3CH4B

The crystal structure of human phosphomavelonate kinase at 1.8 a resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
195
structure length
188
Chain Sequence
b'GSMAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphomevalonate kinase
publication title Crystal structure of human phosphomavelonate kinase at 1.8 A resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 65
structure length 188
sequence length 195
ec nomenclature ec 2.7.4.2: Phosphomevalonate kinase.
pdb deposition date 2008-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04275 P-mevalo_kinase Phosphomevalonate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ch4B00
4LJYA 2DCUA 3EPJA 3IO3A 1FNMA 2KB0A 5JRZA 1F2UB 3BB4A 1ZAKA 3KJEA 4DRZA 1E2FA 3HPQA 3ZS9A 3NDPA 3CR7A 4BZPA 1NIPA 3LLMA 3MWKA 2DBYA 3QXJA 2GXAA 4DDWA 1E2GA 4M9ZA 3U4QB 1KDPA 5EUQB 3VNUA 5FUVA 3N2IA 4PPFA 4B3DA 1G5PA 2EFHB 1VIAA 4U02A 2C78A 3CNNA 2HF9A 4A0HA 3FKSA 3ICQB 3P27A 3AVXA 4YMVA 1XP8A 4WZAE 1ZC3A 2XTNA 4GZLA 1XMVA 4KBGA 1QHXA 1DAMA 3W5IA 5J5CA 1KYIA 2FPMA 2JLUA 4RY2A 4B2PA 4HAZA 2XB2A 1T9HA 2F9MA 4DCTA 3MCAA 3ND8A 4YDSA 1XCPA 4G5RA 4HYYA 4TL6A 3U7HB 2OAQ1 3TGPA 3BC1A 1E32A 4OQNA 1M74A 1NLYA 1O3YA 3B13B 3P4YA 1NN3A 2BJWA 4KYUA 1PLKA 3LXXA 5GJVC 3WRXC 1RYHA 3KQNA 5LD2B 1E9AA 4FMCB 3DZDA 2CL7X 5FH9A 1J2JA 3GJ5A 4B32A 4DLXA 4C0BA 5AJVB 4G5OA 4C3ZA 4RD1A 1PLJA 2YOFA 1D6JA 1US8A 2Q9CA 2CHGA 5L3QA 5DO9A 5FOXA 4DLWA 1AA9A 1OFUX 3UMRA 4L5BA 4Z54A 3IHWA 3K0EA 5J4HA 3VU9A 2P6RA 4NH0A 2VP0A 1ZBDA 3T35A 5AUNB 2IF0A 1G41A 2J45A 3AF1A 1GTVA 4B3XA 1CJKC 1IY2A 3WXMA 2JIZA 2OFXA 4A2PA 1LF0A 5FR1A 3H1TA 3LAWA 3X1WA 1DG1G 1KI1A 1Q3HA 2ZIAA 3MWJA 4N0EA 3ZJYA 4EJSB 1KNQA 3BIFA 5CB8A 3ZLJA 4W5JA 5G53C 4Q9JA 4YMUA 4B2IA 3LDAA 1NRJB 1WMSA 2YWHA 3GLHA 2ZRBA 4ERNA 2RHDA 1GG2A 1KO5A 5EXTA 3AVPA 4QJ3A 3GP8A 1VIYA 2ODNA 2FZLA 1GRNA 5H1YA 1OIWA 1R0YA 2D2FA 4HB4A 3TVTA 5E7MA 2QUZA 3QVVA 1CKEA 3NEYA 2PBRA 1S9DA 3ND9A 2XXAB 2ZETA 4XVQA 1DVRA 1KSHA 3BOSA 2CL0X 2DPXA 3K70D 4B6FA 2ZSAA 2ONJA 5LDDC 1Z3IX 4QGFA 4HSEA 1G16A 1Z28A 4NPHA 3TIFA 1E9DA 3IHLA 2O0JA 2FGJA 1DOAA 3GEHA 2FZ4A 3NH6A 2WWGA 3HP1A 5HPYB 1W36D 4Q1AA 1JR3A 3C15C 1OXTA 1NG1A 4XVUA 4L4UA 3GFTA 2ZJOA 5EP2A 1JR6A 1UKZA 5LD2C 3FMIA 1W47A 3IEVA 3ZIAD 1UEJA 2YVUA 1NP6A 2AK2A 1ANKA 3AKEA 2J3EA 3KJHA 3EG5A 2R6GA 2CXXA 5AJYA 2X2FA 1P72A 3FTQA 4JYCA 3A4LA 2ZRFA 4B47A 2V7QD 5GADl 2IC5A 4M9XA 4XIGS 2C04A 1U98A 3K09C 4JVNA 1KSJA 1G18A 3KB1A 3VX4A 1A2BA 4AYTA 5CK4A 3VR1A 1IN8A 2QY9A 1T8TA 5HKKA 5E7JA 1ZVQA 4W5WA 3W6PA 2NO1A 4PC6A 1KSGA 4JLBA 2WWFA 3PUVA 2IYXA 4IKEA 1IAQA 4B2LA 2IWRA 1ELOA 2ZR7A 3NEJA 2C9OA 2FOLA 5C46F 2PLFA 4LJ4A 2IXFA 1EFRA 4XOIA 4EJSC 1E2NA 3MRSA 2X77A 3EA5A 4KJZA 2RB4A 1S0UA 5E4FA 2WSSD 4US2R 1WF3A 1US8B 2A9KA 4PHTA 4DLVA 1WRBA 5DNYB 5L3QB 4D6PA 2OLKA 3CONA 2FSFA 4OQMA 1L4YA 3M1IA 2E87A 4BLSA 2QP4A 1LV7A 2JAQA 2J5XA 2RHMA 2OZEA 2WAXA 4MDEA 2P67A 3VU9B 3RLFA 1KKMA 3ZH9B 4PFSA 4E03A 5JS7A 4KITB 1FFHA 4BFUA 3THYA 1Z5ZA 5IK2A 1XTJA 1HT2E 3JZAA 3SBDA 1P9WA 1RE0A 1LNZA 2FNAA 2QGZA 2EW1A 5EE9A 1T3HA 1I4LD 2ZJ8A 4ZDWA 1ZIOA 1GM5A 2R6AA 1XTKA 4Z1MD 2GXQA 1ZM2A 2ZJZA 2ZI7A 1NF3A 4IVPA 3Q9LA 4DWJA 1WXQA 3DMNA 3NC0C 3WYGA 1SVMA 4JLOA 3GLHB 2D3WA 4HAWA 2F43A 1KKLA 3TQFA 4GDFA 4WVFA 1EWRA 4Q9LA 4TZ0A 4DJTA 2LCFA 3QXSA 3AUYA 3B1WA 1KZGB 4JLDA 3R7WA 3CX6A 1DADA 4QJ5A 4CT5A 1TTTA 1TADA 2EVWX 2OAP1 3RSLA 2G77B 3PJRA 2N42A 2HYIC 1N6NA 1G4UR 3CB4A 4DT1A 1W4CA 4H1VA 5BWMA 5JI2E 4OK3A 4KVGA 4PHFA 5D3MA 4TYYA 1DELA 2PZEA 2VSXA 3CPEA 1T5IA 4TYPA 2YKGA 1S96A 2WM9B 3A1UA 4QBGB 3EZFA 4O2RA 4NHOA 1U8YA 2BOVA 4ACAA 2CLSA 1KTVA 3CWQA 1DAGA 4PQFA 1AGPA 1R6BX 3BWDD 2D2EA 1KI9A 4PZYA 1G5RA 3GLFA 2ZI5A 2KSQA 5L3VA 3FPAA 2FH5B 2QT1A 2IYTA 2WICA 3PITA 4V0LA 2HYDA 3RDPA 1T3SA 4AI6A 1BYUA 1N5KA 1MRNA 1NVXQ 1KI4A 4ABYA 4A2QA 3W3AA 5DISB 3GLIA 3LV8A 1YVDA 4UNSA 3LD9A 3VR4A 2NPIA 2VRWA 1LF5A 4BLTA 2HDNB 2H7VA 3CH5A 2NOAA 2F1IA 3EAQA 3LLUA 1ZIPA 3A8TA 3TUIC 2P5SA 4ZI2A 3AF4A 4YXWD 1SKQA 3ASZA 2ZJBA 1YZUA 4HAVA 4YC7A 4PXAA 3UANA 1LS6A 4KFRA 4MGYR 4NCJA 4FCVA 4OBEA 3LA6A 1HEIA 2VP9A 5FBQB 1BIFA 1MO5A 2ZITA 121PA 2YWGA 1E2QA 4KU4A 1T6NA 1J99A 4Q7LA 4JL6A 5IF9A 1E2DA 1E94E 5F9HA 3KQKA 2CL6X 2XITA 3A4NA 1DAHA 2A5JA 4JVLA 3NIBA 4US1R 4YONB 2R9VA 3GCGA 2ODBA 1CULC 5KNBA 4RFVA 2JLZA 2ZR0A 1E99A 2D74A 4NE2A 2GRJA 2FE4A 4NYJQ 1RYFA 1ZC4A 2H1LA 4B33A 4PX9A 4AKGA 4NCKA 4Q19A 3UPUA 4QOSA 3B7GA 1H8HD 4PAQA 3U5ZB 1ESMA 1YZLA 3THYB 3IIMA 3C4JA 3FHOA 1ZP6A 1Z0JA 3CIOA 5BYJA 2WKPA 3EASA 4PC7A 2AD5A 2DHRA 2O0KA 2QQEA 4MRRA 1E2EA 5BXQC 4LRWA 4M1TA 4LSGA 4BQSA 3EPLA 1MO6A 1OXSC 2GEUA 4OQFA 1FP7A 4KFSA 2QP3A 3S1AA 3WP1B 1UFQA 3EPKA 5CJ2A 1XF9A 3LO5A 1KAGA 3RRMA 5H68A 4URXR 3UXMA 4B73A 3GJ3A 1W4RA 3W90A 3LFUA 2F43B 4JLAA 4JS0A 3VHXA 3AVUA 1R7RA 4M8NE 5AUPB 2ZRNA 2IYVA 1TAGA 1PV4A 1SXJA 3R7WB 2GEVA 3ZS8A 4IW3B 4B43A 1E0AA 4UXIA 1G3MA 3ZVMA 1N6PA 4RCZA 4DT1B 2CK3D 4POAA 1R8SA 1I4TD 2G1JA 3F8TA 2MMGA 4X8OA 5D3MB 3VKHA 2WJJA 2EWWA 3EIEA 4TLAA 4TTQA 2OCPA 3X1XA 1EWQA 5BQ5A 4KLNA 3ZIAA 4LC0A 2R2AA 1KMHA 2IHYA 1E2PA 1GL7A 1M34E 1Z0FA 4ZCLA 4RSGA 4JSTA 4LHWA 3R8CA 4YLGA 2ZAMA 1G20E 2V7QA 2ZRJA 1GIAA 1UF9A 3KX2A 1J7KA 3PUXA 3GLFB 5FL7D 2ZS7A 1ZU5A 5GJBA 1Z0DA 4B76A 3MLEA 5FTKA 3OESA 3VR5A 1D9ZA 3TUZC 3GLIB 3BE4A 4P3YA 4BLRA 3FHTA 2BJVA 3I3SR 2RGNA 2ZI3A 5FI0B 4NMMA 4Q4LA 4DHEA 4BFYA 3O8CA 2AXPA 4MRSA 4QGAA 2W0MA 4KFUA 4KYIB 2OHFA 1N5IA 4A2WA 2B8WA 2XAUA 3BJIC 1IJFA 4WAUA 2QU8A 2EYUA 1KO1A 2WSSA 4P4SA 1CR2A 5B58C 3PCRB 1Z6AA 3K0CC 4ZDKA 2VHTA 4TQAA 2IYQA 1YKSA 2YWEA 4LHYA 3B78A 4QKQA 5F98A 2XZOA 1MABA 2CJWA 2NMVA 4QXAA 4O0MA 2UZ3A 3B1XA 2VP6A 2PEZA 4EUNA 1W0JD 2AKYA 4XTRA 2Q9AA 2GDJA 1UJ2A 3TW8B 3DL0A 4MH0R 4IDQA 3ZDQA 3K8YA 2PH1A 4IDOA 1JNYA 3NBFA 3SEAA 1P60A 2ZRCA 3AP3A 5A5GA 2VP4A 4L9WA 3NBYC 2I3BA 1PUIA 1BH2A 3EX7C 2BC9A 2O52A 3UG7A 3WP0A 1S9HA 2O8EB 3IIJA 4MKHA 4TMKA 5TVKA 4FMDB 3WNCA 3O8BA 4DEXA 1VKJA 4OYHA 1E2IA 2MMCA 3HU1A 3ZVNA 3OHMA 3AKCA 1C4OA 4GP7A 3S1AB 1M2OB 4NTZA 4Q48A 2V55B 2REBA 1IXRC 2CLDX 3C14C 3MG9A 2CDNA 4HAXA 4I99A 1G8FA 2AFIE 1AS0A 1TQ4A 2QTHA 2IHBA 4GPTA 3MAAC 5FBWB 2HUPA 3R9XA 2V6JA 4OK6A 4QL3A 2ZRMA 2ZYWX 3H0KA 3MFYA 4EIWA 4HEJA 1SXJB 1E9SA 2XEXA 4Q1DA 4AKEA 1RJ9A 1UBCA 3W34A 5JI3E 2OBNA 1KJZA 5BN5A 4BUJA 2BWJA 1A2KC 2BDTA 4AD8A 5EP4A 4TYWA 4Z8YA 3WHKA 4BRUA 3BH6A 2GVDC 4D26A 1IN6A 2IXEA 1X8JA 3QENA 4AG6A 3CH4B 4YQFA 1GP2A 4NZYA 3KKOA 4XSGA 1YRAA 1NBMD 2JJ8A 5LB2A 3C16C 4YMSA 1C9KA 1LVGA 2VSFA 2WSMA 1KMHB 3G0HA 3EC1A 4V0OA 1JJVA 5LBIA 1A4RA 5CJPA 4JMPA 3GFPA 4Y0VA 1EXMA 3UMFA 3BGWA 3ZZTA 2DFNA 1NLZA 4G01B 4YXWA 1OKKD 2WBLC 1EFTA 2FA9A 3SNHA 3AP2A 1N0UA 1II9A 1RVDA 2ZS9A 2QM7A 4V02A 1OFHA 1P9NA 5KDDA 4JLNA 3D6TB 4DZZA 3QEOA 2O8CA 4LWZA 1CR0A 4QHTA 2F6RA 2XTMA 4LHZA 1Z06A 1Q20A 2AWOA 2GESA 3K9LA 3TR5A 4PHGA 3U44A 4OI0A 5KSOA 1P73A 3ICEA 3AVTA 1WDTA 2AHOA 4PR0A 4PSKA 5JZVA 4N1AA 4IXMA 1D8TA 1BMFD 3WYAA 1U0LA 2KJQA 2EYQA 3MSXA 5A0FA 3RC8A 1LW7A 4R98A 3FFBA 3E2IA 4FIDA 4LC1A 5FBLB 3VR6A 4B3BA 3IQXA 2ZROA 1UM8A 1A1VA 4DLTA 1NKSA 1SULA 2OCAA 2FJUA 4EFMA 4C7OA 4P4SB 2BMEA 4XJXA 4I1UA 4MGIR 1IN5A 4A6PA 2OEPA 4YMWA 2XJ9A 1HH4A 3CZPA 1OH6A 1OIVA 3AUXA 1IXZA 2DWOA 2G6BA 2IYSA 3EXAA 4TLBA 4UNRA 3L8ZA 3RHFA 2CJWB 3VHLB 1H8HA 1R8QA 3QI2A 1Z0IA 2J0UA 4L15A 5CDFE 2FPKA 3A1VA 3QKTA 2QROA 2REOA 5ANRB 4CYMA 3KFXA 4J0QA 1RFLA 5EJEA 2R65A 1XTRA 1FUUA 4TLCA 5A4JA 1SXJC 4FMCF 1P7CA 4D2IA 3ADKA 1N2CE 1SQ5A 1N5JA 1P3JA 3QXXA 4E22A 4QFMA 1VG8A 4IOMA 1N6OA 1P2SA 4A8JA 2HT1A 2ZRIA 2H17A 4IEEA 3VQTA 1ZM3A 5JHHB 1GZSA 1DEKA 4DCVA 3AVVA 3QY0A 1NJGA 3GLFE 1E4YA 2A2ZA 4B44A 3GLGE 2FG5A 2JJ2D 4HDOB 4KSCA 1CXZA 3M4YA 4A82A 3PEYA 2YJTD 4AY2A 1HV8A 2V1XA 2IL1A 2GF9A 1EESA 1G7SA 1DTSA 4PQRA 2ZU0C 3NC1C 1AM4D 2PL3A 2AX4A 3PFIA 2GCPA 4LBZA 4TQ9A 1P61B 1R2QA 1HA3A 4IDPA 3UG6A 2YC2C 3BFKA 1UAAA 4GOKA 2PJRA 5KSPA 2W58A 1TQDA 5CLLA 2Y8EA 5JEEA 1RJ9B 2OG2A 4MYHA 1V43A 4PPNA 1JI0A 1DE0A 1T5LA 2RGXA 2ZSDA 2NO6A 5EXPA 1CR1A 4U00A 2RGNC 4M0LA 1CIPA 4XVRA 5KSZA 4JKIA 1N25A 5KPDA 2ZVQX 4LHVA 2W0SA 3TLXA 5JRJA 4Q4JA 2IYWA 3I1FA 5FL7A 3SFVA 4LBWA 1IN4A 1G19A 2WWXA 3ECCA 3F3YA 5FUYA 2XNDD 5FTMA 2RGGA 2Z5FA 4A1FA 2LWIA 1AJEA 4ILEA 5KDLA 1W4BA 3K9GA 4RZ2A 1OXVA 4QHSA 2BEKA 4QRHA 2C95A 2VQSA 1KK1A 1A82A 4BECA 5CK5A 3LW7A 4K81B 1WP9A 4EPRA 2FSIA 2F3RA 2PJZA 5G3YA 3RRZA 3WY9A 1QF9A 2REXB 2UZIR 4QHYA 2P6UA 1AIPA 2G3YA 3BD9A 1D2EA 2P3SA 4OJKA 1DBSA 1SZPA 1MO3A 1FUKA 2Z43A 3SE0A 4RFSA 2J7PD 1N6KA 4OI4A 3U44B 4WZBE 4XD7D 2BMFA 4LJ8A 621PA 2QORA 2Z83A 3SC3A 3D3QA 4Q47A 4Q1BA 2OESA 3Q5EA 4TSFD 1SHKA 5KDOA 2BBWA 2OFOA 3RRNA 2WJGA 4ZPXA 4CT4B 1E2MA 2WWYA 1ZM4A 2G88A 5H70A 4C7OB 1W0JA 2RGAA 3LX5A 1W5SA 5J40A 4OI1A 2B21A 5EE3A 5TDHA 1AKYA 2VP2A 3EARA 3MJHA 4KV9A 4CRWB 3DOFA 2I4IA 1MR3F 3AGPA 2KWIA 4Q9HA 3V4FA 2J7KA 5C1BA 4IOLA 4P0TA 2J0UB 4US0R 2BBOA 3U3MA 4RKEA 1KJWA 3SYLA 1Z6XA 2WKQA 1T3LA 2FEMA 3D7MA 5EP1A 1KI6A 4TMTA 4AKHA 1N0VC 1XD9A 8OHMA 1Q0UA 5DYGA 3RRYA 1X1RA 2ZI6A 1D2MA 4A8JB 3AVOA 2R62A 3BB1A 5J4YA 4DLYA 3A4MA 5C18A 4M1KA 3QIAA 3QVUA 1TF5A 1UBEA 2MSCB 3PVSA 4M1SA 4LV5B 4V03A 6Q21A 4PZLA 1E98A 4DLZA 3NBZC 1ZUIA 4U7DA 1Z22A 2XTZA 4LYFA 2YC4C 4I81A 3I8SA 1ODFA 2PZFA 1IOZA 1G3UA 4TWZA 2CVFA 3W3ZB 1S8FA 2ATVA 4EQ6A 4R2IA 3NWJA 4Q03A 2B8TA 2FMXA 3UATA 4AWXA 4F4CA 2ZVPX 2DFTA 3NG1A 1XXHE 4I1VA 2QENA 4QM7A 1Q1QA 4BFTA 5DH9A 2WIAA 4MYUA 4BEBA 2IW3A 3SN6A 4HZIA 4BFSA 1AGRA 2V6IA 1EGAA 2WJHA 3T06B 1NBMA 1PZNA 1SXJD 4LDJA 4BFXA 2QAGA 4S2EA 1HE8B 1H65A 1XPRA 3PG5A 2OFWA 2ANCA 3IBYA 4Q5IA 1YJ5A 4URUR 3Q72A 2VO1A 2A78A 4AYWA 3B5JA 1Q1BA 4Q4JB 5B2ZA 3DKPA 1OSNA 2QEQA 5BW8A 2OILA 3PV0A 4A0GA 4LPKA 1QHNA 1OKKA 1XTIA 2IYYA 3GJ6A 4GZMA 4EPTA 4C0AC 2PLRA 3KQLA 4M4SA 2F9LA 3SI7A 4CEIA 4QM6A 2OCBA 3HU3A 4AYXA 3IPXA 2J0VA 1U81A 2YOHA 4L9SA 2CMKA 2MSEB 3DKVA 1JALA 3QXCA 3SYNA 1AQYA 1L8QA 4WA7A 3W8RA 5JSZA 1QHIA 1XMSA 2ZE5A 1BMFA 2HXSA 3O8DA 4P31A 2WJVA 1XFAA 5IHPA 1B23P 2WAYA 2H16A 3CRVA 4LJ6A 1NVWQ 2ZQ5A 3MMPA 1VMAA 1IONA 2VHCA 2RGBA 4RFSB 2CHVA 1U2RA 4IEIA 1DS6A 4RD6A 5JLJA 2FGKA 4A8JC 3C5CA 1KMQA 2X1VA 2XZLA 3F0TA 2YWFA 1OFTA 4M1YA 4JJZA 3W8NA 5M04A 4B75A 3OIYA 4L8GA 1QHGA 4D4MA 1SKYB 1MKYA 2BMJA 3V9PA 4ASUA 1UBFA 4LPSA 1XJCA 3RNLA 2ZRGA 721PA 1J90A 1RRGA 2GZHA 2NPFA 4IDHA 1R10A 1XX6A 2H92A 1Z8FA 1A5TA 3VR2A 3U61B 4JIMA 1QRAA 2PZGA 4GOXA 4M9SA 4LV6A 4HB3A 3ADCA 3H4MA 3VKWA 3UMSA 3EZ7A 3MUFA 1WQ1R 3LY5A 3RS3A 3GQBA 4G5SA 4JBYA 3N2EA 3QG5A 4BLOA 3RANA 2ZRDA 5TV2A 1YU9A 3EW9A 4LJAA 1KI6B 4TL7A 2JJ2A 1QHHA 2GF0A 4ZV4A 3K0CA 2VLIA 1XBTA 4A15A 1XNJA 2GZAA 3DEFA 1EX7A 3TW4A 1W4AA 2AD1A 3TH5A 3FB4A 3EZ6A 3DPUA 4DXAA 3CX7A 3IUYA 1XEFA 1IXSB 4TMZA 1Q57A 3NHBA 1VG1A 3I5YA 2W00A 4PTLA 4QBHA 2ATXA 5FPTA 2C99A 3RC3A 2WJIA 3ZYCA 5C4GB 3WBJA 4ZCIA 1E9EA 1P2VA 2P0EA 5K8UA 2XOKD 4EQ6B 1YR7A 3RABA 4ACBA 1S2MA 4BFZA 4BASA 2CBZA 2NGRA 4ON9A 1OFIA 521PA 1VHLA 3REFA 1R5BA 2FU5C 1E1QA 2WKRA 3BAFA 3CKLA 1EFCA 2XNDA 4RD2A 5DGXA 4C2UA 4W7SA 4Q7MB 1OV4A 1NSFA 4DBLC 2QAGB 4UNPA 4GMDA 5KNCA 4L16A 2D4HA 3OE7A 2JLXA 4AKIA 1BS1A 5EZ5A 1OE0A 4OHZA 2BHRA 2H5EA 1W46A 1G7TA 2RCNA 1P9RA 2RMKA 3CLVA 2OUKA 1VPLA 3Q85A 4S35A 1TX4B 4NU0A 5JECA 2BV3A 4CEIB 2HF8A 4MGZR 5CM9C 3K0SA 2BEJA 2A5DA 4NYJR 3FMOB 2PCLA 1JJ7A 3E70C 1FX0A 1XCMA 2ONKA 2J7PA 2W2TA 3AKYA 3I92A 4XD7A 5DE3A 4OHVA 2QZ4A 5BN3A 5DIFA 4QNRA 5JSZB 1XCGB 1HE1C 2N46A 2OBLA 3NTUA 4D0LB 4OQXA 3FHCB 4OKSA 3IPYA 3GFOA 4TSFA 3CR8A 5K8TA 4V0MA 4W5HA 4I4LA 4QGHA 4LBYA 4HI0E 3QG1A 3U60B 5CIWA 1NMYA 3PENA 1WCV1 3OAAA 3N5CA 2ZRPA 2JLYA 4GL2A 2R44A 2JJ1D 3QKRA 3SQXA 1SVKA 3EC2A 2QGNA 4IOKA 2BBTA 1XEWY 2VBCA 4Z8XA 1FMLA 1N3BA 2GK6A 1E3MA 2VL7A 4Q1CA 1IBRA 4FD2A 3RS5A 2OXCA 3RWOA 2J9RA 4HUQA 5AWFC 3SJAA 1KOFA 4HB0A 1HTWA 2ZRAA 4F4IA 3SS8A 1NIJA 3SJCA 2O8FA 5JBQA 4R9UC 2L0XA 2Q9BA 1JXOA 5FPKA 2FSHA 1L7VC 3P20A 4UKDA 2O5VA 1BOFA 5AJXA 5LPNA 2ZS8A 4UNNA 2YINC 1E9BA 1DO0A 3DO6A 4GFDA 4QC2A 2OSBA 3CW2A 1COWD 1VYTA 4MQBA 5JCPA 2VSOA 2QTVB 3IGFA 1QHHB 2IS1A 5LB4A 1P6XA 2QAGC 3IDQA 3Q3JB 4FW9A 1GNQA 4I1OA 3A37A 1NSTA 2PT5A 5GVSA 4CDGA 1PLLA 3QOFA 4LZZA 1Z2AA 4UNQA 1KSFX 4C4PA 5EUMA 4QNMA 5CITA 5CM8B 5KO2A 1JAHA 2NO0A 3IEUA 3QNUA 221PA 4QJ4A 5FL3A 1GKIA 1J8YF 2GA8A 3BBPA 5HCNA 1K6MA 4D0GA 1CJMA 2ZJYA 1YZQA 3TK1A 4JYBA 3OEHA 1QDEA 4FMDF 3VKGA 4DSNA 2JATA 4EPWA 1RRPA 1TU4A 1XTQA 4R71A 1E79A 2XB4A 3PQCA 3EPHA 4HAYA 1G3QA 2QP9X 1XU4A 2GCNA 1GSIA 3LVQE 4HLUA 1F48A 2Q3MA 4TMWA 4OL0A 3AM1A 1CEEA 4PAOA 2P2LA 2AWNA 4PC1A 3HYTA 2CNWD 4HLDA 4JT4A 5HCIA 3U3RA 4DSTA 2JLWA 4FWTA 1W1WA 3IIKA 2ZANA 2WTUA 2DB3A 1K5DA 2QMEA 4QG7A 1E9CA 3RSOA 2QL6A 4M9QA 1RIFA 2IYUA 2NZ8A 4JVMA 3LBNA 1XDBA 4NCHA 3TJZA 2WMOB 4IRUB 2XJ4A 4JBWA 1Q22A 2XZPA 4DEYA 1KY2A 1AKEA 5G41A 4II7A 4MYCA 1XMIA 1TF7A 4M1OA 3MD0A 2C2HA 5L3RA 2GWHA 4ZKEA 1KY3A 1FX0B 1QG4A 5DN6D 4PPQA 1SVSA 1YQTA 4MGKR 2P5TB 4KCGA 3JVVA 4Q1EA 2VH5R 1SVIA 4D4KA 1BO6A 2GAAA 2CCGA 4LJ5A 4XWKA 4DSOA 1OXUA 5CYOA 3C8UA 3T34A 3F5FA 1ZYUA 1IN7A 3GLHE 3KTAA 2IS6A 1GUAA 3NKVA 4D25A 2VTKA 1UEIA 3QKRB 3TQCA 3PUYA 4RCYA 4QGGA 4ESVA 3AVYA 2JEOA 3U3JA 4UJ5A 1MO4A 3RS7A 1R0WA 3AVQA 4M2LA 1KO4A 3SU8A 2BCJQ 5CIQA 1BKDR 1NVVR 1Z0AA 3WBKA 4HUQB 1GNRA 4MA4A 5TY0A 4QBFA 3AVWA 421PA 4BZQA 1YE8A 3CRRA 3MWYW 1NBME 1JAIA 2O8FB 3DM5A 1UKYA 1ZUHA 3GJXC 2ZUBA 5FR2A 3P32A 1WE2A 1E2KA 2WJYA 1Q44A 2GNOA 5HE8A 1FOEB 2A5YB 1JQLB 4FINA 3W6OA 2YYZA 1RRCA 4KLZA 1ZRHA 4OHYA 1JR3E 5B57C 1OH5A 4A9AA 2VIIA 1E2JA 1D5CA 2KBFA 1GWNA 4Q02A 3T1VA 1W2GA 4IVQA 4AG5A 4BEJA 4IFBA 5AUOB 5DYIA 2ZRLA 1G7CA 3KDSE 2XOKA 4B48A 2Q0HA 1XMJA 4LBVA 4U5XA 1UPTA 2A5GA 4HDCA 1AK2A 2UKDA 5SZIA 5CLQA 4DIDA 2HJVA 1JEEA 1KAOA 1WB9A 2PX3A 3M6AA 1NVVQ 1Z6GA 1RZ3A 3DMDA 4C0KA 1LB1B 2D06A 3PUWA 1GITA 2ZI9A 1IQPA 2ODWA 4TZ6A 2BCGY 2IEZA 3L43A 2WPDA 1VCOA 3NHAA 1HURA 2YZ2A 3KKMA 3TUJC 1WA5A 2B6HA 1EK0A 4LJ7A 3B1YA 1VG0B 3AGQA 5BN4A 1Z2CA 1WBDA 3IBGA 3K53A 3LW8A 3QF4A 1R0XA 5GVRA 1DAIA 4D4JA 1Z29A 2WWIA 4JLJA 2F7SA 1CRPA 2FFAA 3SQWA 1AS3A 1FMJA 1ZNWA 3VX3A 5HZKA 3PEWA 1PUJA 5CYPA 4IFEA 2QA5A 2X19A 3A1TA 1FL9A 2DFLA 3A58B 4C30A 3QJYA 1GKUB 3UKDA 1E4VA 1LS1A 2QQ0A 1DAEA 2FWRA 1ZNXA 1Z0KA 4PC2A 2FV8A 1T8UA 2OM2A 4Q9KA 5DLQC 4FN5A 1U94A 1GILA 2EFCB 1VTKA 2JJ1A 2HV8A 2C03A 3X2SA 3HDTA 1IJEA 1KDRA 1QVAA 4WXRA 2AKAB 1TEVA 4Z51A 1KIMA 2ZYTX 4LYJA 3CRQA 4V0KA 5JJKA 4EDHA 4TQUS 2QPOA 3U6KA 3FWYA 4R2HA 1E1RA 4I1SA 4B34A 3U7GA 3FVQA 3T1TA 4WOPA 2PEYA 3KTAB 1XJ0A 1W44A 5JHGB 2ZAOA 4JJKA 3PXGA 4EKDA 4G3XA 1CU1A 3AEZA 2EU8A 3P4XA 3E5HA 5SZKB 1CS4C 1MOZA 4OJQA 1E0KA 3QKSA 4BLPA 1TMKA 1X3SA 4TTPA 1GVNB 1VCIA 4C0LA 1COWA 3OZXA 1NN1A 3HJNA 1Z83A 1M7BA 4ASUD 2GCOA 3KJIA 5KOYA 3CWZA 1CBUA 1UADA 5FOWA 1CF4A 4LGMA 3B1ZA 3K9HA 1K5GA 1EFHA 2YHSA 4G1UC 4Q4AA 1OHHD 2GJAA 4PANA 4CZ2A 3A6PC 2W2VA 3DVLA 3GEIA 1I2DA 2GHIA 1IM2A 2XNSA 3I73A 4HLUC 4MUAA 2Q6TA 2HLDD 4KXFB 3RWMB 4A6XA 3W5JA 2QMHA 2RGCA 5C4MA 1ZNZA 1RPZA 1VYVA 2ECKA 3QE0A 4MRNA 4OHWA 4GI7A 2Z6VA 1AZSC 4KO8A 1ZM9A 4RZ3A 4UQOA 1AQUA 3HPRA 1GRQA 3GLIE 1RC8A 1FZQA 5J47A 3R9WA 4NDZA 5B30A 3CPHA 1Z07A 4Q00A 2H57A 1KI8A 3KKNA 3WRYC 3SR0A 3I32A 4BFVA 5IT5A 2OE2A 3MGCA 5SZJA 2VP5A 2VHUA 4Y0AA 3K0FA 1DAFA 4DDVA 1XJQA 1L2TA 4E07A 1S4QA 4V0ME 2ZE8A 2CNWA 3I4LA 1Z6YA 4IJMA 4MKGA 2KE5A 2ZSEA 4HZUA 5JCZA 3BS4A 3KKQA 4RZUA 3KQUA 3RYTC 4LV8B 1TPZA 3L82B 1W2HA 2R6CA 4H1UA 4MUBA 3TAUA 4G5GA 4O3MA 1E1QD 1TEXA 1II0A 1KI7A 1T0HB 3IO5A 5FFMA 4G5QA 5IDVA 3GMTA 3GPLA 1Z47A 3QF4B 1KO8A 1ZD8A 2BKUA 1OYYA 3WMGA 2QPAA 3U4QA 3LBHA 5DN6A 2ASEA 5JEDA 3OE7D 1GRRA 1I2MA 2K5UA 1TF2A 2WVJA 2ZEJA 2UVQA 3CX8A 2VHQA 4D81A 4B3GA 3QKUA 3REGA 4URYR 1O87A 3AQ4A 2IYRA 3I72A 1H8ED 2X8AA 3KXIA 1G3IA 3QXHA 2FX3A 2MSDB 2E1RA 1GL9B 3LNCA 1JPNA 1JECA 4LYHA 4EAQA 2F55A 2RH5A 3HR8A 2I1VB 5IRCD 2OBMA 1UKVY 1NKTA 2RKOA 2H8KA 2IK8A 2WOJA 1WBBA 4MDFA 2Q21A 3THWA 2D7CA 4TYQA 3OF5A 4X8MA 1KI3A 1VG9B 4NBSA 1Q3TA 1LY1A 3FKQA 4CF7A 3I5XA 2F1RA 1YZKA 2FF7A 3OAAD 1R5NA 2J46A 2IYLD 2AFHE 1OF1A 2VA8A 1Q1ZA 1SXJE 2C9CA 1U90A 2OO7A 3NH9A 3WMFA 4N0DA 3FE2A 3IQWA 3E1SA 3KKPA 3LQRA 1Y63A 2QRNA 4P4UA 1FNNA 3T5DA 4RD3A 1RW4A 3QKSB 5HR5A 1ZM7A 4F7WA 4JLMA 4JSYA 3CO5A 2R6DA 4QBIA 3U3KA 2GKSA 4TN1A 2ERXA 2X2EA 5HZHA 3PEUA 1G6OA 3CF0A 3TR0A 2XGJA 1F6BA 3JZMA 3L2OB 3L0OA 4TTRA 2GCOB 2O8BA 1Q12A 2FN4A 3R8FA 4LOAA 3RS0A 1PVOA 5C2JB 1W7AA 5KU1A 1TU3A 3IILA 4Q4AB 4CGZA 3FDIA 1U99A 4KAXA 4D80A 4M21A 5F9FA 4CVNA 2KI5A 1OYWA 4LK2A 3SFZA 3J81k 2IEYA 2O0HA 2OT3B 1XRJA 2C9YA 1F2TA 2YOGA 1AN0A 2WWWA 3EWAA 2RGDA 3OIUA 4JVSB 3GJ7A 3QBVA 5KUTA 1AZTA 2NQ2C 4AURA 3SJBA 2BVNA 4IXNA 1TNDA 1S3SA 4C9BA 1P5ZB 3KUDA 3ASYA 4PO8A 4FXPA 4M53A 2QPTA 1QG2A 4P33A 3H86A 4BLQA 1A7JA 1IHUA 3FOZA 1K8RA 3BH0A 3K0FB 3OFNA 2NO9A 1CJVC 2Q3FA 5EQTA 2G83A 3BFXA 4TL9A 1U8AA 4Q4HA 3WMEA 1G1MA 2HT6A 2ORVA 1B0UA 3W6NA 2KBEA 4HZUB 2QM8A 3OEHD 5KSYA 5EE0A 3I61A 1G3RA 5H8WA 4PO9A 4Q7KA 1VECA 5FOVA 3QBTA 4ZO4A 1E79D 4RKFA 4NYIR 4RD4A 1QBKC 3FGNA 2QG6A 4HUTA 2FDCA 2XSZD 1E0SA 3KXKA 4LX0A 4IHQA 4HAUA 3WYFA 3NBXX 3SHFA 1KZ7B 3ZZ0A 2W2XA 3BFVA 2DWPA 3BRWD 1G17A 3FMFA 1M8PA 1XPOA 2CCKA 3SJZA 5DI3A 3UIEA 2QAJA 4IVRA 2JGNA 1U9IC 1DAKA 3T1OA 3CRW1 4MYTA 2QTFA 3M0EA 2AL7A 5FBRB 3CF6R 1ZINA 4NCNA 3K0AA 4BFWA 1N5LA 4JLPA 4HATA 2WWHA 4DCUA 5ELXA 4UXJA 2IBMA 1SGWA 2SHKA 3V4RA 4YDHB 2W6ID 3V00A 1ZCBA 1OW3B 1FQKA 2IWHA 4A0RA 1S1MA 4D82A 3R20A 3L0SA 1Q21A 3CNOA 2PT7A 2V8OA 1OIXA 4MITA 5KPJA 1EG7A 2V3CC 2G0TA 2N1BA 2J1LA 5GJWC 3EIQA 4KVAA 4Q01A 4A92A 4NYIQ 1XD2A 3THWB 5L3SA 1JPJA 3DZ8A 3EA0A 5JJIA 1R4AA 4LY6A 3R9IA 3C41J 2ZXUA 3AF2A 2QE7D 4DCSA 5E95A 2PX0A 1MH1A 4JLVA 2AR7A 1X86B 3BK7A 3CZQA 1Z63A 1VDZA 3B9PA 2IYZA 2ZYVX 1CLUA 2GBLA 4BRWA 1OHHA 4DC9A 1OLOA 5FPSA 1HQCA 4K8OA 2CE7A 3KXLA 1QZXA 3IKJA 1F60A 3T5GA 3LRPA 2GXSA 2QN6A 3OIWA 2FPLA 4O2LA 3X1ZA 2HLDA 2WV9A 3RVBA 1DG3A 2GILA 2PCJA 2VPPA 3L8YA 5KHOC 3LVRE 2O8BB 4ESHA 3N70A 4FCWA 2DYKA 4DB2A 2F1JA 1LTQA 2JLSA 1G6HA 2V9PA 2NG1A 3VMFA 1E9FA 4CIDA 3SHWA 2ZUDA 2BMDA 3AF0A 4Q66C 4XSHA 2WHXA 3G5UA 2OCYC 2ODEA 1HQYE 1F2TB 2NTYC 2Z4RA 2BM0A 4PC3A 3EZ9A 1JB1A 4DDTA 3FMPB 5KNDA 4DLSA 4ZIRA 1M1YE 1N6HA 4GBMA 4NKRA 4M1MA 4DIEA 3KFVA 1NN0A 3B9QA 5JS8A 4JKYA 1OB2A 2IUUA 1NN5A 2IXGA 2HEIA 5G40A 2QT0A 3LXRA 4G0NA 5SZHB 4MKIA 2V54A 2ZREA 2C98A 2JCSA 4PPGA 5FBVB 1TUIA 5J4VA 4P4TA 2GAOA 4URVR 2ZI4A 3NVAA 3OEED 4Q4HB 2JDID 2OXRA 3C5HA 2PMDA 1NNEA 2GXUA 4BPBA 1HT1E 4JL5A 4F4JA 4B71A 1W5TA 3ETLA 1TQ6A 1YR6A 1KO7A 3U7EB 5AR1A 4NYMR 4B3CA 2J0SA 2WPDD 4UJ3A 5D3QA 3CBQA 1XEXA 5EZ6B 2NIPA 1HYQA 4TT3D 1H8EA 2Z0MA 3K9NA 3LX8A 3SDZA 1TUEA 5EXSA 5CDFA 1N6RA 3H2YA 4XWAA 1CJTC 2B7CA 1MRSA 1E9RA 4KHZA 4DLRA 5FPHA 3Q7QA 2NZJA 4PAMA 2IS2A 5DI3B 1KK0A 4LJ9A 3VTKA 5JWOA 1UDWA 1KK2A 1J8MF 5L8VA 2EFEB 3K0AB 3TSOA 1W0KD 1ZCAA 2H18A 4KFTA 4DVGA 1QVRA 4JZKA 1X6VA 2FFHA 3GLGA 3B85A 4LCBA 2IX3A 2W83A 3ZZUA 2W6JD 3LWNA 2Z4SA 4E09A 1SVWA 2A30A 4RJLA 1N6IA 2FFQA 5FTJA 3QEJA 5TB5A 1KDOA 2JASA 1EFUA 1XZPA 4KSBA 4ZI3A 1R0ZA 4OQLA 2WZQA 4NYMQ 1XD2B 1RKBA 5L3SB 2J87A 1W48A 2V4ZA 5TXGA 3NXSA 5EE5B 1E1RD 3RS4A 2P65A 5JJLA 1G4AE 2DWQA 3WNBA 4C0SA 1GKYA 1CTQA 2D62A 2NO7A 2QSYA 1NY6A 2I1QA 2PMKA 2TMKA 1Z08A 2HCBA 4DDUA 1OJLA 4ITRC 3ZVRA 3RAPR 4Q1FA 1LFDB 3H84A 1FPMA 1PJRA 3VFDA 1ZD1A 2O8DA 4GNKA 4CEJA 4UXHA 4F92B 3FFAA 4OHXA 1DARA 4X8LA 3KB2A 2IF2A 1ZNYA 4B74A 1G5TA 3KZ1E 2A5FA 3WNDA 1ZW6A 5F3WB 2CCJA 2ZPTX 4WZ6A 1M7HA 1ZJ6A 2VEDA 4HLQB 2ZSFA 2GJ8A 2ZSBA 1AS2A 3FYHA 2EQBA 2ERYA 3THXA 5JWHA 4BWYA 4PZZA 5FOSA 2GTPA 3TMKA 3QSYA 1XD8A 5K8LA 2QSZA 1XPUA 3AH8A 2AK3A 3KJGA 1N0WA 4LYAA 3TKLA 4B35A 4ZIRB 3AF3A 3B8HA 5JWRA 5AJWA 3BXZA 3C7KA 4C0QC 3VAAA 1OH8A 4WW0A 3Q7PA 5FUWA 1XB2A 1ZD9A 2A3RA 4EFNA 1ESNA 4AIIA 4NP6A 4B6EA 1Q1EA 4H9GA 1DO2A 3GJ4A 4M22A 3LBIA 2AN9A 2BBSA 2OLJA 1U8ZA 2C5LA 3OIVA 5K8IA 5FOTA 5TARA 3ADDA 1JBKA 4PSAA 2XSZA 1N6LA 4N3NA 1TL7C 2ZM5A 1KGDA 4X8HA 5FPYA 1FP6A 2G0NA 3T1QA 1NVUQ 3LH5A 3ZGXA 1G21E 1UDXA 1SKYE 1YRBA 4R7ZA 4A36A 1E6CA 3SOPA 2ZJ2A 4BE7B 2J0QA 4EPYA 4DUGD 3B6EA 1JEDA 3B2EA 2IS4A 2V1UA 3L0PA 1NMXA 4M1WA 4TMVA 1XEXB 1W49A 1MV5A 2GZDA 3AV0B 2XX3A 4BGDA 3D31A 1Y3AA 2RGEA 2C77A 4C0HA 1J70A 2C8VA 5AJZA 4OI2A 2W6IA 1FQJA 1JQJC 1P2TA 1X1SA 2EWVA 2GEDA 2Q3HA 4ARZA 1OH7A 2JLVA 2WMNB 3TSWA 1NJFA 1SVLA 2ZU6A 4EPXA 2GBLC 4GRAA 2FSGA 3QPVA 2ZR9A 3O47A 3UWOA 3AB3A 3A1WA 2GVZC 3A1SA 4K46A 4JT2A 3X1YA 1XZQA 4Q21A 3O8RA 4HDQB 4YMTA 3GLGB 2QE7A 3GD7A 3PEVA 4EPVA 2GJ9A 3BERA 4NL4H 1NMZA 4GP6A 3U3OA 2CE2X 4ZCMA 1VYUA 3QPWA 5FOUA 2EFGA 1KDTA 2ZE7A 5DHFA 3RS2A 2FFBA 1X8LA 3FKSD 1XXHA 4FI3C 2B92A 2JLQA 5F2EA 4WXPA 3DDCA 1E2HA 4MRPA 1BYIA 4TL8A 2VF8A 2OV2A 2O8CB 1ZU4A 4P32A 1D9XA 2ZTSA 1F5NA 2HCJB 4MKFA 3CRMA 5KTYA 1UKEA 3BORA 3EZ2A 3Q8XB 4JBXA 5EE1A 3CF2A 4RD0A 3KQHA 4E5UA 2O8DB 4CEJB 1OXXK 1KK3A 5E3HA 1P2UA 1FW6A 2ZE6A 3ONWA 1ZMXA 2CLCX 1W36C 1D2NA 5BYKA 2P6NA 3QPUA 2J41A 3MWLA 1II8A 3ADBA 4FMBB 5DI9A 1NI3A 1G291 4DLUA 3UWKA 1IY1A 4ZDIA 2VHJA 1YZTA 3THXB 2ZYUX 1E0JA 4CEHA 4Q7JB 1GL6A 5JMTA 4ZDJA 3B60A 3CUEF 2QBYA 1GAJA 1T91A 2GK7A 2LKCA 4Z1MA 2O8EA 2HXYA 5J4KA 4Q18A 1KNXA 1M6NA 3OEEA 4PHHA 4TMXA 4C0JA 4RVCA 2JDIA 2F3TA 1X8KA 3A36A 3MJRA 3VNVA 3TRFA 1C1YA 2QNRA 2R6FA 4ZKDA 3UK6A 1NG9A 2JIZD 1IY0A 2ZRHA 4DB4A 1Z6TA 3TBKA 1G64A 2ZRKA 1ETUA 4TT3A 5P21A 3OFND 4A4DA 3HYRA 2ZJ5A 1S3GA 5DHAA 4DSUA 1SVOA 1E2LA 1CRQA 2QI9C 3SBEA 3T15A 3TVDA 4XH9B 4V0NA 3GJ0A 4WIAA 4XWOA 3K70B 4F91B 4GSYA 2QMOA 3D8BA 3HR7A 1G7RA 2ZJAA 3TAHA 5GJCA 3ZVLA 1G8GA 1OT3A 1YR9A 1HY3A 5JFGA 3QQ5A 4NCIA 4GT1A 1CJUC 1W36B 2R8RA 2EFDB 5FUXA 1F2UA 1CR4A 4AC9A 3CPJB 3L0IB 1W0KA 5G3ZA 3EWSA 1P75A 2RAPA 1FTSA 4MRVA 3I62A 3B82A 5J4LA 4ARZB 3I8XA 3GEEA 2W6JA 1NL3A 2ANBA 5HTKA 3T61A 1P62B 4A0FA 3TSZA 2JLRA 2BKEA 4O25A 4FCTA 2WIBA 3GJ8A 4KI0A 4PSVA 5AUQA 3THOA 1JR3D 3EIHA 3B1VA 1VCMA 3AKDA 3BB3A 3W9YA 4EFLA 1GNPA 3G82C 4LI0A 5AK0A 1YZGA 1GFIA 4Q9IA 1YR8A 3SYKA 3PUZA 1F3OA 1XWIA 2YNMA 1QHYA 2C96A 2AXNA 1CP2A 2CHQA 2CVHA 4KODA 1RRFA 4GMXA 3ZQJA 1U9IA 1T0JB 1G8HA 2DY1A 1XEWX 1U0JA 1XXHB 2GJKA 2ZUCA 2GJSA 4B3FX 1SHZA 4W9MC 3QUSA 2DR3A 4BZXA 1VHTA 3LQQA 3U7FB 3CM0A 1KHTA 2WOOA 5EXXA 3T12A 1ONBA 4DCNA 5HE9A 3NDBB 2QMUA 1GOTA 5HKKD 2LKDA 1P4SA 1S1CA 3P1JA 3K1JA 5FTLA 4FWIB 3DOEA 2IUTA 3KL4A 5TMPA 4F38A 4WBSA 3VR3A 4D0NA 2QRZA 2ORIA 1G9XA 2JA1A 3WHLA 1MABB 1OPXA 3DHWC 3HU2A 2D7DA 5UKDA 3K09A 1EFRD 3CNLA 2E9SA 5EP3A 4URWR 1NY5A 1TQ2A 4IOJA 4JL8A 4F93B 3TE6A 1G8YA 4LHXA 4URZR 1II8B 4HLCA 5FTNA 4GOJA 3ZQ6A 3P26A 3AP1A 1ZUNB 4LUCA 3K70C 1VCNA 2DFKB 2HJGA 2FEOA 2G1KA 4RZXA 3TNFA 3QF7A 4CEHB 1HUQA 4TLEA 1I4DD 3U2QA 3HWSA 1EX6A 1L4UA 4KBFA 1MT0A 2QBYB 1U0HC 4PO1A 1UBGA 3Q5DA 4PQYA 3X1DA 3PR1A 2IA5A 2YV5A 1T4GA 2GETA 1JXMA 4TLDA 2J59A 4D4LA 3SZRA 4EJSA 821PA 1YZNA 2VF7A 4AK9A 1GDDA 2G9NA 5IK2D 3U6BA 2VYFA 5B64A 1R5OA 1V5WA 2BIFA 1E96A 4C2TA 1XTSA 5FI1B 3PIRA 4DUGA 2BM1A 2F1HA 5KYKA 1KI2A 2A7QA 5E7IA 2IT1A 3DM9B 4HB2A 4OK5A 3JVUA 1OB5A 2ORWA 1E69A 1YHNA 3ZD6A 2CK3A 4XTCS 1FTNA 5CB6A 1M7GA 2CEAA 2XXAA 1NLFA 4TYNA 2IUSA 4JLKA 1QHSA 4CW7A 1G8PA 4IDNA 2B7BA 3BH7A 1DPFA 5DSZA 3KUCA 4DKXA 4NONA 1KJYA 3ZD7A
chains in the Genus database with same CATH superfamily
2FPIA 2ZTLA 4LJYA 5G0VA 3HB4X 1FNMA 1OZAA 1ZD2P 2PH3A 5JRZA 4UW9A 1P74A 1ZAKA 3KJEA 4W6QA 3IT3A 4K03A 2BYTA 4L4ZA 3CLSD 3NDPA 1MW8X 1T0IA 3OPNA 5K2OA 2IHTA 1YTUA 4H27A 4WCFA 5CBPB 4XIJA 1MN6A 1Q95A 2HJSA 3L8MA 3NAGA 5DNEA 1QFXA 2FEAA 3VNUA 2DETA 3OQVA 4GMHA 1JBEA 1NZJA 1Z0UA 3CT4A 4JNCA 4RH0A 1CWUA 1SHTX 4L4RA 4B3DA 2F64A 4QZVA 5KKNB 4DR1B 4LF9B 1K4MA 2HF9A 5LBTA 3KLMX 3FKSA 3MJCA 3ICQB 2W5UA 1XP8A 3AO0B 3I58A 3VZCA 3ZU6A 4RJJA 4KBGA 4AW9A 3QE4A 1NNUA 5KWIA 1DAMA 2QRMA 4NSNA 1KH3A 4KWCA 1KYIA 2FPMA 5J5CA 3GZNA 4UHHA 3PUHA 4HAZA 1FK8A 1XLWA 3KG2A 1CETA 2I54A 5DHUA 4DCTA 4LZAA 4R9VA 5ALUA 3V32A 5JASA 2EP8A 2HK9A 3VR4D 1J21A 5IXYA 1C8BA 3IQFA 5DM2A 4R1NA 2QE6A 4RSHA 1D0IA 4GO1A 1NLYA 2PYDA 1O3YA 1FP4A 1PU2A 3PGXA 4QXQA 4ZEVA 4HDSA 3GLKA 3B6KA 3KUKA 2WD9A 2BJWA 2P9BA 5JUWA 1EE1A 1AKQA 1VSTA 5GJVC 4RPJA 3KQNA 2BGNA 5LD2B 3R2JA 5ER6A 3F1KA 5FH9A 3GJ5A 2EL9A 2NUTB 3I2HA 5J59A 3URKA 4RD1A 1PLJA 2YOFA 4OA5A 3PFKA 1JSXA 1L7OA 3H19A 3MIIA 4J16C 2Q46A 5CYGA 5L3QA 1VRVA 4J7AA 5DO9A 4D79A 5JOQA 5A3SA 1PFVA 2HAEA 3LOPA 1T6XA 3T5CA 3UOAB 3AL3A 3DC2A 4DLWA 1A5AB 1ENPA 3N05A 5JR3A 1Z4LA 2BMWA 5HQ3B 4GYKA 4CTJA 4CWAA 2WF7A 2MT9A 4AZ0B 1A69A 4FW8A 4MB2A 4O4JA 1G9SA 3EQ8A 4R2MA 1FBNA 2NTVA 4C7JA 5F4ZA 4CG3A 1OR8A 2FSVC 2YX1A 4C7MA 2FVYA 5AW9A 5IBCA 1W5BA 3SQMA 3NAMA 1W581 2BELA 5KNBD 2J45A 1BZYA 3KELA 3MERA 3DG9A 3Q8KA 1IY2A 1CJKC 5T8KC 3WXMA 1MB2A 2GA9A 4QU8A 3IR5A 1LF0A 1O5TA 4A2PA 4ZHSA 3BXXA 1DG1G 1FFEA 1Q3HA 1VL1A 2ZIAA 3MWJA 3RPEA 3ZJYA 2IOHA 4G0YA 3NUGA 4U6NA 2LW7A 4MO9A 2EHJA 4NCAA 3PJFA 2C9BA 1DDOA 4R8LA 4RHFA 2Z9BA 2WTXA 1TEHA 3E7DA 1VHQA 3IEVA 2RG1A 3DWGA 2JJYA 3DAOA 4GPIB 4LCEA 3KWJA 2PSSA 3DD5A 2VDMB 4O1HA 3SIWA 2DHCA 5EXTA 1VIYA 3M6VA 5LUBA 1QLHA 4PGFA 2FZLA 3GL9A 4IXDA 4ISBA 1FXWF 3WLMA 5E8JA 3ZWPA 1EHYA 1KIAA 5DHRA 1PL6A 2D2FA 2BCEA 3TVTA 1IATA 3GGPA 5KCZA 5ALVA 4BNKA 2ECQA 3EGDA 3RE1A 4EJ0A 1E9VA 2HHCA 2XQFA 4XVQA 4MYRA 3E6AA 3MJFA 3UT5A 4JB8A 5BVGA 1T8PA 5C1DA 3SVLA 1KSHA 3H42B 3F78A 2CLEB 2ZSAA 1AT1A 2JHPA 4LKOA 4ND7A 2FPIB 4PNZA 1G16A 1Z28A 3BZWA 3ZH2A 1E9DA 5HRUA 2O0JA 4M9RA 1DOAA 3DLCA 3FF4A 1W36D 3GIDA 2FXIA 3INTA 5HPYB 3FVVA 5KYVA 3RAGA 2Y66A 1IUPA 1CDOA 4WCFB 3TINA 2PKQO 1L9XA 5KIAA 2X40A 3I45A 5FUMA 1CUEA 1OWMA 2GM3A 5LD2C 1W47A 4EKIA 5ALZA 1SXHA 1NP6A 3EJWA 4CM9D 3KJHA 3VH2A 1V48A 1PWXA 2CLIB 2X7XA 3LP8A 1EQAA 1H0KA 3RVOA 4F60A 4JOCA 4EWLA 2X2FA 4M1ZA 4NI5A 2WE7A 1K0FA 1SOUA 2PGXA 3H9QA 1TMOA 1QIDA 2X3UA 3ZV4A 3K09C 3B1JA 4JVNA 3KHUA 3LHKA 2O19A 3GZNB 1VKOA 2BISA 1A2BA 4ROTA 3KJFA 4AYTA 4BMZA 1IN8A 1T8TA 3Q3VA 3VUFA 2OVFA 3DVQX 1HETA 3VR5D 3GG9A 5HM6A 3DCYA 5FBHA 3MFQA 4RPLA 4PC6A 3W05A 4B6JA 1LLCA 1Z7YA 3R5SA 4NBNA 4JSRA 5DNWA 2CXUA 5C51B 3PUVA 4K9QA 4ZA2A 4G5XA 4COKA 3HXLA 3LCVB 1Z88A 1SVUA 1VLMA 2ZR7A 1FP4B 4R69A 5ED0A 4UASA 3OUUA 4HDSB 4LJ4A 5HUQA 4GQIA 2DOKA 1O54A 4XOIA 1FQOA 3QNMA 1QCCA 4MQ4A 5TPZA 3WOHA 4FC7A 4FYPA 4BNUA 3H3FA 4M3NA 5I5GA 1RQXA 4YP0A 2QF7A 3LUHA 3Q98A 5LUAA 3V4PB 1EK6A 3MTQA 1OLUA 4TN5A 5E4FA 2HN9A 3S7ZA 5GWXA 4DLVA 1QJ4A 5L3QB 3FLMA 4YRDA 4ZEMA 3O9ZA 3PFFA 4RAQA 4AKTA 4BO8A 2OLKA 3SX4A 4ZYVA 4OQMA 2BDUA 1GA1A 3ND7A 2J5XA 5I9SA 2RHMA 1Y3DE 2DERA 5I8ZA 3TXAA 3FR7A 2P67A 3VPFA 4O4JB 4K3UA 4PFSA 2X41A 4QECA 5JS7A 1HM5A 1FFHA 2IZ5A 2Q5JA 3H9GA 4B9AA 4BFUA 3DAFA 4Z0PA 3UXYA 2OHHA 2J30A 1TT5A 4KPEC 1TXGA 1HT2E 2R7MA 3DXYA 5AJHA 3H5NA 4LNAA 3F98A 2EZ4A 1IHPA 1LNZA 2FNAA 3M7IA 4E2XA 4R0MA 4PRZA 5BURA 8ATCA 1BHJA 1POXA 2IRWA 1I4LD 4R2XA 3TNDA 5LP6A 4YCNA 1N2JA 4ZDWA 1QTRA 5CDGA 1AKTA 2R6AA 2Q41A 1WD5A 1ZM2A 5DP1A 4XVCA 3AZQA 4KXMA 1EXWA 3RVSA 3IAM6 4ZYUA 1DJPA 4XIIA 3VNQA 2QUJA 5B1YA 3A4IA 1SVMA 2H1CA 4BKOA 4YNBA 3O91A 1GV0A 3O4VA 2F43A 1GNVA 1O08A 1EWRA 1K27A 1SUAA 2FWIA 4WADA 1NJ6A 4DJTA 3UBTA 1KIFA 4UVIA 4UPDA 1UXGA 1KZGB 4JLDA 1DADA 2HF7A 5EERA 2G36A 3VSDA 4J7CA 1DXOA 3DT6A 3GU3A 4DMRA 4O33A 3KVOA 2WUWE 4AY5A 3CB4A 4RVUA 3EGDB 1M2KA 3RKUA 2QLTA 1W4CA 3SKYA 3UT5B 4F9TA 5BV7A 2ZUTA 5JI2E 5BVGB 4BNLA 2FP3A 3L0YA 2X5OA 4KVGA 5D3MA 1X80A 1IK6A 1QHEA 5IH3A 4J3FA 1I6MA 1TYCA 5KJ6A 1T5IA 1M8GA 4H35A 3NWEA 4DA9A 1T9GS 3E23A 4NHOA 1M83A 2BOVA 1PL8A 1UCFA 4ACAA 3CWQA 1KTVA 2V0CA 1R4MA 3I6ZA 1AGPA 1R6BX 1A9QA 1XA3A 2D2EA 2YZMA 1NXQA 4DMGA 1OILA 4ECAA 2GFQA 1S2OA 2IHVA 5GIOE 4RYDA 2DZDA 3KV3O 4XWTA 2M6RA 2ZI5A 5I45A 4F6RA 3GUUA 4AU1A 4OSPA 4V0LA 4JLSA 3P2EA 3KJQA 2HYDA 3AYXB 1T3SA 4NZOA 3V8BA 3PHHA 2IYNA 4CMAA 4ABYA 5CAEA 4LQ4A 1QFYA 3DBLA 1ICEA 2O1EA 4J0HA 4UHFA 2P3QA 4X1OA 3RUHA 3USCS 4MVJA 5EKDA 1L7QA 3EXHA 2VRWA 4DR2B 3EPPA 3BAZA 3HN2A 4PY2A 4BLTA 4J0IA 1RQLA 1OFVA 4IQGA 5IKXA 4JLWA 1IL0A 3LLUA 1S8OA 3VZRA 1W76A 4H7EA 4U4AA 4ZI2A 2VZLA 3DLBA 4ZRMA 4K40A 1VI2A 2P41A 2WI8A 4DR3B 4YC7A 4IIGA 1U1IA 3DAHA 1Z18A 4N6GA 1FDRA 4HQ0A 2JIOA 1QR6A 4M49A 2GOYA 1KZYC 2QI9F 3PR3A 2YQ5A 1EVJA 4GE3A 4LMBA 3QYPA 4ND3A 1C0LA 3PCXA 1JHVA 2F3UA 3GZJA 3P9CA 3L6UA 1UPXA 3UHJA 3BDVA 1IBSA 5FBQB 2ZITA 1PYDA 4DM3A 3CLUC 1NVBA 4UATA 2HJWA 3E8MA 3DFZA 4KU4A 1J99A 2EG9A 3DZIA 4YFVA 4DMLA 3KKZA 1J0BA 1QAQA 1E2DA 3DBOB 3WAJA 1F6DA 2HPZA 2JFNA 2GM4A 5FCDA 5FUBA 1Y9ZA 2PUTA 2CL6X 1SIOA 1U7DA 1OLUB 1ZJWA 2QJTA 2HSGA 5K3OA 1DAHA 1C29B 1DWOA 3NIBA 2GSWA 3QTLA 3GCGA 2G9ZA 3WYBA 1CULC 1RQRA 2JFGA 3E61A 1E99A 2D74A 1N2GA 1CVIA 2FE4A 3ED1A 4NYJQ 4EY6A 1F7VA 4JV5B 1YH3A 2V5AA 1BFDA 4AKGA 3V9AA 1U5AA 3BWEA 4OHUA 2QU7A 3FYCA 3L4SO 4PAQA 1KVTA 2EDCA 3U5ZB 1ESMA 3O0TA 2A9OA 4DUPA 1R0CA 2IEGA 1Z4JA 3IIMA 5IX8A 2H0AA 2Y1WA 3C4JA 5EGNA 3KXDA 1TT5B 4KQGA 5EVJA 2XMRA 2Z6QA 5GONF 4LRWA 3ZCPA 5BXQC 5LP6B 4TS4A 1OXSC 3JW8A 5FP0A 4L95C 2X9GA 3WZMA 3WP1B 4KLRA 1UFQA 4QICA 2CW5A 3AJEA 4L76A 1O6ZA 4JA0A 4IDGA 3RRMA 4URXR 4DTIA 1YQDA 5JW6A 1DT3A 3GJ3A 1BWPA 2VNSA 3W90A 1QGOA 2JGFA 2C4HA 5F73A 2F43B 2FJPA 5I9BA 1QB8A 3WWYA 3VHXA 4PLTA 4E3ZA 4BIMA 5LR6A 1U8FO 4EMSA 3IVRA 2ZRNA 1AZWA 2IYVA 3L93A 4N82A 1FSPA 1R00A 1SXJA 4UPEA 3I28A 5A2GA 1TJ3A 2FUG1 5DPMA 2NW6A 4AO7A 1Y98A 2ZATA 4F06A 3OZIA 3LIIA 4I4TF 1DHTA 4P81A 2B69A 4F21A 2CMHA 5AVSA 1N6PA 1RAFA 3MC1A 1U2SA 4YAJA 3ZG6A 1M0WA 1QKJA 5FRDA 3U19A 1EM8A 4WOBA 1RP7A 2KQUA 4F5YA 4UFOA 1I4TD 5IDWA 5B4UA 4IM7A 3F8TA 4ENSA 5D3MB 5EJIA 4ER5A 1U8UA 2EWWA 4UOZA 1X80B 2OCPA 5DM70 3FI0A 5JAPA 3E0QA 2PGDA 3GCDA 3U4DA 1E5XA 1XDWA 3KVVA 4KGDA 2IHYA 1R4MB 2BFBA 2JC3A 1M34E 3JPYA 1Z0FA 1U2PA 4CV1A 2PD4A 1ZFNA 2AQIA 1XR3A 3R8CA 3UPDA 4JELA 2V7QA 3I1YA 2ZRJA 4HRVA 1UF9A 3K8OE 4NMXB 5K8VA 4N65A 4F6RB 3LUPA 1R9NA 5GJBA 4NFSA 2ACWA 3MLEA 1M5RA 5B6IA 5B12A 1U0BB 4YJKA 1USUA 5CAEB 3GA7A 3F9RA 3DBLB 3O1LA 2IPAB 5DMHA 4AJ9A 3TUZC 2FCAA 1GGMA 1CHNA 2QN9A 4OH1A 1UH5A 3EXHB 2BR3A 3PNLA 1J5PA 2QUAA 4OPMA 2WTEA 4ZOQI 1B14A 3VU1A 4DHEA 3VGPA 1FCJA 1S8NA 4CCSA 2AXPA 3AESA 1ECCA 4QGAA 5E6SA 5KYUA 4B45A 5DCLA 1L5FA 2B99A 4OJMX 5ELMA 4U7PB 3U9LA 3MD9A 1YB4A 1M75A 4MVJP 1QHFA 3H9EO 1WZCA 4PN7A 1IJFA 1ZS9A 3O8QA 2IHKA 3K2IA 3LVFO 2EYUA 3OPQA 2XPCA 4P4SA 1FDSA 1CR2A 1R9JA 4RMJA 1KYXA 2FRDA 3K0CC 2DT8A 4BNZA 4XIFA 2VHTA 5F9MA 5LP6C 1NF8A 3EIXA 3TN7A 2IYQA 2XE8A 1UODA 4LHYA 1FFDA 1L5LA 1MABA 5E9QA 1N2SA 1NUSA 3Q5GA 2CJWA 3FMGA 3HBNA 4EG4A 1MJHA 2V7TA 3GF4A 4IDEA 4JUBA 2NMVA 1UFVA 4ZRNA 3REOA 2ISCA 2ZYRA 3ZY5A 2K7FA 2Y9MB 4PU0A 3L0ZA 4EHLA 3A6GA 1LNQA 1GFWA 3B1XA 3GY0A 3HGTA 1TZ2A 4XEHA 3V6MA 1W0JD 5CFOA 2J8ZA 2P40A 3IA2A 4OBWA 2FPPA 1AQJA 1NA5A 3VDNB 1UJ2A 4DA0A 1WMDA 4YV0A 3ZDQA 1KHHA 3P45A 3RIMA 1JNYA 4I1YA 1GPBA 1P60A 2P6OA 4H0CA 1H5UA 3K05A 1DC8A 2VP4A 1Y7LA 3OOHA 4KMRA 4DL9A 2ADMA 1U3CA 4U6QA 1JQ3A 1O6FA 2RHWA 5FB3A 2A86A 5ITWA 3O7WA 4MAFA 3OY7A 4PZ0A 1AVTA 2HJRA 3IUJA 4DEXA 3ETNA 2MMCA 1K7XB 5AM5A 3AKCA 3B3FA 1C4OA 3T5AA 4DW8A 4R9NA 4F7DA 5KREA 3GO4A 3ISVA 4Q48A 5HSGA 2V55B 2PKXA 2YN0A 5C7LO 4HAIA 3CLUD 3C14C 4PCUA 5HK8A 3BD7A 2WB4A 3QYAA 1U2QA 4HRXA 3KEGA 3TFOA 3JQ9A 3LOUA 1G8FA 1XF1A 5KYGA 1YB2A 4M0KA 4BWFB 2ETXA 4DBVO 2FWBA 2QTHA 4GRIA 4GPTA 1WCYA 2PKWA 3VHXB 1FX1A 1DRVA 4IHJA 3QMWA 2ID4A 5BSVA 3E27A 2ZYWX 3MFYA 2I4LA 3OLQA 5FFFA 4EIWA 1SXJB 1LDEA 1S7CA 4Q1DA 1C0KA 4AKEA 1ODCA 1RJ9A 4CNBA 2BFFA 3AB7A 1PJLA 4IPTA 5LN1A 4EUHA 3EXHC 1ZHFA 2BSAA 2AGVA 2J5KA 3N7AA 3WHKA 1EM8B 4BRUA 3SYRA 3VYUB 2VPYA 5HJ7A 3ONDA 1UEXC 1IN6A 3TE7A 1X8JA 2F62A 1T1IA 2JVKA 3KALA 2ICAA 1DJQA 3FI9A 4TS1A 3SBXA 5CTJA 1P7VA 2G80A 4RDXA 3CH4B 2PFGA 4IUDS 2FE1A 3OG9A 1NBMD 2JJ8A 5K0CA 3C16C 3S81A 5A5DA 1YQQA 5HNKA 3EC1A 4G9GA 3TO5A 2BFBB 3DE6X 3HCOA 1HC7A 1UK8A 2FCRA 1A4RA 1LDMA 1NJ2A 1R6UA 2OZVA 1RPTA 1M1ZA 3KQOA 2Y4NA 3LZCA 5EESA 3RYFA 4YI3A 1C0IA 3UMFA 3F97A 3GGGA 1N7HA 4BRZA 4EF6A 4EH1A 3N2LA 1MA0A 1N8KA 4YXWA 1BS9A 1IBKB 2FA9A 3UW3A 3AP2A 1JJFA 1JNXX 1II9A 1R0BA 1RVDA 2P2YA 3KR0A 3P0EA 3E8SA 3SK0A 3YASA 2CKMA 5KDDA 4YPVA 9LDTA 5HYVA 1JG3A 2RONA 4BBZA 5BMOA 1F9AA 1JJIA 2FG7C 2QQGA 1UPFA 5AI0A 1CR0A 2I6TA 2LTAA 2F6RA 2GX6A 2XTMA 3K9LA 3O74A 3U44A 3TR5A 1M54A 4PHGA 3DMRA 5JD4A 4MW0A 4CU5A 1P73A 2EKZA 3OIDA 1WDTA 2OQIA 3M1AA 1Y5RA 3AESB 2C58A 2GM5A 2GI4A 3PVZA 1H3NA 4PZ9A 2CEKA 4MINA 4N1AA 3VR4H 1AKRA 1IHYA 1HORA 1I9CA 3R3YA 5A0FA 1JE1A 3ECAA 1DTEA 3D4LA 3E2IA 4DDMA 3HJHA 3GMIA 3KIPA 3IQXA 3IA7A 1UM8A 1DIGA 3O8QB 1NKSA 4EFMA 1GGNA 1V8ZA 4OKIA 2BMEA 4P4SB 4I1UA 4GX0A 4UQPA 5L4LA 1YA6A 5ADUS 3JX9A 4A6PA 3BCSA 4PGAA 2AJ8A 3I42A 4YMWA 3NTRA 1HH4A 1SXGA 3V4SA 3JQ7A 4Q3EA 4QFDA 1IXZA 2IYSA 3LCCA 2J07A 3T7RA 4UNRA 1U0TA 1I6KA 1LCIA 3L8ZA 2CJWB 5FO0A 1H8HA 3QI2A 5KTPA 1DJMA 3D59A 1Z0IA 1E7WA 4L15A 4GOOD 4LWOA 5CDFE 3K7EA 4P2GA 2QROA 3GH1A 2FW8A 4R2LA 5KVVA 3KFXA 2FPPB 4UM9D 3IH5A 5EJEA 2H00A 1XTRA 3DZGA 1J0DA 5A4JA 1SXJC 3FRHA 2DEUA 2ZXEA 2B4AA 2PRYA 4R2KA 1RJFA 4EITA 2GEFA 3ZJUA 2G76A 2WYWA 2VPQA 3D7RA 4PIVA 2GYUA 2G25A 1P2SA 1JHUA 1JKMA 4MIKA 5KNBH 1MX5A 2BLLA 4IX1A 1C3EA 4QXRA 1TCAA 1Z8HA 3QY0A 4BTEA 2OTCA 3UCXA 1CUZA 3IR7A 1A5SB 2JFUA 4OKNA 5I3ZA 1CXZA 4A82A 5INTA 2ENWA 2K2WA 5JFTA 4ALMA 1PJSA 4M37A 1NMSA 4MVWA 4ED9A 4BP8A 1CUVA 3L7NA 4D45A 2YWBA 3S0JA 2WA2A 1SCIA 2AX4A 2PY6A 2G5CA 5E1DA 1OU4A 1SD2A 4TQ9A 4LQCA 3GPCA 3W5DA 4I0WB 2PJRA 3I9V1 1X87A 4IHJB 5C0OE 1QWOA 2ACKA 2E6KA 4KUHA 2B5VA 4P8RA 3WJ1A 4OHFA 4L85A 2Y8EA 1RJ9B 2BFFB 1WU8A 3GRPA 1V43A 4PPNA 1ZOIA 4Y2QA 2RGXA 1LLDA 3A9VA 5LQUA 2OGWA 1D0SA 4M0LA 4XVRA 4PGHA 3IP6A 2DR0A 1RRKA 4JKIA 1AX9A 2W8ZA 1QYXA 2I7XA 2GD2A 5JU6A 1X7YA 2G17A 3SZOA 1WV0A 3EGEA 3GBVA 5D7NA 1G19A 1P9LA 3ECCA 3TNLA 4FN4A 5FTMA 2RGGA 2Z5FA 3UH1A 4DQXA 3HJGA 1A96A 2LWIA 3M9XA 1GFSA 1AJEA 4MW2A 2BKLA 4FSHA 3GAZA 3K9GA 3KO8A 4QHSA 4RZ2A 2C95A 2VQSA 1UBUS 4GX2A 1ZK0A 4XDZA 3RYFB 4YV1A 2PUCA 3RUCA 1DBRA 1N92A 2H0QA 4LNUA 3C87A 1WP9A 4IX9A 2QPLA 2FSIA 4EPRA 1WP4A 5KEIA 3K1TA 4KWIA 5DXAA 3M6IA 4HXFB 4L27A 4MQLA 1TAUA 4BLUA 3PIIA 4D56A 1PNOA 3PQ8A 2WNHA 1U3TA 4WGGA 2BUBA 4PZCA 4KX3A 2I34A 2G3YA 5KVCA 3BD9A 2PHZA 5AXBA 1TK2A 1GGVA 2PBZA 3KWFA 4NOKA 1MO3A 1UOOA 3T7IA 4I5GA 4PYRA 2J7PD 4MVJD 3U44B 3AB8A 3NYWA 1HXHA 2D5BA 4TTTS 3VR5H 621PA 5T67A 1QTIA 2R7LA 3HXOA 1J20A 2ZDHA 3I53A 1O5IA 2J9ZB 1GFZA 1TZJA 2OESA 1XK6A 4PO3X 4RH3A 4ZRDA 6CHYA 3ILYA 3C6XA 2OFOA 5FA6A 4ZPXA 1SY7A 1DRWA 1TGYA 2G88A 4H17A 1OI2A 2G8LA 3F4BA 4K9RA 2VJKA 5DHTA 2ZDGA 2O2IA 3VKUA 1KPGA 4DYHA 4YMLA 3GFVA 1EYZA 2WTBA 3HVJA 4FHCA 2GZSA 2B21A 3RADC 4J0JA 4YRGA 5KCMA 5EE3A 1NJ1A 3JQ7B 3KBOA 1G5QA 1QP8A 2DUNA 2P75A 1SZDA 3QU7A 4RIIA 4WK2B 3AU8A 4CRWB 1N2IA 4QO7A 3DOFA 3HS3A 2Y76A 3IP7A 3ABOB 2HADA 3BEOA 3PT5A 4UUPA 4YP5A 4C6SA 4ENWA 2KWIA 2CUZA 4K6FA 1Y0BA 3RAFC 4RDCA 4Z0HO 1BKYA 1FFWA 4WK4B 3HI6A 1FJ2A 4BZPA 4GLLA 3CNHA 3F8SA 4KEAA 4QWWA 2WKQA 2D1YA 2MSKA 1O94D 4LZJA 1UPBA 4OQDA 4BNGA 5JCOA 1FXUA 2P6MA 4JN6B 2FFJA 2R62A 1CZKA 1ZA1A 2RJOA 3HBJA 3BGOS 4DQ0A 5C18A 4M1KA 3LK6A 3QVUA 2XY4A 4M1SA 2JIBA 4DWWA 5L45A 1UMBA 3NKLA 5EL0A 1KL7A 1PNRA 4KAJA 1A4UA 3A9WA 1VSVA 3PQ2A 1L7NA 4U7DA 2XTZA 5J58A 4O4JF 3IRUA 2BE7A 4TTVA 1J22A 4I81A 4Y8VA 3I8SA 4GMGA 4YLYA 1AUPA 2CVFA 4FYWA 5MGNA 5EHZA 1NXSA 1OU0A 1KFKB 1S8FA 3H99A 5F4BA 1TZCA 2ODAA 4WFQA 4BNVA 2YMLA 4DY6A 2VQFB 2ISSD 1MMFB 1GSOA 3PBKA 1GCGA 4HYEA 3SC2A 1KRHA 3NG1A 4I1VA 7MHTA 2IYPA 3KT0A 1Q1QA 3F5MA 2GBFA 3LSYA 2C83A 1PJAA 2ZYDA 3F3MA 5MF6A 3P0HA 3ANMA 2J0EA 1H69A 3LDFA 4HZIA 4BFSA 1BE6A 5BUQA 2IIPA 1V96A 1EGAA 1DXQA 4X3PA 3ZI0A 4CETA 3TOSA 1UBSB 4G97A 3NFYA 1BOOA 1SXJD 2UUPA 4LNHA 1H1TA 1NLMA 1CY6A 1NURA 2HWXA 1T6BY 3GWGA 2L69A 3HSKA 3LPDA 3H5VA 4OY3A 1Z37A 1X9HA 2XUGA 3IPAA 4WWHA 3ID6C 2ANCA 2HCFA 2AZMA 1YJ5A 2Q3BA 4URUR 4K2HA 2VP3A 1NW7A 1Q1BA 4KI7A 4Y1FA 5B2ZA 1X7YB 1WOMA 3MJSA 5HMLA 4C7XA 1LJ8A 3M6XA 3BSWA 4FBMA 2XZDA 1WTCA 5CA0A 1JB9A 3GVHA 1GG9A 4HNHA 4A8PA 4KQ1A 2PLRA 4C0AC 1BKSB 3DZFA 3EB9A 4M4SA 4QUBA 3KQLA 1IXYA 5D87A 4DR6B 2VQDA 3I64A 1YNSA 1U81A 1Q5PA 2JI4A 2PFSA 3F5QA 4Q7EA 2MSEB 5AESA 3QXCA 4LNUB 1XRRA 1EAMA 1FDTA 3ZDAA 2CFRA 3DJFA 3PPYA 2AR9A 1K5HA 1BMFA 2AC7A 3GXBA 4LQLA 4HDKA 3QUQA 2ALJA 4D44A 5F77A 2B94A 1XFAA 3G9XA 1PYOA 3IJPA 5CH3A 4Z3KA 3A2KA 1EU1A 4BNIA 1NVWQ 3AFHA 1VMAA 2JEYA 5ALOA 4JI1B 3NHSA 4B4VA 4IRMA 4CV0A 2C4KA 4BY9E 1ZKMA 2Y1EA 4MAAA 1U2RA 1MBZA 1RXUA 2WVAA 4RD6A 1DQRA 4I8XA 4JJ7A 4GWLA 3BGIA 1NBIA 1U7PA 2ATIA 2XZLA 1KMQA 1QYCA 2A4MA 2YWFA 3TZEA 3U5TA 1OFTA 3W8NA 3OQ6A 3U9TA 1SVNA 5BSGA 3RU9A 1SBYA 1MKYA 1VJCA 1ZD5A 4GGPA 5ALEA 4FCCA 2Z2XA 1P17A 3GLUA 1S2LA 3RNLA 3EISA 3ROQA 4P80A 4P5DA 3UQZA 2PYIA 2GZHA 1L9KA 4DMUB 4MO2A 1UDAA 3BWVA 2H92A 5A5FA 4Z9AA 3VR2A 4ZTZB 2HRCA 4CF5A 1EWVA 3ML1A 4GOXA 2O1XA 4CTOA 4LV6A 4HB3A 3W2TA 3CCCA 3KQYA 1X9IA 1I94B 3OM9A 3RSGA 2W2OA 3K5IA 3RS3A 1OJ7A 3GQBA 4XB1A 3RUIA 2IELA 1K4KA 1D0VA 3RANA 4BO0A 1RFGE 3KAPA 5CG1A 1YU9A 3O2NA 5IXSA 2JJ2A 2V7VA 2GF0A 3RH0A 3LC7O 3JWPA 4DJJA 4ZV4A 2VLIA 3T3OA 3LKDA 3PSHA 4OOFA 5D00A 3DEFA 4GUAA 4JX8A 4U5QA 3TW4A 1KOJA 1YFJA 1R0LA 1SUPA 4TZTA 2LXNA 3VU8A 6ABPA 3R0IA 1TYZA 3DPUA 4MKZA 1JYSA 4N18A 4XRRA 5TNXA 3TB6A 1UJ5A 3OCCA 1ISHA 2VSQA 1UMBB 1XEFA 2JIQA 3IUYA 1K68A 1N5RA 2YYAA 5H3CA 3I5YA 1MU0A 2W00A 5IAKA 1T2DA 5FPTA 3SX0A 3DA8A 1QNFA 2WJIA 4QWMA 5C4GB 4DA4A 1DKUA 2EGUA 4UUNA 4QSHA 1NR5A 1P31A 2X0NA 2XOKD 3FH0A 1NZDA 3SHQA 2BFEA 4UZSA 4C07A 4EELA 4ZAGA 4BO4A 3QEBZ 1S2MA 3AHHA 4BFZA 2GD0A 4YXWD 2EDAA 3GJYA 3SC2B 5LP6F 4EFKA 3N6RA 2CT8A 3A1FA 2J67A 3LFHA 3QWFA 521PA 5TVGA 2FU5C 1SBQA 3KOYA 1YAJA 3T3PB 3I04M 5KVSA 3CKLA 1JX6A 1NW5A 2JAXA 3CNEA 2HHAA 4ZN6A 5B1IA 4W7SA 1BU5A 1R12A 2H2FA 4Q7MB 1OV4A 1NSFA 4IH9A 2G8NA 5JXWA 3EZLA 3UGJA 2XR1A 2E82A 3ELUA 5CG2A 1DKNA 1KBQA 2NO5A 2D4HA 3M4NA 3EEFA 3T1YB 1O4VA 3RJ5A 2H5EA 4WK6A 4ZGWA 5LQRA 4ND5A 3VA7A 2QVGA 4MW1A 4PZEA 1U2GA 4JC4A 4PVDA 5CA0B 3Q3EA 1TX4B 3TLMA 2IPMA 3V1LA 5A4KA 4XFDA 4HNRA 4NNPA 5HFNA 1HO3A 1H2HA 4O4IF 4M8SA 3K0SA 1XVUA 3FMOB 2PCLA 4KWEA 3E70C 2WILA 4Y6PA 3G79A 3RRXA 2VYNA 3I92A 5AVVA 3ER9A 1M6VA 1L4BA 3GP3A 3OETA 4OHVA 1NRIA 3NCHA 4PF1A 3ZEIA 5DIFA 1N5OX 2Q0QA 4X1YA 2N46A 3W2FA 1C30A 3FHCB 4NPCA 3H9CA 3GFOA 4TSFA 4HDKB 3CR8A 3P9IA 2QQFA 3UJHA 4TYMA 2B2NA 3L49A 4I4LA 4LWPA 4MPJA 3FPCA 4LBYA 4FJ0A 2A8YA 3PENA 4P0PB 4U8HA 2NYRA 1GNLA 1WCV1 4TS9A 4GL2A 2JJ1D 4ESVA 2Y1KA 3WLNA 1Z6ZA 4AJJA 4DXHA 1Y6ZA 4D02A 3M6WA 4IOKA 1EVIA 2G82A 5ESRA 3T7KA 3L7AA 4QSMA 3CF4G 5FLKA 4MVJF 2R1ZA 4Z0NA 2AYXA 3FFWA 1PZXA 4FKBA 4WN9A 2Y68A 3OP4A 1V3TA 2VL7A 4QIHA 1A3CA 1E8MA 2W6PA 2OXCA 3RWOA 2J9RA 2Q5CA 3V55A 3SJAA 1YZYA 2FQXA 2WU3A 4HB0A 4K26A 1GR1A 4LGYA 1IN1A 5I7UA 4WJZA 3B3AA 1Z2EA 3U1BA 5BPHA 1PBTA 1QGUA 1CV2A 1KRWA 5BWOA 2PZ8A 1L7VC 3A2MA 3FTCA 4JEIA 1G2IA 5GV7A 1JHRA 6ADHA 4I3GA 3HL0A 4YHHB 1D7OA 2BGRA 3GQBB 2F59A 2V9ZA 1Y34E 1DO0A 2D1RA 1JHPA 5U9CA 1TZKA 4E6EA 2HRZA 1PG0A 5JCPA 1FTGA 3IGFA 4K0KB 1SHLA 2IS1A 2YMQA 3DPIA 4D74A 3KU4A 4OMCA 3A6LA 2A35A 4GLOA 1FU7A 3Q3JB 1E6KA 4YRBA 1XWWA 1GNQA 1W6UA 2O5RA 4HH4A 1SN7A 1W5AA 1GLGA 1N4DA 3JTMA 4BO6A 1AGXA 1HYEA 3LDHA 4CUJA 10MHA 2J9GA 3WGIA 1LLQA 1Z2AA 2PIDA 1KSFX 2FUKA 2CXRA 3K8ZA 3NYQA 4GPBA 5KTRA 4LY3A 1V8DA 1JAHA 1F1BA 2NO0A 4JI7B 1EBBA 3KHKA 2IGBA 5AW5A 3V1KA 1JVBA 1VJ1A 1X1CA 4D0GA 1CJMA 3QVXA 3TK1A 3ZE0B 2FZCA 2BFEB 2NADA 2Q50A 3VKGA 2JATA 3RT7A 4UBKA 2IH5A 3SY8A 4R71A 3EXG1 3DXXA 4IP0A 4NULA 1ZOSA 1XZIA 2HRQA 5EIOA 2Q3MA 1NM5C 3RJTA 3TLAA 4OJTA 3AM1A 3K2EA 1GPLA 2AWNA 1Z8DA 3F71A 3AUFA 2XECA 3HYTA 4HLDA 5HCIA 7REQA 3LT5A 4PE5B 5HRAA 4FWTA 4UPVA 2JLWA 1EGVB 4DDKA 1XKLA 2CD9A 1MB0A 1PAUA 4LQDA 2QMEA 2QK4A 3QLVA 5AIBA 4XZ3A 2QL6A 1GYRA 5AOCA 1RIFA 5C5IA 4CL3A 3LBNA 4NE9A 3IODA 1RWWA 1FFBA 1RKXA 4K9SA 3TJZA 4KXXA 3MTIA 1KH1A 3FPKA 4HRYA 4JBWA 5ECGC 3CVWA 4X92A 4W9NC 3M2PA 5H3LA 2GPWA 4D97A 4II7A 4H6WA 4MYCA 5IJ0A 1TF7A 2C84A 3GVXA 4NBRA 3TLZA 1DKOA 4RXTA 4KO2S 4IUCS 3QGMA 1QG4A 4DHWA 2DG2A 1V7CA 4FBGA 3WVNA 2E3JA 5AVWA 2VXCA 1YQTA 1M6VB 4CLXA 2HA4A 3EVZA 2V6BA 4N01A 3S40A 3DVSX 3PFGA 3JVVA 4X1YB 3STTA 4IICA 1C30B 1U28A 3JQEA 4YFYA 3FNGA 2PWAA 1ZJYA 2BGUA 1PK8A 3BQMB 3T3HA 4DREA 4XWKA 2YH2A 1CVRA 3DLIA 4IG9A 4KVZA 1BSVA 4RV4A 4U2DA 4RV9A 2HH9A 3VPCA 1SHJA 4KC0A 1YDEA 3GLHE 2IS6A 1RQ2A 4E11A 3JS5A 4G9EA 1OOEA 1KYTA 3W78A 1AHPA 4I5EA 1BU8A 2G9RA 3RS7A 1C0EA 3AVQA 1KO4A 2HOQA 4WN9B 1Z4KA 2BCJQ 5TQ2A 1P19A 3C6YA 4B7UA 4E12A 1BKDR 1Z0AA 3O9VA 5CEJA 1OT5A 1C8KA 2ZVDA 5LZ4A 3PDJA 1GNRA 4MA4A 4TTJA 4QBFA 4HGQA 4YCMA 1YU6A 1FA9A 3V1TC 4A16A 1JAIA 3W5CA 3DM5A 1ZUHA 1QGUB 3R7SA 1EB9A 3CIFA 3P32A 3B48A 2WJYA 1Q44A 1E1KA 3EWNA 4IWNA 3C3MA 2YHBA 1VFPA 4ZOCA 2D2XA 1ZRHA 5ENVA 3OOSA 5DXFA 1ISJA 1ONSA 4GOLD 3N76A 4L8YA 1GWNA 4Q02A 3T1VA 3ZU2A 4FB4A 3KK0A 4XA8A 2O2HA 4TXJA 1DIBA 1KU6A 2CJXA 3DOUA 1UDCA 4M7OA 3COJA 4UUOA 1JHYA 1DSSG 4KXYA 1G7CA 3CZ9A 1MJFA 1VE9A 2FOIA 4NOLA 3SYTA 3G59A 2HEGA 3GA5A 1XMJA 2B34A 2BSXA 4NDAA 4W1PA 2A5GA 4JUCA 2ECPA 2G63A 1H4TA 4I50A 3O90A 3IS3A 3T9BA 1LTHR 5CLQA 3D7LA 2NNLD 4D41A 4BEVA 3QYJA 3EA4A 1U2GC 1JEEA 2B9VA 2EBFX 3PNBA 2PX3A 4AICA 4GM0A 2XHEA 2GPBA 4MARA 5IULC 3EZXA 1LV8A 1Z6GA 2J3JA 2X13A 4ZO9A 4AWAA 3ZCSA 2RD2A 2CF5A 2F2TA 1MFPA 2GPJA 1J8FA 2IEDA 2ODWA 4P54A