3CGZA

Crystal structure of salmonella sensor kinase phoq catalytic domain
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
157
structure length
143
Chain Sequence
SVLLSRELHPVAPLLDNLISALNKVYQRKGVNISMDISPEISFVGEQNDFVEVMGNVLDNACKYCLEFVEISARQTDDHLHIFVEDDGPGIPHTLRPGQGVGLAVAREITEQYAGQIIASDSLLGGARMEVVFGRQHPTQKEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Virulence sensor histidine kinase phoQ
publication title The Hsp90 inhibitor radicicol interacts with the ATP-binding pocket of bacterial sensor kinase PhoQ.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 36
structure length 143
sequence length 157
chains with identical sequence B, C
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3cgzA00
1I5AA 3RLRA 4CWTA 1US7A 2WI1A 4GCZA 1GJVA 2YGAA 2WI3A 3CRLA 4XCLA 2XX5A 3TZ5A 4EGIA 1BGQA 4YKXA 5F5RA 3O2FA 1QZRA 4I5SA 5IDMA 2H55A 2IWXA 2BZ5A 1Y4UA 4O05A 5CTUA 4HXWA 4WUCA 3RLQA 2CCUA 1ZXMA 3K99A 4FPPA 1B3QA 4URMA 4EEHA 4MP7A 4HY6A 4XIPA 2BREA 4KTNA 1YT0A 2VWCA 5D6PA 3QDDA 5L3JA 2YE6A 4HXZA 4HY1A 3H4LA 1QY8A 3D2RA 3CGZA 5FWKA 4GEEA 5M4PA 4MPNA 1UYCA 4L91A 2ZBKB 5CF0A 2K5BA 4JASA 3WQ9A 3KE6A 4XKKA 2WI2A 1BKNA 3B26A 4B7PA 2CGFA 1YC3A 2YEJA 3T1KA 3HYZA 4K4OA 2YECA 2BRCA 3EHFA 5IN9A 2YE7A 3R4MA 4BQJA 1YS3A 1UYLA 3C11A 2BU8A 4CE3A 4PU9A 3IEDA 5M4NA 3T0ZA 1QYEA 3VADA 4CWNA 2HG1A 2CH4A 3OWDA 4KSGA 3OWBA 3TZ0A 4URNA 2XX4A 4V26A 2YEBA 1U2OA 2XDKA 4XDMA 4XE2A 3CRKA 4V25A 2XJGA 4BAEA 3GIGB 3H80A 4HYPA 4HZ0A 3HHUA 5FNDA 4LWHA 4HZ5A 1Y8OA 5CTXA 2YEIA 5GGZA 4LWIA 4HYMA 4QPKA 1TC0A 2H8MA 2BYHA 1B62A 1H7UA 2ZDXA 1YESA 4NH9A 2ESAA 1Y8PA 2WI7A 2AKPA 4NH8A 3K97A 2VW5A 4B6CA 4URLA 2CCSA 4R1FA 4CE2A 4KFGA 1OSFA 4H81A 3BM9A 4O0BA 4KSHA 5FNCA 2BYIA 4O09A 1B63A 2YI0A 3B24A 3A0TA 3T10A 5C93A 1ZW9A 2Q8FA 3T0HA 3R4OA 4CWPA 2WERA 4CWSA 5J6AA 3U2DA 2YEHA 2IOPA 4L94A 1YERA 4P7AA 4MOTA 2WI5A 4WUBA 4XCJA 2YE5A 1Z59A 3O0IA 3D0BA 4XTJA 4WUDA 5D7RA 1Y8NA 2YGEA 4O04A 3FT5A 4ASBA 1UYGA 2Q2EB 4ASAA 1MX0A 2Q8HA 4LWEA 2FWZA 1EA6A 2IWUA 1UYIA 3Q5JA 3JZ3A 4W7TA 3O6OA 2XJXA 4LWFA 2XDSA 3B25A 3CWVA 1AMWA 3DGEA 3QTFA 2XDLA 1ID0A 2E0AA 4BIZA 4XITA 3G7BA 4EM7A 2YKEA 2O1VA 1KZNA 1TH8A 2YJXA 2XK2A 4GFNA 5CTYA 3HZ1A 4UROA 4LPBA 4DUHA 1UYFA 4CE1A 2WEQA 4BQGA 2YI7A 4O07A 2ZDYA 5M4MA 4JQLA 4DZYA 4Q20A 3EHHA 4R3AA 5M4EA 1I5CA 4LP0A 2VCIA 1I5BA 2Q8IA 2YE3A 2GQPA 4YKTA 2IOQA 2WEPA 1YC1A 1ZWHA 3R91A 5IDJA 3WHAA 2YE4A 1ZXNA 4PRXA 3VHAA 1UYHA 5FNFA 4EFTA 2HCHA 4GT8A 2CG9A 2YKCA 2YE8A 3OPDA 3ZKDA 2WI6A 4BXIA 4FCQA 3GIFA 4FMTA 2XHTA 3PEHA 2CCTA 2XDXA 4EGHA 2BU6A 2XABA 2XX2A 1Y4SA 2YI5A 4E00A 1GKXA 1JM6A 4YKZA 3C0EA 1EI1A 3ZXQA 3HEKA 2Q8GA 1YC4A 2YEEA 3FT8A 1R62A 1YSZA 2JKIA 2YKBA 4GGLA 4XC0A 3K60A 5CPHA 4H7QA 2YEAA 2YK9A 3D36A 2BU5A 1H7SA 1KIJA 4YKYA 5BOCA 1I5DA 3TTZA 5F3KA 4R3MA 3RKZA 2XDUA 3VHCA 3HYYA 2BT0A 4P8OA 4XIRA 4E01A 5D6QA 4E02A 3G7EA 2YEFA 1TC6A 2BTZA 2JJCA 1GKZA 1TBWA 4KP4A 4MB9A 4ASGA 4AWPA 3Q5LA 2UWDA 3HZ5A 3INXA 4EGKA 1I58A 1NHHA 4PRVA 4MPEA 4I3HA 5BODA 4CWFA 3A0ZA 2FWYA 5CTWA 4JAVA 1YETA 4YKRA 2ZKJA 3B28A 2YGFA 4FCRA 3OMUA 5M4HA 1UY6A 4YKQA 4XD8A 2PNRA 2YJWA 4JAUA 4U7NA 2XHXA 3GIEA 1NHJA 1UYMA 4MP2A 3T2SA 3R4NA 4L93A 1I59A 4ZVIA 3TZ2A 1UYDA 3INWA 4MPCA 2FYPA 4NH7A 3K98A 4KQVA 5M4KA 4L90A 1AM1A 2EXLA 2XCMA 3A0YA 3ZKBA 2YE9A 4BIUA 2BSMA 2O1UA 2C2AA 4AS9A 1AH6A 2GFDA 3MNRP 1Z5BA 1TIDA 3R4PA 1UYEA 2XJJA 4GQTA 1BYQA 2QFOA 4QPJA 1YT2A 2YKJA 2VCJA 1U0ZA 2XD6A 5D7CA 4XIQA 1UY9A 1Z5AA 3FV5A 3ZXOA 2YEGA 1AJ6A 1TILA 2HKJA 2YKIA 1YT1A 3EKRA 2YK2A 3B27A 2QG0A 3ZM7A 2O1WA 3GIGA 4AWOA 1A4HA 4LWGA 3G75A 1THNA 3U67A 1L0OA 1PVGA 5J71A 4CWRA 1YSRA 3TZ4A 4MBCA 2QF6A 4CWOA 2IORA 2YEDA 2QG2A 2YE2A 4L8ZA 4U93A 4X9LA 4H85A 3PEJA 1UY7A 5D7DA 1AH8A 4YKUA 4ASFA 3A0RA 2BU2A 3VHDA 3EKOA 4CWQA 1Z5CA 2FXSA 2XHRA 4PL9A 4FCPA 4XKAA 3LNUA 1NHIA 3EHJA 3A0XA 3LPSA 4EMVA 3RLPA 3EHGA 1S16A 3A0WA 3OW6A 1S14A 1UYKA 1BXDA 2YI6A 4EFUA 4ZKIA 2WI4A 3BMYA 4XKOA 2BU7A 3CGYA 3TUHA 1MU5A 3SL2A 1UY8A 4AWQA 4U7OA 3R92A 2IWSA 3Q5KA 4YKWA 3NMQA 3U2KA
chains in the Genus database with same CATH superfamily
1I5AA 3RLRA 4CWTA 1US7A 2WI1A 4GCZA 1GJVA 2YGAA 2WI3A 3CRLA 1IXMA 4XCLA 2XX5A 3TZ5A 4EGIA 1BGQA 4YKXA 5F5RA 3O2FA 1QZRA 4I5SA 5IDMA 2H55A 2IWXA 2BZ5A 1Y4UA 4O05A 5CTUA 4HXWA 4WUCA 3RLQA 2CCUA 1ZXMA 3K99A 4FPPA 1B3QA 4URMA 4EEHA 4MP7A 4HY6A 4XIPA 2BREA 4KTNA 1YT0A 2VWCA 5D6PA 3QDDA 5L3JA 2YE6A 4HXZA 4HY1A 3H4LA 1QY8A 3D2RA 3CGZA 5FWKA 4GEEA 5M4PA 4MPNA 2FTKA 1UYCA 4L91A 2ZBKB 5CF0A 2K5BA 4JASA 3WQ9A 3KE6A 4XKKA 2WI2A 1BKNA 3B26A 4B7PA 2CGFA 1YC3A 2YEJA 3T1KA 3HYZA 4K4OA 2YECA 2BRCA 3EHFA 5IN9A 2YE7A 3R4MA 4BQJA 1YS3A 1UYLA 3C11A 2BU8A 4CE3A 4PU9A 3IEDA 5M4NA 3T0ZA 1QYEA 3VADA 4CWNA 2HG1A 2CH4A 2C1GA 3OWDA 3OWBA 4KSGA 3TZ0A 4URNA 2XX4A 4V26A 2YEBA 1U2OA 2XDKA 4XDMA 4XE2A 3CRKA 4V25A 2XJGA 4BAEA 3GIGB 3H80A 4HYPA 4HZ0A 3HHUA 3LMMA 5FNDA 4LWHA 4HZ5A 1Y8OA 5CTXA 2YEIA 5GGZA 4LWIA 4HYMA 4QPKA 1TC0A 2H8MA 2BYHA 1B62A 1H7UA 1F51A 2ZDXA 1YESA 4NH9A 2ESAA 1Y8PA 2WI7A 2AKPA 4NH8A 3K97A 2VW5A 4B6CA 4URLA 2CCSA 4R1FA 4CE2A 4KFGA 1OSFA 4H81A 3BM9A 4O0BA 4KSHA 5FNCA 2BYIA 4O09A 1B63A 2YI0A 3B24A 3A0TA 3T10A 5C93A 1ZW9A 2Q8FA 3T0HA 3R4OA 4CWPA 2WERA 4CWSA 5J6AA 3U2DA 2YEHA 2IOPA 4L94A 1YERA 4P7AA 4MOTA 2WI5A 4WUBA 4XCJA 2YE5A 1Z59A 3O0IA 3D0BA 4XTJA 4WUDA 5D7RA 1Y8NA 2YGEA 4O04A 3FT5A 4ASBA 1UYGA 2Q2EB 4ASAA 1MX0A 2Q8HA 4LWEA 2FWZA 1EA6A 2IWUA 2HHIA 1UYIA 3Q5JA 3JZ3A 4W7TA 3O6OA 2XJXA 4LWFA 2C1IA 2XDSA 3B25A 3CWVA 1AMWA 3DGEA 3QTFA 2XDLA 1ID0A 2E0AA 4BIZA 4XITA 3G7BA 4EM7A 2YKEA 2O1VA 1KZNA 1TH8A 2YJXA 2XK2A 4GFNA 5CTYA 3HZ1A 4UROA 4LPBA 3CYGA 4DUHA 1UYFA 4CE1A 2WEQA 4BQGA 2YI7A 4O07A 2ZDYA 5M4MA 4JQLA 4DZYA 5JENA 4Q20A 3EHHA 4R3AA 5M4EA 1I5CA 3S5TA 4LP0A 2VCIA 1I5BA 2Q8IA 2YE3A 2GQPA 4YKTA 2IOQA 2WEPA 1YC1A 1ZWHA 3R91A 5IDJA 3WHAA 2YE4A 1ZXNA 4PRXA 3VHAA 1UYHA 5FNFA 4EFTA 2HCHA 4GT8A 2CG9A 2YKCA 2YE8A 3OPDA 3ZKDA 2WI6A 4BXIA 4FCQA 3GIFA 4FMTA 2XHTA 3PEHA 2CCTA 2XDXA 4EGHA 2BU6A 2XABA 2XX2A 1Y4SA 2YI5A 4E00A 1GKXA 1JM6A 4YKZA 3C0EA 1EI1A 3ZXQA 3HEKA 2Q8GA 1YC4A 2YEEA 3FT8A 1R62A 1YSZA 2JKIA 2YKBA 4GGLA 4XC0A 3K60A 5CPHA 4H7QA 2YEAA 2YK9A 3D36A 2BU5A 1H7SA 1KIJA 4YKYA 5BOCA 1I5DA 3TTZA 5F3KA 4R3MA 3RKZA 2XDUA 3VHCA 3HYYA 2BT0A 4P8OA 4XIRA 4E01A 5D6QA 4E02A 3G7EA 2YEFA 1TC6A 2BTZA 2JJCA 1GKZA 1TBWA 4KP4A 4MB9A 4ASGA 4AWPA 3Q5LA 2UWDA 3HZ5A 3INXA 4EGKA 1I58A 1NHHA 4PRVA 4MPEA 4I3HA 5BODA 4CWFA 3A0ZA 2FWYA 5CTWA 4JAVA 1YETA 4YKRA 2ZKJA 3B28A 2YGFA 4FCRA 3OMUA 5M4HA 1UY6A 4YKQA 4XD8A 2PNRA 2YJWA 4JAUA 4U7NA 2XHXA 3GIEA 1NHJA 1UYMA 4MP2A 3T2SA 3R4NA 4L93A 1I59A 4ZVIA 3TZ2A 4E72A 1UYDA 3INWA 4MPCA 2FYPA 4NH7A 3K98A 4KQVA 5M4KA 4L90A 1AM1A 2EXLA 2XCMA 3A0YA 3ZKBA 2YE9A 4BIUA 2BSMA 2O1UA 2C2AA 4AS9A 1AH6A 2GFDA 3MNRP 1Z5BA 1TIDA 3R4PA 1UYEA 2XJJA 4GQTA 1BYQA 2QFOA 4QPJA 1YT2A 2YKJA 2VCJA 1U0ZA 2XD6A 5D7CA 4XIQA 1UY9A 1Z5AA 3FV5A 3ZXOA 2YEGA 1AJ6A 1TILA 2HKJA 2YKIA 1YT1A 3EKRA 2YK2A 3B27A 2QG0A 3ZM7A 2O1WA 3GIGA 4AWOA 1A4HA 4LWGA 3G75A 1THNA 3U67A 1L0OA 1PVGA 5J71A 4CWRA 1YSRA 3TZ4A 4MBCA 2QF6A 4CWOA 2IORA 2YEDA 2QG2A 2YE2A 4L8ZA 4U93A 4X9LA 4H85A 3PEJA 1UY7A 5D7DA 1AH8A 4YKUA 4ASFA 3A0RA 2BU2A 3VHDA 3EKOA 4CWQA 1Z5CA 2FXSA 2XHRA 4PL9A 4FCPA 4XKAA 3LNUA 1NHIA 3EHJA 3A0XA 3LPSA 4EMVA 3RLPA 3EHGA 1S16A 3A0WA 3OW6A 1S14A 1UYKA 1BXDA 2YI6A 4EFUA 4ZKIA 2WI4A 3BMYA 4XKOA 2BU7A 3CGYA 3TUHA 1MU5A 3SL2A 1UY8A 4AWQA 4U7OA 3R92A 2IWSA 3Q5KA 4YKWA 3NMQA 3U2KA
chains in the Genus database with same CATH topology
1I5AA 3RLRA 4CWTA 1US7A 2WI1A 4GCZA 1GJVA 2YGAA 2WI3A 3CRLA 4XCLA 2XX5A 3TZ5A 4EGIA 1BGQA 4YKXA 5F5RA 3O2FA 1QZRA 4I5SA 5IDMA 2H55A 2IWXA 2BZ5A 1Y4UA 4O05A 5CTUA 4HXWA 4WUCA 3RLQA 2CCUA 1ZXMA 3K99A 4FPPA 1B3QA 4URMA 4EEHA 4MP7A 4HY6A 4XIPA 2BREA 4KTNA 1YT0A 2VWCA 5D6PA 3QDDA 5L3JA 2YE6A 4HXZA 4HY1A 3H4LA 1QY8A 3D2RA 3CGZA 5FWKA 4GEEA 5M4PA 4MPNA 1UYCA 4L91A 2ZBKB 5CF0A 2K5BA 4JASA 3WQ9A 3KE6A 4XKKA 2WI2A 1BKNA 3B26A 4B7PA 2CGFA 1YC3A 2YEJA 3T1KA 3HYZA 4K4OA 2YECA 2BRCA 3EHFA 5IN9A 2YE7A 3R4MA 4BQJA 1YS3A 1UYLA 3C11A 2BU8A 4CE3A 4PU9A 3IEDA 5M4NA 3T0ZA 1QYEA 3VADA 4CWNA 2HG1A 2CH4A 3OWDA 4KSGA 3OWBA 3TZ0A 4URNA 2XX4A 4V26A 2YEBA 1U2OA 2XDKA 4XDMA 4XE2A 3CRKA 4V25A 2XJGA 4BAEA 3GIGB 3H80A 4HYPA 4HZ0A 3HHUA 5FNDA 4LWHA 4HZ5A 1Y8OA 5CTXA 2YEIA 5GGZA 4LWIA 4HYMA 4QPKA 1TC0A 2H8MA 2BYHA 1B62A 1H7UA 2ZDXA 1YESA 4NH9A 2ESAA 1Y8PA 2WI7A 2AKPA 4NH8A 3K97A 2VW5A 4B6CA 4URLA 2CCSA 4R1FA 4CE2A 4KFGA 1OSFA 4H81A 3BM9A 4O0BA 4KSHA 5FNCA 2BYIA 4O09A 1B63A 2YI0A 3B24A 3A0TA 3T10A 5C93A 1ZW9A 2Q8FA 3T0HA 3R4OA 4CWPA 2WERA 4CWSA 5J6AA 3U2DA 2YEHA 2IOPA 4L94A 1YERA 4P7AA 4MOTA 2WI5A 4WUBA 4XCJA 2YE5A 1Z59A 3O0IA 3D0BA 4XTJA 4WUDA 5D7RA 1Y8NA 2YGEA 4O04A 3FT5A 4ASBA 1UYGA 2Q2EB 4ASAA 1MX0A 2Q8HA 4LWEA 2FWZA 1EA6A 2IWUA 1UYIA 3Q5JA 3JZ3A 4W7TA 3O6OA 2XJXA 4LWFA 2XDSA 3B25A 3CWVA 1AMWA 3DGEA 3QTFA 2XDLA 1ID0A 2E0AA 4BIZA 4XITA 3G7BA 4EM7A 2YKEA 2O1VA 1KZNA 1TH8A 2YJXA 2XK2A 4GFNA 5CTYA 3HZ1A 4UROA 4LPBA 4DUHA 1UYFA 4CE1A 2WEQA 4BQGA 2YI7A 4O07A 2ZDYA 5M4MA 4JQLA 4DZYA 4Q20A 3EHHA 4R3AA 5M4EA 1I5CA 4LP0A 2VCIA 1I5BA 2Q8IA 2YE3A 2GQPA 4YKTA 2IOQA 2WEPA 1YC1A 1ZWHA 3R91A 5IDJA 3WHAA 2YE4A 1ZXNA 4PRXA 3VHAA 1UYHA 5FNFA 4EFTA 2HCHA 4GT8A 2CG9A 2YKCA 2YE8A 3OPDA 3ZKDA 2WI6A 4BXIA 4FCQA 3GIFA 4FMTA 2XHTA 3PEHA 2CCTA 2XDXA 4EGHA 2BU6A 2XABA 2XX2A 1Y4SA 2YI5A 4E00A 1GKXA 1JM6A 4YKZA 3C0EA 1EI1A 3ZXQA 3HEKA 2Q8GA 1YC4A 2YEEA 3FT8A 1R62A 1YSZA 2JKIA 2YKBA 4GGLA 4XC0A 3K60A 5CPHA 4H7QA 2YEAA 2YK9A 3D36A 2BU5A 1H7SA 1KIJA 4YKYA 5BOCA 1I5DA 3TTZA 5F3KA 4R3MA 3RKZA 2XDUA 3VHCA 3HYYA 2BT0A 4P8OA 4XIRA 4E01A 5D6QA 4E02A 3G7EA 2YEFA 1TC6A 2BTZA 2JJCA 1GKZA 1TBWA 4KP4A 4MB9A 4ASGA 4AWPA 3Q5LA 2UWDA 3HZ5A 3INXA 4EGKA 1I58A 1NHHA 4PRVA 4MPEA 4I3HA 5BODA 4CWFA 3A0ZA 2FWYA 5CTWA 4JAVA 1YETA 4YKRA 2ZKJA 3B28A 2YGFA 4FCRA 3OMUA 5M4HA 1UY6A 4YKQA 4XD8A 2PNRA 2YJWA 4JAUA 4U7NA 2XHXA 3GIEA 1NHJA 1UYMA 4MP2A 3T2SA 3R4NA 4L93A 1I59A 4ZVIA 3TZ2A 1UYDA 3INWA 4MPCA 2FYPA 4NH7A 3K98A 4KQVA 5M4KA 4L90A 1AM1A 2EXLA 2XCMA 3A0YA 3ZKBA 2YE9A 4BIUA 2BSMA 2O1UA 2C2AA 4AS9A 1AH6A 2GFDA 3MNRP 1Z5BA 1TIDA 3R4PA 1UYEA 2XJJA 4GQTA 1BYQA 2QFOA 4QPJA 1YT2A 2YKJA 2VCJA 1U0ZA 2XD6A 5D7CA 4XIQA 1UY9A 1Z5AA 3FV5A 3ZXOA 2YEGA 1AJ6A 1TILA 2HKJA 2YKIA 1YT1A 3EKRA 2YK2A 3B27A 2QG0A 3ZM7A 2O1WA 3GIGA 4AWOA 1A4HA 4LWGA 3G75A 1THNA 3U67A 1L0OA 1PVGA 5J71A 4CWRA 1YSRA 3TZ4A 4MBCA 2QF6A 4CWOA 2IORA 2YEDA 2QG2A 2YE2A 4L8ZA 4U93A 4X9LA 4H85A 3PEJA 1UY7A 5D7DA 1AH8A 4YKUA 4ASFA 3A0RA 2BU2A 3VHDA 3EKOA 4CWQA 1Z5CA 2FXSA 2XHRA 4PL9A 4FCPA 4XKAA 3LNUA 1NHIA 3EHJA 3A0XA 3LPSA 4EMVA 3RLPA 3EHGA 1S16A 3A0WA 3OW6A 1S14A 1UYKA 1BXDA 2YI6A 4EFUA 4ZKIA 2WI4A 3BMYA 4XKOA 2BU7A 3CGYA 3TUHA 1MU5A 3SL2A 1UY8A 4AWQA 4U7OA 3R92A 2IWSA 3Q5KA 4YKWA 3NMQA 3U2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I5A A;  3RLR A;  4CWT A;  1US7 A;  2WI1 A;  4GCZ A;  1GJV A;  2YGA A;  2WI3 A;  3CRL A;  4XCL A;  2XX5 A;  3TZ5 A;  4EGI A;  1BGQ A;  4YKX A;  5F5R A;  3O2F A;  1QZR A;  4I5S A;  5IDM A;  2H55 A;  2IWX A;  2BZ5 A;  1Y4U A;  4O05 A;  5CTU A;  4HXW A;  4WUC A;  3RLQ A;  2CCU A;  1ZXM A;  3K99 A;  4FPP A;  1B3Q A;  4URM A;  4EEH A;  4MP7 A;  4HY6 A;  4XIP A;  2BRE A;  4KTN A;  1YT0 A;  2VWC A;  5D6P A;  3QDD A;  5L3J A;  2YE6 A;  4HXZ A;  4HY1 A;  3H4L A;  1QY8 A;  3D2R A;  3CGZ A;  5FWK A;  4GEE A;  5M4P A;  4MPN A;  1UYC A;  4L91 A;  2ZBK B;  5CF0 A;  2K5B A;  4JAS A;  3WQ9 A;  3KE6 A;  4XKK A;  2WI2 A;  1BKN A;  3B26 A;  4B7P A;  2CGF A;  1YC3 A;  2YEJ A;  3T1K A;  3HYZ A;  4K4O A;  2YEC A;  2BRC A;  3EHF A;  5IN9 A;  2YE7 A;  3R4M A;  4BQJ A;  1YS3 A;  1UYL A;  3C11 A;  2BU8 A;  4CE3 A;  4PU9 A;  3IED A;  5M4N A;  3T0Z A;  1QYE A;  3VAD A;  4CWN A;  2HG1 A;  2CH4 A;  3OWD A;  4KSG A;  3OWB A;  3TZ0 A;  4URN A;  2XX4 A;  4V26 A;  2YEB A;  1U2O A;  2XDK A;  4XDM A;  4XE2 A;  3CRK A;  4V25 A;  2XJG A;  4BAE A;  3GIG B;  3H80 A;  4HYP A;  4HZ0 A;  3HHU A;  5FND A;  4LWH A;  4HZ5 A;  1Y8O A;  5CTX A;  2YEI A;  5GGZ A;  4LWI A;  4HYM A;  4QPK A;  1TC0 A;  2H8M A;  2BYH A;  1B62 A;  1H7U A;  2ZDX A;  1YES A;  4NH9 A;  2ESA A;  1Y8P A;  2WI7 A;  2AKP A;  4NH8 A;  3K97 A;  2VW5 A;  4B6C A;  4URL A;  2CCS A;  4R1F A;  4CE2 A;  4KFG A;  1OSF A;  4H81 A;  3BM9 A;  4O0B A;  4KSH A;  5FNC A;  2BYI A;  4O09 A;  1B63 A;  2YI0 A;  3B24 A;  3A0T A;  3T10 A;  5C93 A;  1ZW9 A;  2Q8F A;  3T0H A;  3R4O A;  4CWP A;  2WER A;  4CWS A;  5J6A A;  3U2D A;  2YEH A;  2IOP A;  4L94 A;  1YER A;  4P7A A;  4MOT A;  2WI5 A;  4WUB A;  4XCJ A;  2YE5 A;  1Z59 A;  3O0I A;  3D0B A;  4XTJ A;  4WUD A;  5D7R A;  1Y8N A;  2YGE A;  4O04 A;  3FT5 A;  4ASB A;  1UYG A;  2Q2E B;  4ASA A;  1MX0 A;  2Q8H A;  4LWE A;  2FWZ A;  1EA6 A;  2IWU A;  1UYI A;  3Q5J A;  3JZ3 A;  4W7T A;  3O6O A;  2XJX A;  4LWF A;  2XDS A;  3B25 A;  3CWV A;  1AMW A;  3DGE A;  3QTF A;  2XDL A;  1ID0 A;  2E0A A;  4BIZ A;  4XIT A;  3G7B A;  4EM7 A;  2YKE A;  2O1V A;  1KZN A;  1TH8 A;  2YJX A;  2XK2 A;  4GFN A;  5CTY A;  3HZ1 A;  4URO A;  4LPB A;  4DUH A;  1UYF A;  4CE1 A;  2WEQ A;  4BQG A;  2YI7 A;  4O07 A;  2ZDY A;  5M4M A;  4JQL A;  4DZY A;  4Q20 A;  3EHH A;  4R3A A;  5M4E A;  1I5C A;  4LP0 A;  2VCI A;  1I5B A;  2Q8I A;  2YE3 A;  2GQP A;  4YKT A;  2IOQ A;  2WEP A;  1YC1 A;  1ZWH A;  3R91 A;  5IDJ A;  3WHA A;  2YE4 A;  1ZXN A;  4PRX A;  3VHA A;  1UYH A;  5FNF A;  4EFT A;  2HCH A;  4GT8 A;  2CG9 A;  2YKC A;  2YE8 A;  3OPD A;  3ZKD A;  2WI6 A;  4BXI A;  4FCQ A;  3GIF A;  4FMT A;  2XHT A;  3PEH A;  2CCT A;  2XDX A;  4EGH A;  2BU6 A;  2XAB A;  2XX2 A;  1Y4S A;  2YI5 A;  4E00 A;  1GKX A;  1JM6 A;  4YKZ A;  3C0E A;  1EI1 A;  3ZXQ A;  3HEK A;  2Q8G A;  1YC4 A;  2YEE A;  3FT8 A;  1R62 A;  1YSZ A;  2JKI A;  2YKB A;  4GGL A;  4XC0 A;  3K60 A;  5CPH A;  4H7Q A;  2YEA A;  2YK9 A;  3D36 A;  2BU5 A;  1H7S A;  1KIJ A;  4YKY A;  5BOC A;  1I5D A;  3TTZ A;  5F3K A;  4R3M A;  3RKZ A;  2XDU A;  3VHC A;  3HYY A;  2BT0 A;  4P8O A;  4XIR A;  4E01 A;  5D6Q A;  4E02 A;  3G7E A;  2YEF A;  1TC6 A;  2BTZ A;  2JJC A;  1GKZ A;  1TBW A;  4KP4 A;  4MB9 A;  4ASG A;  4AWP A;  3Q5L A;  2UWD A;  3HZ5 A;  3INX A;  4EGK A;  1I58 A;  1NHH A;  4PRV A;  4MPE A;  4I3H A;  5BOD A;  4CWF A;  3A0Z A;  2FWY A;  5CTW A;  4JAV A;  1YET A;  4YKR A;  2ZKJ A;  3B28 A;  2YGF A;  4FCR A;  3OMU A;  5M4H A;  1UY6 A;  4YKQ A;  4XD8 A;  2PNR A;  2YJW A;  4JAU A;  4U7N A;  2XHX A;  3GIE A;  1NHJ A;  1UYM A;  4MP2 A;  3T2S A;  3R4N A;  4L93 A;  1I59 A;  4ZVI A;  3TZ2 A;  1UYD A;  3INW A;  4MPC A;  2FYP A;  4NH7 A;  3K98 A;  4KQV A;  5M4K A;  4L90 A;  1AM1 A;  2EXL A;  2XCM A;  3A0Y A;  3ZKB A;  2YE9 A;  4BIU A;  2BSM A;  2O1U A;  2C2A A;  4AS9 A;  1AH6 A;  2GFD A;  3MNR P;  1Z5B A;  1TID A;  3R4P A;  1UYE A;  2XJJ A;  4GQT A;  1BYQ A;  2QFO A;  4QPJ A;  1YT2 A;  2YKJ A;  2VCJ A;  1U0Z A;  2XD6 A;  5D7C A;  4XIQ A;  1UY9 A;  1Z5A A;  3FV5 A;  3ZXO A;  2YEG A;  1AJ6 A;  1TIL A;  2HKJ A;  2YKI A;  1YT1 A;  3EKR A;  2YK2 A;  3B27 A;  2QG0 A;  3ZM7 A;  2O1W A;  3GIG A;  4AWO A;  1A4H A;  4LWG A;  3G75 A;  1THN A;  3U67 A;  1L0O A;  1PVG A;  5J71 A;  4CWR A;  1YSR A;  3TZ4 A;  4MBC A;  2QF6 A;  4CWO A;  2IOR A;  2YED A;  2QG2 A;  2YE2 A;  4L8Z A;  4U93 A;  4X9L A;  4H85 A;  3PEJ A;  1UY7 A;  5D7D A;  1AH8 A;  4YKU A;  4ASF A;  3A0R A;  2BU2 A;  3VHD A;  3EKO A;  4CWQ A;  1Z5C A;  2FXS A;  2XHR A;  4PL9 A;  4FCP A;  4XKA A;  3LNU A;  1NHI A;  3EHJ A;  3A0X A;  3LPS A;  4EMV A;  3RLP A;  3EHG A;  1S16 A;  3A0W A;  3OW6 A;  1S14 A;  1UYK A;  1BXD A;  2YI6 A;  4EFU A;  4ZKI A;  2WI4 A;  3BMY A;  4XKO A;  2BU7 A;  3CGY A;  3TUH A;  1MU5 A;  3SL2 A;  1UY8 A;  4AWQ A;  4U7O A;  3R92 A;  2IWS A;  3Q5K A;  4YKW A;  3NMQ A;  3U2K A; 
#chains in the Genus database with same CATH topology
 1I5A A;  3RLR A;  4CWT A;  1US7 A;  2WI1 A;  4GCZ A;  1GJV A;  2YGA A;  2WI3 A;  3CRL A;  1IXM A;  4XCL A;  2XX5 A;  3TZ5 A;  4EGI A;  1BGQ A;  4YKX A;  5F5R A;  3O2F A;  1QZR A;  4I5S A;  5IDM A;  2H55 A;  2IWX A;  2BZ5 A;  1Y4U A;  4O05 A;  5CTU A;  4HXW A;  4WUC A;  3RLQ A;  2CCU A;  1ZXM A;  3K99 A;  4FPP A;  1B3Q A;  4URM A;  4EEH A;  4MP7 A;  4HY6 A;  4XIP A;  2BRE A;  4KTN A;  1YT0 A;  2VWC A;  5D6P A;  3QDD A;  5L3J A;  2YE6 A;  4HXZ A;  4HY1 A;  3H4L A;  1QY8 A;  3D2R A;  3CGZ A;  5FWK A;  4GEE A;  5M4P A;  4MPN A;  2FTK A;  1UYC A;  4L91 A;  2ZBK B;  5CF0 A;  2K5B A;  4JAS A;  3WQ9 A;  3KE6 A;  4XKK A;  2WI2 A;  1BKN A;  3B26 A;  4B7P A;  2CGF A;  1YC3 A;  2YEJ A;  3T1K A;  3HYZ A;  4K4O A;  2YEC A;  2BRC A;  3EHF A;  5IN9 A;  2YE7 A;  3R4M A;  4BQJ A;  1YS3 A;  1UYL A;  3C11 A;  2BU8 A;  4CE3 A;  4PU9 A;  3IED A;  5M4N A;  3T0Z A;  1QYE A;  3VAD A;  4CWN A;  2HG1 A;  2CH4 A;  2C1G A;  3OWD A;  3OWB A;  4KSG A;  3TZ0 A;  4URN A;  2XX4 A;  4V26 A;  2YEB A;  1U2O A;  2XDK A;  4XDM A;  4XE2 A;  3CRK A;  4V25 A;  2XJG A;  4BAE A;  3GIG B;  3H80 A;  4HYP A;  4HZ0 A;  3HHU A;  3LMM A;  5FND A;  4LWH A;  4HZ5 A;  1Y8O A;  5CTX A;  2YEI A;  5GGZ A;  4LWI A;  4HYM A;  4QPK A;  1TC0 A;  2H8M A;  2BYH A;  1B62 A;  1H7U A;  1F51 A;  2ZDX A;  1YES A;  4NH9 A;  2ESA A;  1Y8P A;  2WI7 A;  2AKP A;  4NH8 A;  3K97 A;  2VW5 A;  4B6C A;  4URL A;  2CCS A;  4R1F A;  4CE2 A;  4KFG A;  1OSF A;  4H81 A;  3BM9 A;  4O0B A;  4KSH A;  5FNC A;  2BYI A;  4O09 A;  1B63 A;  2YI0 A;  3B24 A;  3A0T A;  3T10 A;  5C93 A;  1ZW9 A;  2Q8F A;  3T0H A;  3R4O A;  4CWP A;  2WER A;  4CWS A;  5J6A A;  3U2D A;  2YEH A;  2IOP A;  4L94 A;  1YER A;  4P7A A;  4MOT A;  2WI5 A;  4WUB A;  4XCJ A;  2YE5 A;  1Z59 A;  3O0I A;  3D0B A;  4XTJ A;  4WUD A;  5D7R A;  1Y8N A;  2YGE A;  4O04 A;  3FT5 A;  4ASB A;  1UYG A;  2Q2E B;  4ASA A;  1MX0 A;  2Q8H A;  4LWE A;  2FWZ A;  1EA6 A;  2IWU A;  2HHI A;  1UYI A;  3Q5J A;  3JZ3 A;  4W7T A;  3O6O A;  2XJX A;  4LWF A;  2C1I A;  2XDS A;  3B25 A;  3CWV A;  1AMW A;  3DGE A;  3QTF A;  2XDL A;  1ID0 A;  2E0A A;  4BIZ A;  4XIT A;  3G7B A;  4EM7 A;  2YKE A;  2O1V A;  1KZN A;  1TH8 A;  2YJX A;  2XK2 A;  4GFN A;  5CTY A;  3HZ1 A;  4URO A;  4LPB A;  3CYG A;  4DUH A;  1UYF A;  4CE1 A;  2WEQ A;  4BQG A;  2YI7 A;  4O07 A;  2ZDY A;  5M4M A;  4JQL A;  4DZY A;  5JEN A;  4Q20 A;  3EHH A;  4R3A A;  5M4E A;  1I5C A;  3S5T A;  4LP0 A;  2VCI A;  1I5B A;  2Q8I A;  2YE3 A;  2GQP A;  4YKT A;  2IOQ A;  2WEP A;  1YC1 A;  1ZWH A;  3R91 A;  5IDJ A;  3WHA A;  2YE4 A;  1ZXN A;  4PRX A;  3VHA A;  1UYH A;  5FNF A;  4EFT A;  2HCH A;  4GT8 A;  2CG9 A;  2YKC A;  2YE8 A;  3OPD A;  3ZKD A;  2WI6 A;  4BXI A;  4FCQ A;  3GIF A;  4FMT A;  2XHT A;  3PEH A;  2CCT A;  2XDX A;  4EGH A;  2BU6 A;  2XAB A;  2XX2 A;  1Y4S A;  2YI5 A;  4E00 A;  1GKX A;  1JM6 A;  4YKZ A;  3C0E A;  1EI1 A;  3ZXQ A;  3HEK A;  2Q8G A;  1YC4 A;  2YEE A;  3FT8 A;  1R62 A;  1YSZ A;  2JKI A;  2YKB A;  4GGL A;  4XC0 A;  3K60 A;  5CPH A;  4H7Q A;  2YEA A;  2YK9 A;  3D36 A;  2BU5 A;  1H7S A;  1KIJ A;  4YKY A;  5BOC A;  1I5D A;  3TTZ A;  5F3K A;  4R3M A;  3RKZ A;  2XDU A;  3VHC A;  3HYY A;  2BT0 A;  4P8O A;  4XIR A;  4E01 A;  5D6Q A;  4E02 A;  3G7E A;  2YEF A;  1TC6 A;  2BTZ A;  2JJC A;  1GKZ A;  1TBW A;  4KP4 A;  4MB9 A;  4ASG A;  4AWP A;  3Q5L A;  2UWD A;  3HZ5 A;  3INX A;  4EGK A;  1I58 A;  1NHH A;  4PRV A;  4MPE A;  4I3H A;  5BOD A;  4CWF A;  3A0Z A;  2FWY A;  5CTW A;  4JAV A;  1YET A;  4YKR A;  2ZKJ A;  3B28 A;  2YGF A;  4FCR A;  3OMU A;  5M4H A;  1UY6 A;  4YKQ A;  4XD8 A;  2PNR A;  2YJW A;  4JAU A;  4U7N A;  2XHX A;  3GIE A;  1NHJ A;  1UYM A;  4MP2 A;  3T2S A;  3R4N A;  4L93 A;  1I59 A;  4ZVI A;  3TZ2 A;  4E72 A;  1UYD A;  3INW A;  4MPC A;  2FYP A;  4NH7 A;  3K98 A;  4KQV A;  5M4K A;  4L90 A;  1AM1 A;  2EXL A;  2XCM A;  3A0Y A;  3ZKB A;  2YE9 A;  4BIU A;  2BSM A;  2O1U A;  2C2A A;  4AS9 A;  1AH6 A;  2GFD A;  3MNR P;  1Z5B A;  1TID A;  3R4P A;  1UYE A;  2XJJ A;  4GQT A;  1BYQ A;  2QFO A;  4QPJ A;  1YT2 A;  2YKJ A;  2VCJ A;  1U0Z A;  2XD6 A;  5D7C A;  4XIQ A;  1UY9 A;  1Z5A A;  3FV5 A;  3ZXO A;  2YEG A;  1AJ6 A;  1TIL A;  2HKJ A;  2YKI A;  1YT1 A;  3EKR A;  2YK2 A;  3B27 A;  2QG0 A;  3ZM7 A;  2O1W A;  3GIG A;  4AWO A;  1A4H A;  4LWG A;  3G75 A;  1THN A;  3U67 A;  1L0O A;  1PVG A;  5J71 A;  4CWR A;  1YSR A;  3TZ4 A;  4MBC A;  2QF6 A;  4CWO A;  2IOR A;  2YED A;  2QG2 A;  2YE2 A;  4L8Z A;  4U93 A;  4X9L A;  4H85 A;  3PEJ A;  1UY7 A;  5D7D A;  1AH8 A;  4YKU A;  4ASF A;  3A0R A;  2BU2 A;  3VHD A;  3EKO A;  4CWQ A;  1Z5C A;  2FXS A;  2XHR A;  4PL9 A;  4FCP A;  4XKA A;  3LNU A;  1NHI A;  3EHJ A;  3A0X A;  3LPS A;  4EMV A;  3RLP A;  3EHG A;  1S16 A;  3A0W A;  3OW6 A;  1S14 A;  1UYK A;  1BXD A;  2YI6 A;  4EFU A;  4ZKI A;  2WI4 A;  3BMY A;  4XKO A;  2BU7 A;  3CGY A;  3TUH A;  1MU5 A;  3SL2 A;  1UY8 A;  4AWQ A;  4U7O A;  3R92 A;  2IWS A;  3Q5K A;  4YKW A;  3NMQ A;  3U2K A; 
#chains in the Genus database with same CATH homology
 1I5A A;  3RLR A;  4CWT A;  1US7 A;  2WI1 A;  4GCZ A;  1GJV A;  2YGA A;  2WI3 A;  3CRL A;  4XCL A;  2XX5 A;  3TZ5 A;  4EGI A;  1BGQ A;  4YKX A;  5F5R A;  3O2F A;  1QZR A;  4I5S A;  5IDM A;  2H55 A;  2IWX A;  2BZ5 A;  1Y4U A;  4O05 A;  5CTU A;  4HXW A;  4WUC A;  3RLQ A;  2CCU A;  1ZXM A;  3K99 A;  4FPP A;  1B3Q A;  4URM A;  4EEH A;  4MP7 A;  4HY6 A;  4XIP A;  2BRE A;  4KTN A;  1YT0 A;  2VWC A;  5D6P A;  3QDD A;  5L3J A;  2YE6 A;  4HXZ A;  4HY1 A;  3H4L A;  1QY8 A;  3D2R A;  3CGZ A;  5FWK A;  4GEE A;  5M4P A;  4MPN A;  1UYC A;  4L91 A;  2ZBK B;  5CF0 A;  2K5B A;  4JAS A;  3WQ9 A;  3KE6 A;  4XKK A;  2WI2 A;  1BKN A;  3B26 A;  4B7P A;  2CGF A;  1YC3 A;  2YEJ A;  3T1K A;  3HYZ A;  4K4O A;  2YEC A;  2BRC A;  3EHF A;  5IN9 A;  2YE7 A;  3R4M A;  4BQJ A;  1YS3 A;  1UYL A;  3C11 A;  2BU8 A;  4CE3 A;  4PU9 A;  3IED A;  5M4N A;  3T0Z A;  1QYE A;  3VAD A;  4CWN A;  2HG1 A;  2CH4 A;  3OWD A;  4KSG A;  3OWB A;  3TZ0 A;  4URN A;  2XX4 A;  4V26 A;  2YEB A;  1U2O A;  2XDK A;  4XDM A;  4XE2 A;  3CRK A;  4V25 A;  2XJG A;  4BAE A;  3GIG B;  3H80 A;  4HYP A;  4HZ0 A;  3HHU A;  5FND A;  4LWH A;  4HZ5 A;  1Y8O A;  5CTX A;  2YEI A;  5GGZ A;  4LWI A;  4HYM A;  4QPK A;  1TC0 A;  2H8M A;  2BYH A;  1B62 A;  1H7U A;  2ZDX A;  1YES A;  4NH9 A;  2ESA A;  1Y8P A;  2WI7 A;  2AKP A;  4NH8 A;  3K97 A;  2VW5 A;  4B6C A;  4URL A;  2CCS A;  4R1F A;  4CE2 A;  4KFG A;  1OSF A;  4H81 A;  3BM9 A;  4O0B A;  4KSH A;  5FNC A;  2BYI A;  4O09 A;  1B63 A;  2YI0 A;  3B24 A;  3A0T A;  3T10 A;  5C93 A;  1ZW9 A;  2Q8F A;  3T0H A;  3R4O A;  4CWP A;  2WER A;  4CWS A;  5J6A A;  3U2D A;  2YEH A;  2IOP A;  4L94 A;  1YER A;  4P7A A;  4MOT A;  2WI5 A;  4WUB A;  4XCJ A;  2YE5 A;  1Z59 A;  3O0I A;  3D0B A;  4XTJ A;  4WUD A;  5D7R A;  1Y8N A;  2YGE A;  4O04 A;  3FT5 A;  4ASB A;  1UYG A;  2Q2E B;  4ASA A;  1MX0 A;  2Q8H A;  4LWE A;  2FWZ A;  1EA6 A;  2IWU A;  1UYI A;  3Q5J A;  3JZ3 A;  4W7T A;  3O6O A;  2XJX A;  4LWF A;  2XDS A;  3B25 A;  3CWV A;  1AMW A;  3DGE A;  3QTF A;  2XDL A;  1ID0 A;  2E0A A;  4BIZ A;  4XIT A;  3G7B A;  4EM7 A;  2YKE A;  2O1V A;  1KZN A;  1TH8 A;  2YJX A;  2XK2 A;  4GFN A;  5CTY A;  3HZ1 A;  4URO A;  4LPB A;  4DUH A;  1UYF A;  4CE1 A;  2WEQ A;  4BQG A;  2YI7 A;  4O07 A;  2ZDY A;  5M4M A;  4JQL A;  4DZY A;  4Q20 A;  3EHH A;  4R3A A;  5M4E A;  1I5C A;  4LP0 A;  2VCI A;  1I5B A;  2Q8I A;  2YE3 A;  2GQP A;  4YKT A;  2IOQ A;  2WEP A;  1YC1 A;  1ZWH A;  3R91 A;  5IDJ A;  3WHA A;  2YE4 A;  1ZXN A;  4PRX A;  3VHA A;  1UYH A;  5FNF A;  4EFT A;  2HCH A;  4GT8 A;  2CG9 A;  2YKC A;  2YE8 A;  3OPD A;  3ZKD A;  2WI6 A;  4BXI A;  4FCQ A;  3GIF A;  4FMT A;  2XHT A;  3PEH A;  2CCT A;  2XDX A;  4EGH A;  2BU6 A;  2XAB A;  2XX2 A;  1Y4S A;  2YI5 A;  4E00 A;  1GKX A;  1JM6 A;  4YKZ A;  3C0E A;  1EI1 A;  3ZXQ A;  3HEK A;  2Q8G A;  1YC4 A;  2YEE A;  3FT8 A;  1R62 A;  1YSZ A;  2JKI A;  2YKB A;  4GGL A;  4XC0 A;  3K60 A;  5CPH A;  4H7Q A;  2YEA A;  2YK9 A;  3D36 A;  2BU5 A;  1H7S A;  1KIJ A;  4YKY A;  5BOC A;  1I5D A;  3TTZ A;  5F3K A;  4R3M A;  3RKZ A;  2XDU A;  3VHC A;  3HYY A;  2BT0 A;  4P8O A;  4XIR A;  4E01 A;  5D6Q A;  4E02 A;  3G7E A;  2YEF A;  1TC6 A;  2BTZ A;  2JJC A;  1GKZ A;  1TBW A;  4KP4 A;  4MB9 A;  4ASG A;  4AWP A;  3Q5L A;  2UWD A;  3HZ5 A;  3INX A;  4EGK A;  1I58 A;  1NHH A;  4PRV A;  4MPE A;  4I3H A;  5BOD A;  4CWF A;  3A0Z A;  2FWY A;  5CTW A;  4JAV A;  1YET A;  4YKR A;  2ZKJ A;  3B28 A;  2YGF A;  4FCR A;  3OMU A;  5M4H A;  1UY6 A;  4YKQ A;  4XD8 A;  2PNR A;  2YJW A;  4JAU A;  4U7N A;  2XHX A;  3GIE A;  1NHJ A;  1UYM A;  4MP2 A;  3T2S A;  3R4N A;  4L93 A;  1I59 A;  4ZVI A;  3TZ2 A;  1UYD A;  3INW A;  4MPC A;  2FYP A;  4NH7 A;  3K98 A;  4KQV A;  5M4K A;  4L90 A;  1AM1 A;  2EXL A;  2XCM A;  3A0Y A;  3ZKB A;  2YE9 A;  4BIU A;  2BSM A;  2O1U A;  2C2A A;  4AS9 A;  1AH6 A;  2GFD A;  3MNR P;  1Z5B A;  1TID A;  3R4P A;  1UYE A;  2XJJ A;  4GQT A;  1BYQ A;  2QFO A;  4QPJ A;  1YT2 A;  2YKJ A;  2VCJ A;  1U0Z A;  2XD6 A;  5D7C A;  4XIQ A;  1UY9 A;  1Z5A A;  3FV5 A;  3ZXO A;  2YEG A;  1AJ6 A;  1TIL A;  2HKJ A;  2YKI A;  1YT1 A;  3EKR A;  2YK2 A;  3B27 A;  2QG0 A;  3ZM7 A;  2O1W A;  3GIG A;  4AWO A;  1A4H A;  4LWG A;  3G75 A;  1THN A;  3U67 A;  1L0O A;  1PVG A;  5J71 A;  4CWR A;  1YSR A;  3TZ4 A;  4MBC A;  2QF6 A;  4CWO A;  2IOR A;  2YED A;  2QG2 A;  2YE2 A;  4L8Z A;  4U93 A;  4X9L A;  4H85 A;  3PEJ A;  1UY7 A;  5D7D A;  1AH8 A;  4YKU A;  4ASF A;  3A0R A;  2BU2 A;  3VHD A;  3EKO A;  4CWQ A;  1Z5C A;  2FXS A;  2XHR A;  4PL9 A;  4FCP A;  4XKA A;  3LNU A;  1NHI A;  3EHJ A;  3A0X A;  3LPS A;  4EMV A;  3RLP A;  3EHG A;  1S16 A;  3A0W A;  3OW6 A;  1S14 A;  1UYK A;  1BXD A;  2YI6 A;  4EFU A;  4ZKI A;  2WI4 A;  3BMY A;  4XKO A;  2BU7 A;  3CGY A;  3TUH A;  1MU5 A;  3SL2 A;  1UY8 A;  4AWQ A;  4U7O A;  3R92 A;  2IWS A;  3Q5K A;  4YKW A;  3NMQ A;  3U2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...