A;  2YKC A;  1UY9 A;  4O07 A;  2XDK A;  4URM A;  4XTJ A;  5J71 A;  5BOD A;  2QG0 A;  4U7N A;  1UYD A;  2YEF A;  3TUH A;  4E01 A;  2BT0 A;  3HZ5 A;  4XD8 A;  2FYP A;  2YI6 A;  4AWQ A;  5IN9 A;  3R4P A;  3GIF A;  2YE6 A;  4GCZ A;  1UYH A;  3A0Z A;  4YKX A;  2YEB A;  1AH6 A;  4KSG A;  2XK2 A;  2ZDX A;  2IWS A;  1UY7 A;  4LP0 A;  4PL9 A;  4JAS A;  4GT8 A;  5BOC A;  2Q2E B;  2YEC A;  3GIG B;  2HG1 A;  5D6P A;  3T1K A;  4O0B A;  2YEA A;  3O0I A;  4JQL A;  5CPH A;  1YER A;  4EMV A;  2FWZ A;  3ZKB A;  2YGF A;  4L94 A;  3ZM7 A;  3B26 A;  3D2R A;  1UYL A;  5F3K A;  4YKU A;  3EKR A;  3PEJ A;  4ASG A;  1YET A;  4O05 A;  3HYZ A;  2YI5 A;  4JAU A;  3OPD A;  4BQG A;  1Y8P A;  2BRE A;  1ID0 A;  2BU7 A;  2EXL A;  1NHJ A;  4L91 A;  3NMQ A;  4L93 A;  3H80 A;  3HZ1 A;  2JJC A;  3C11 A;  3VHD A;  4R3A A;  4HYM A;  4MP2 A;  4YKW A;  4L8Z A;  4U7O A;  2FWY A;  1Y8N A;  4EM7 A;  4URN A;  2PNR A;  2IOR A;  1I59 A;  3U67 A;  2YEI A;  3LNU A;  1GJV A;  4H85 A;  4KSH A;  5FND A;  3EHJ A;  2FXS A;  1UYM A;  3WHA A;  2WEP A;  4XKO A;  3INW A;  3SL2 A;  1QY8 A;  2WI3 A;  3CGY A;  5D6Q A;  1H7S A;  2IOP A;  4CE3 A;  1U0Z A;  4JAV A;  1EI1 A;  3HEK A;  4CWO A;  2GQP A;  3IED A;  4AWO A;  2YI0 A;  2QG2 A;  3CRL A;  3Q5L A;  4FCQ A;  4L90 A;  3TZ4 A;  2ZDY A;  2XHX A;  5CTW A;  5M4N A;  3TZ0 A;  1Y8O A;  3D0B A;  3H4L A;  4BIZ A;  2XAB A;  3CGZ A;  3TZ5 A;  4QPJ A;  2QF6 A;  4LWG A;  4KP4 A;  2H55 A;  4MPE A;  3RLQ A;  1PVG A;  2WI6 A;  1I5C A;  4P7A A;  2XDX A;  3R4O A;  3O2F A;  3RKZ A;  4Q20 A;  2CH4 A;  2YKB A;  1ZWH A;  1QYE A;  3EHF A;  4EGH A;  4XKA A;  3FV5 A;  3B28 A;  4MPC A;  4FMT A;  4LWH A;  3JZ3 A;  3B25 A;  4O09 A;  3GIG A;  4B7P A;  2YE9 A;  2YE5 A;  5L3J A;  2JKI A;  4WUC A;  3QDD A;  2YK9 A;  4CWR A;  1UYE A;  2XDL A;  2WI7 A;  3OWB A;  4AWP A;  4XIR A;  1B3Q A;  1BKN A;  3U2D A;  2XCM A;  1YSR A;  2XDS A;  1YC4 A;  1KIJ A;  4B6C A;  1TC6 A;  4PRV A;  3OWD A;  1YT2 A;  4MPN A;  3LPS A;  4H81 A;  1MU5 A;  1OSF A;  4EGI A;  5CTX A;  1B62 A;  3MNR P;  2Q8H A;  3ZXQ A;  4XIT A;  1YC1 A;  2IOQ A;  4URO A;  2H8M A;  2QFO A;  4FCP A;  5M4H A;  2YE7 A;  1TID A;  4XDM A;  4EGK A;  3K99 A;  1S16 A;  1ZW9 A;  5D7R A;  3T0H A;  1EA6 A;  5IDM A;  2YGA A;  3T2S A;  5CTU A;  1NHI A;  1YSZ A;  1QZR A;  4XKK A;  4MBC A;  2YJW A;  4ZVI A;  4FCR A;  1H7U A;  4LWE A;  1I58 A;  4LPB A;  5D7C A;  3VAD A;  3U2K A;  5CF0 A;  1GKX A;  1TIL A;  2BRC A;  1Z5A A;  4KFG A;  2VW5 A;  2BZ5 A;  1L0O A;  2YI7 A;  3EHH A;  4BXI A;  3C0E A;  2CCT A;  3TZ2 A;  3VHC A;  1GKZ A;  4CWS A;  2XDU A;  5FNF A;  1JM6 A;  4XIP A;  3O6O A;  1Z5B A;  3B24 A;  1ZXN A;  3R91 A;  4R1F A;  1BXD A;  2GFD A;  2YK2 A;  4HY6 A;  1UY8 A;  3HHU A;  3Q5K A;  3T0Z A;  3ZXO A;  4GEE A;  4HY1 A;  2Q8I A;  2XJX A;  4EFT A;  3BM9 A;  3R4N A;  4FPP A;  1TH8 A;  4LWF A;  2WI5 A;  1UYC A;  2WER A;  4CWN A;  3A0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...