3CH4B

The crystal structure of human phosphomavelonate kinase at 1.8 a resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
195
structure length
188
Chain Sequence
GSMAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphomevalonate kinase
publication title Crystal structure of human phosphomavelonate kinase at 1.8 A resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 65
structure length 188
sequence length 195
ec nomenclature ec 2.7.4.2: Phosphomevalonate kinase.
pdb deposition date 2008-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04275 P-mevalo_kinase Phosphomevalonate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ch4B00
5FI1B 1GSIA 2NO1A 3H1TA 5HZHA 3JZAA 2BJWA 3ZVMA 4ON9A 1ONBA 3CZQA 2HCBA 2OFWA 4R71A 1W47A 1GTVA 3W90A 2DYKA 1CJTC 1DPFA 3K9GA 3V00A 4CEIB 1R7RA 1XNJA 1KMHA 1N6LA 5EXTA 4NU0A 2IYVA 5D3MB 3U60B 4XOIA 1DAEA 1FP6A 5DI3B 4KU4A 4QHTA 4BEJA 2O8BA 1KTVA 4ZPXA 1T4GA 4IOKA 4O2RA 4WAUA 1O87A 1OJLA 3O8BA 3EAQA 2OUKA 3G5UA 3LDAA 3T1QA 2HDNB 4R2HA 5AR1A 4PC1A 1G4UR 3LBNA 3UK6A 1JR6A 3X1WA 2YC2C 1VTKA 3LXXA 1J8MF 1HE8B 3DHWC 1VYUA 2QT1A 3I4LA 5IDVA 3GJ6A 1A82A 1BYIA 3FMPB 4LHXA 3H86A 2Q9BA 1T91A 1WBDA 4WBSA 3HU2A 4C0KA 4KJZA 1NJFA 3LAWA 3UWKA 3C5HA 3LQQA 3ZDQA 1NVXQ 4JLKA 4YMSA 2ATVA 1KK0A 2C98A 5GJBA 1U9IA 4RFSB 4LBZA 3A1UA 3CIOA 2PJZA 1XMJA 3DVLA 1BKDR 1KDTA 4ZCLA 1J70A 3D8BA 3TJZA 2C9OA 4RY2A 4TL8A 3I72A 3U6BA 2F3TA 1EFCA 1N6PA 1XJCA 2VP6A 1I4TD 3C14C 1GRNA 5EE9A 4JL6A 2B7CA 4PHFA 1YZGA 2OCPA 3LX8A 5DISB 2AK3A 4JT4A 2CCJA 2W2TA 4OJKA 2BOVA 3FWYA 3P4YA 4QGFA 2J7PA 2XB2A 3B1ZA 1A2BA 2WSMA 1N0WA 2CEAA 1KDPA 4GBMA 1FMLA 3B9PA 4C7OB 1Z3IX 2E87A 1HE1C 4NYIR 1JQLB 1XCPA 4KYUA 5CDFA 4AG5A 5FBLB 1Z2AA 1PV4A 4BFWA 1I4LD 2O8EA 4W9MC 1HT1E 1R5NA 4POAA 4IFBA 2AHOA 4MYHA 4NCJA 2GXSA 5C18A 1ZMXA 2OM2A 4B3XA 4F4JA 2XZLA 3R20A 1KMHB 1T8TA 2FV8A 1NN5A 3T5DA 4PQRA 4XVRA 1NBMD 2ZYUX 3C4JA 2O8BB 4JVNA 2FSFA 1W49A 2O0HA 3PEUA 1KGDA 3P4XA 1SXJC 2C96A 4FXPA 4G0NA 1XX6A 1AIPA 2QU8A 2JASA 3DZ8A 1YVDA 1XCGB 4B3CA 5G40A 3QI2A 1XEWX 1GAJA 5JEEA 3RS4A 4Q4AA 1W4CA 5GVRA 1GL7A 5FOSA 4BASA 2IHYA 4MKIA 1MR3F 3KUCA 1EFUA 1Z6GA 3H4MA 1CJMA 4FN5A 1RRPA 2HYIC 3NC0C 4TYQA 1OH6A 1CR4A 4TQ9A 1ZM4A 3QEJA 2IF0A 2ZRMA 4LZZA 4NCHA 4C0LA 3KQUA 2XXAA 3T1VA 1D9XA 3NWJA 4B76A 2NO7A 1N3BA 1S96A 1GFIA 2VHCA 4NCNA 4QNMA 3SZRA 3D3QA 4A2QA 4BFZA 1CF4A 4DXAA 3B60A 1V43A 3L2OB 4E07A 5F3WB 3ZIAA 4V0ME 4TL7A 3U3MA 4GT1A 1ZUNB 4IFEA 1JJVA 4JLPA 1O3YA 1GRQA 1DG1G 2QMOA 1P5ZB 1HQYE 5TY0A 1GDDA 4IW3B 1UADA 3FKSD 3OIWA 4G01B 2PLRA 2HT1A 1SXJD 1QHNA 1F48A 3TE6A 4MRVA 3F0TA 1KI3A 3GEIA 4QGHA 3E70C 4EQ6A 2W6IA 4O25A 1VCMA 3Q8XB 3Q5EA 2QGNA 4NBSA 2BMFA 2O8EB 4YMTA 1S9HA 3QSYA 3KL4A 1GNQA 3BOSA 1NVWQ 2OCAA 3GJ3A 4M1YA 4LV8B 4HAZA 4PO9A 1SULA 2NTYC 4PSAA 4Q4LA 2ZI9A 4LJ7A 1P73A 1ZVQA 3DEFA 1IONA 4H1UA 3N2IA 4Q9IA 5TVKA 5K8LA 4H1VA 2R44A 6Q21A 4M8NE 3K0CC 4QGAA 3CH5A 4CW7A 5H8WA 3CRMA 1PJRA 1E98A 3QPUA 4DCTA 5B30A 4EUNA 4A0RA 1NN3A 2GCOA 1LTQA 3QXXA 2PZGA 2ZREA 4R7ZA 2YHSA 1OH8A 2OG2A 2DWOA 4HLUA 2EFHB 4YMUA 3AV0B 3LW7A 5KU1A 3SU8A 5FBQB 4PC3A 2IS4A 1T5IA 2RGEA 4A1FA 1OW3B 4QBFA 4Q02A 2JA1A 5BWMA 3VR6A 4GOJA 2XXAB 1XD2A 2FEMA 3AP1A 4KAXA 4TL6A 1KSFX 2GAAA 3IIMA 2A5GA 2HF8A 2J41A 2QQEA 3W6OA 1G8PA 3FFAA 5CM8B 3SE0A 3I5XA 3RANA 1QHSA 2N1BA 4OK3A 4RZXA 1SHKA 2P5SA 3K53A 3QPVA 3K0AA 1TF5A 1H8ED 2GESA 3QG1A 2VSOA 4LC0A 1G291 4AD8A 4EQ6B 3NXSA 1G3UA 2J1LA 1VYTA 4RD6A 3C15C 1WCV1 2CNWD 3A4NA 4M22A 2YWHA 4BE7B 1XJQA 4BFUA 5DN6D 4MRPA 1ZNXA 1IM2A 1U0HC 2B8TA 3B8HA 2CVHA 2A5FA 1XBTA 3GLHE 5JLJA 1IJFA 1JPJA 2JLQA 4AYTA 1OIVA 2JLXA 5K8IA 4KODA 1QVAA 3IPXA 5FL7A 4DLZA 4TYNA 1E2QA 4BFTA 2IS1A 1XF9A 2WJHA 1XCMA 4ERNA 4TMVA 1TNDA 1IXRC 5FUVA 4B3FX 1KK3A 2GCOB 1UFQA 2C9CA 3IUYA 5FPTA 4A6XA 2WM9B 1YU9A 1G6HA 2QRZA 4JLVA 2RHMA 3H2YA 4OQXA 4Q5IA 4PHTA 1LF5A 4QHYA 2C5LA 2QT0A 4RKEA 2A5YB 2ORIA 3DKVA 4KYIB 3ZS9A 1CKEA 2IYUA 3IHLA 1DAFA 2RB4A 4AKGA 1NLYA 1M6NA 4JVLA 5B64A 2VIIA 1P2VA 1YR6A 4C2UA 2CE7A 1ZUIA 5C1BA 2O8DA 4PQFA 4DCUA 1VG9B 2OILA 1BMFA 5CYPA 3DMDA 4DHEA 4AKIA 2J46A 3NDBB 1UAAA 2FJUA 2DFTA 3PUZA 2ZANA 1LW7A 2DHRA 3HWSA 3K0AB 4TWZA 3LY5A 1IN4A 1L2TA 3DL0A 3DPUA 3LFUA 3SN6A 4HDOB 3U7FB 2OLKA 4V0MA 2KJQA 4DJTA 2FEOA 1GL9B 1I2MA 4JVMA 4HAUA 2WIBA 2RAPA 2W58A 4PQYA 2AD5A 4CT5A 2XX3A 1XXHA 5FTNA 4MKFA 3WBKA 4DSNA 4V0KA 2FF7A 2GZHA 2JJ1D 2YWEA 1KKMA 3LXRA 2QTVB 4FMDB 2QORA 4PSKA 2FFAA 4XWOA 1OKKA 3LX5A 1KI4A 5SZKB 4XD7A 1UKZA 5IK2A 1TL7C 2X1VA 3CZPA 5CK4A 2JLZA 1DOAA 4MYTA 1II0A 4YQFA 4NYJR 4ZDKA 3Q9LA 4PAMA 4TLCA 3O8CA 1ZJ6A 1VHLA 4NP6A 1JXMA 2QI9C 1YZKA 3TAHA 2PMDA 3EZ6A 1FW6A 2XTZA 2FSIA 3BS4A 4MQBA 3A6PC 2GXQA 4NPHA 3OEHD 3BD9A 2CL6X 3EZ9A 2RGNA 3KJEA 5FH9A 1EFRA 2B92A 2YOHA 1AZSC 1ZNYA 3SI7A 1ZCBA 4UJ5A 2GKSA 2O8DB 2GCNA 2ERXA 5JJKA 4DT1A 3E5HA 3WYGA 1OIWA 5H1YA 2EW1A 1LNZA 1UJ2A 4QXAA 3AF4A 4AURA 2YJTD 4P33A 4JLDA 5KYKA 2AXNA 3BK7A 4LCBA 2VF7A 4TMXA 1GKIA 1W4BA 3FHTA 2QTFA 3B2EA 4B2PA 3C41J 2Q6TA 2AKAB 2RGDA 1NIJA 1WRBA 2Z4SA 4KO8A 721PA 1K5GA 5IF9A 3SHWA 1XXHB 5JHGB 3CRVA 3TIFA 2EYUA 4Q1BA 2XZPA 2NIPA 1F5NA 1E99A 3X1ZA 4EFMA 3GQBA 2J7PD 2VP0A 1NN0A 4DRZA 2OHFA 2FPKA 1JPNA 1GM5A 4NCIA 2ODNA 2FNAA 2O0JA 3GLHA 1X8JA 1TUIA 4D4JA 3IEVA 1CEEA 2C78A 5AJXA 1E9CA 2YVUA 3R7WA 1G5RA 1Q12A 1TF7A 4LYAA 2Z83A 3EA5A 1U0JA 4G1UC 5E7MA 2HJGA 3PUXA 2PZEA 2QENA 1LS1A 3OIUA 5E7IA 3QQ5A 3QXCA 2QSZA 2BBWA 2VBCA 3GCGA 4B74A 3AUYA 3CM0A 1YZLA 4IDPA 2ZAMA 1X8LA 2HEIA 1VPLA 5CM9C 4KVGA 3A8TA 2O8FA 4Z1MA 3OAAD 3K8YA 3AP3A 4HB3A 2ZITA 4F4CA 2ZSFA 3FMIA 4LSGA 2JDID 4DT1B 2ZS8A 3AP2A 1KO1A 4A2PA 4D81A 3NEJA 1L4YA 2PMKA 1Z83A 4M9ZA 4U5XA 1K5DA 4BLRA 1IN5A 3VMFA 4G5SA 4OHXA 2J0SA 3WMGA 2CBZA 2IXGA 5J40A 1NBMA 2I1QA 4PZYA 1AS2A 3NVAA 4HLUC 1ZM2A 1NLZA 2IYZA 4RD3A 1S4QA 4MGZR 3ZIAD 2ORWA 1VIYA 4LYJA 4JZKA 2ZYWX 1OXUA 1HUQA 3VR3A 5EUMA 2A78A 3CH4B 2QMUA 3RAPR 1KI9A 1FUKA 1D8TA 3ZYCA 5G41A 3EIHA 5CLLA 1W2HA 4LPSA 3SEAA 2VSFA 1CR1A 1TEVA 2W6ID 2ZU0C 1VCNA 4HUTA 3IDQA 3I8XA 3GLHB 1KJYA 3CO5A 3B1XA 1JEDA 4N3NA 3R7WB 1GOTA 1GITA 4JVSB 3PR1A 2F55A 1HQCA 2GCPA 2IYSA 4WVFA 1US8A 3MAAC 4UXJA 2UVQA 5CIWA 1UBFA 3EZ2A 2G6BA 3ONWA 4HAXA 3LD9A 5AUNB 4W5JA 2WTUA 3W9YA 4D0LB 2ZRNA 1P9WA 2P6RA 3WBJA 2H8KA 4RZUA 4RCYA 1CBUA 3FFBA 2O8FB 1EG7A 4LJAA 4OK5A 4QM7A 4PHHA 3QXHA 4ZKDA 1SXJA 4RFVA 2VP2A 5CYOA 4ZCMA 1IQPA 1G19A 1FTNA 4F38A 3A4MA 4D80A 5EZ5A 3BORA 1D5CA 4TLDA 3QF4A 2OBNA 1MO4A 2MMCA 1ESNA 4S2EA 3VHLB 4PXAA 1YE8A 3K0SA 3CF0A 4B48A 4OI2A 3GFOA 1AM4D 2XSZA 1KNQA 1KKLA 4ZKEA 2CLSA 4ASUA 4B6FA 3LRPA 5FUWA 3CB4A 3RS3A 4P0TA 1JAIA 3EWAA 1R0XA 1TPZA 4MYUA 1AZTA 2PT5A 5FTJA 1WF3A 4GDFA 1SKYB 1YZUA 3EC1A 1BS1A 1MT0A 2PT7A 3Q85A 3TQCA 1M2OB 1UKEA 1TU3A 5FPKA 1WXQA 3T34A 3E2IA 4TYWA 4TL9A 4PO8A 4A0FA 3PQCA 1D2MA 1G3QA 5BN5A 3GLGE 3ZZUA 3PUYA 4WZ6A 2W2VA 1S1CA 1US8B 1QZXA 3BAFA 3KXIA 4EJSA 2GF0A 1UBCA 1Z6YA 3A36A 3VR4A 5FL7D 1IJEA 1X1SA 3N2EA 5CLQA 3LO5A 2D2EA 3VQTA 4HLQB 2AKYA 1M7BA 1NG1A 2DWPA 4MDFA 1E9AA 2C99A 4CDGA 3EG5A 2DR3A 3CUEF 3EPJA 5F9HA 1G21E 1SHZA 2VHQA 3CNLA 4OBEA 1SXJB 2ZI7A 4GSYA 2ODBA 4TTQA 2ONJA 5C4GB 4DSUA 2G88A 3B13B 5DN6A 3GJ0A 2QG6A 4Q21A 1XFAA 1VG8A 3TAUA 3FMOB 3QF4B 5HCNA 1G7RA 4D0NA 5UKDA 1OB2A 3K9NA 1YR7A 1WP9A 3AVYA 1BMFD 1W4RA 3H84A 3EX7C 4GPTA 3RS7A 1GZSA 4O0MA 2ZSEA 2NPFA 2CCKA 3U6KA 2E9SA 3F5FA 1G7CA 1W48A 2RGNC 2ZSDA 1NMZA 5JEDA 4HDQB 1HV8A 1XEFA 3B6EA 1U81A 2GJ9A 1QHIA 2OBMA 1E0SA 1M34E 1ZW6A 2R6GA 4JIMA 2V8OA 2OCBA 1TUEA 4A0GA 2GF9A 4D4MA 3GLFE 1FPMA 1GL6A 1YHNA 4IHQA 1M7GA 1U8ZA 1KSHA 2C2HA 4PTLA 3K09C 5FUYA 4EJSB 4PFSA 2J0VA 3T35A 3RVBA 5JWRA 4HLCA 2GEDA 2AWNA 2F7SA 2HF9A 5DI9A 3MUFA 4HLDA 3KKMA 4QNRA 4C9BA 5H68A 1E0AA 1N25A 4F92B 3WHKA 5LB2A 3MMPA 3K70C 1G8YA 4EPRA 1JAHA 3RC3A 1BO6A 2VPPA 2DWQA 1N2CE 5K8UA 1OFHA 1EWRA 2YZ2A 5L3QB 1XTJA 2R6FA 4G5GA 2JJ1A 1JB1A 2IXFA 1EFRD 4OQNA 3W5IA 4MUBA 1KI8A 1N6IA 1ZU5A 4P4UA 1A5TA 5DYGA 4C4PA 5SZHB 2VEDA 4NH0A 4KCGA 621PA 2ZRBA 4LJ9A 3QVVA 2XOKD 4DIDA 3KUDA 2PLFA 2AN9A 1CTQA 4QRHA 4QBIA 5FOTA 1BIFA 1E69A 4DVGA 5C2JB 4LBVA 1T6NA 4KHZA 4V0NA 5EE3A 1QG4A 3EXAA 4Q4HA 3GMTA 4L5BA 4DIEA 3HYRA 3KJHA 4GOKA 3B1YA 4V0OA 2ZJ8A 1E0JA 3OEHA 4NZYA 4D6PA 2QQ0A 2WKPA 1F3OA 3ECCA 2IWHA 1P4SA 1G16A 1YKSA 2RHDA 1OE0A 5LDDC 1N0UA 1XEWY 5KNBA 1MO5A 2XNDD 3LBHA 2D2FA 5JS7A 1S8FA 1R2QA 2BM0A 2VQSA 3GLGA 2VL7A 3NTUA 1DELA 1Z0DA 2W2XA 1DAHA 2YWGA 2QZ4A 5FBRB 1NG9A 1CJUC 2ZVPX 5JWHA 2Q3MA 4MRRA 2DFNA 2JJ8A 4ZI2A 2ODWA 5HE9A 1R8SA 2NZJA 3O47A 4HI0E 2B6HA 3KTAA 3BH7A 3KB2A 2Q3HA 4A82A 1OSNA 4JJKA 4K8OA 5AJWA 2AFHE 3CX8A 3L8ZA 1IAQA 1SVKA 3CX6A 1CP2A 2G1JA 4DCNA 1RRGA 1Z22A 3FVQA 1E2IA 1NP6A 2XTMA 2Z4RA 3CPHA 3UMSA 2YV5A 1L7VC 4Z1MD 1J8YF 2FFHA 1IY0A 5KDDA 4QBGB 2RMKA 1KO4A 1CR2A 2OO7A 5FBWB 2E1RA 1FMJA 2ZIAA 2WMNB 2OCYC 1W4AA 4NDZA 1RFLA 4TLBA 5J4LA 3KJIA 4IKEA 5DHAA 4GP6A 3I62A 2D7CA 1JQJC 1J99A 1MO6A 1OF1A 2Q9CA 2A3RA 1RYHA 4Q4HB 1CRPA 3E1SA 3L0SA 4IXNA 5KSZA 4L9SA 121PA 2RGXA 4QFMA 3RS0A 1W36D 1M7HA 3CW2A 4NYMQ 4X8LA 3WHLA 4YDHB 4BLSA 1LF0A 1X86B 2WWWA 4TQAA 3OAAA 1P2TA 3BGWA 1E9FA 2QPTA 4TN1A 1Z6AA 1JALA 2R2AA 2NPIA 1KZGB 3ASZA 4EPVA 4PAOA 3GLFA 4UNQA 4TYYA 2JDIA 3GLGB 1EK0A 2P0EA 2PCLA 2J7KA 2YC4C 5DO9A 3AVPA 4TT3D 3U7EB 1CU1A 3PENA 1F2UA 2W00A 4Q1FA 3EW9A 2ZRKA 1DADA 1S9DA 1G5TA 3KTAB 4ITRC 8OHMA 2GK6A 4FWTA 4DWJA 2IYQA 3CPJB 4B6EA 1KI2A 2V1UA 4CGZA 1XMIA 2GK7A 3IPYA 5IRCD 3ADCA 2ZI6A 3OIVA 2BHRA 1A4RA 4TZ0A 3LNCA 3SYKA 4M0LA 3TH5A 1DG3A 4C0BA 2PH1A 3D7MA 4PC7A 4TSFA 1Q57A 2WIAA 3NH6A 3G0HA 4EJSC 4I1SA 1G3IA 2GJSA 2AFIE 2WV9A 4Q7KA 4US0R 5E4FA 2OAQ1 4IEEA 3NHAA 4CRWB 5JJIA 1UF9A 1AJEA 4LC1A 1NVUQ 3F8TA 1IOZA 3FMFA 2QP9X 3P27A 1NF3A 3EZFA 3VTKA 2XSZD 3FGNA 1XPRA 2G1KA 1XTKA 4ASUD 2IYRA 2IS2A 3QG5A 1GRRA 4JLAA 2OE2A 5BQ5A 2P3SA 1KDRA 1YQTA 5JCZA 2OT3B 3S1AA 2NOAA 1EESA 4Q4AB 2ZRJA 5DSZA 3CKLA 1RZ3A 3GLFB 1T3SA 1QHHA 3MCAA 2GVZC 1MO3A 2XB4A 5BXQC 1ODFA 3TSOA 5JWOA 5KTYA 1FNMA 2HUPA 2L0XA 4MRNA 3L0PA 4FMCF 2WSSD 3IO3A 4ACAA 1F2UB 4XJXA 4EPWA 5BN4A 4U00A 2D74A 4ILEA 2VO1A 2C95A 4KXFB 4PR0A 4TLAA 2HV8A 3TW8B 2R6CA 3U4QA 4KFUA 4TYPA 5HPYB 1ZRHA 1E2KA 4EPTA 1AGPA 1VHTA 4V03A 2ZRIA 4AIIA 3MWKA 1CJVC 4RKFA 2X2EA 1SGWA 3IQWA 1MH1A 4XSHA 1GG2A 2CVFA 3IGFA 4ZIRA 1JECA 3R8FA 1T0HB 2GHIA 3NHBA 2P65A 4M9XA 1KSGA 2BMEA 5DIFA 2J0UA 3FKQA 1BYUA 1ZM3A 3AGQA 3LBIA 1UPTA 4AY2A 1Z0JA 1P6XA 1TQ6A 2ZRGA 1W2GA 3QKSA 1Y63A 2IYXA 2V9PA 3SC3A 3U3OA 1OXXK 4KVAA 3VAAA 1XZQA 5AJZA 3MWJA 1ZD9A 2ZTSA 1KO5A 4BPBA 1E2EA 2XEXA 4QHSA 2UZ3A 1E9RA 1LY1A 4FCWA 2FZLA 4M1SA 3THOA 5K8TA 4BZXA 3SBDA 1GVNB 4UNNA 1UDWA 2Y8EA 4NKRA 1MRNA 2CLCX 4E5UA 2ZJ5A 4PPQA 1GNPA 1VG1A 3DM5A 2BVNA 4FCTA 2J59A 3NC1C 1XPUA 4LGMA 1ZC4A 1MKYA 3S1AB 2W0MA 3ZS8A 3BB1A 3MWLA 4FIDA 1KY2A 2ZJYA 3FTQA 3ND8A 1Z5ZA 2O52A 1QHHB 3GFTA 3ADDA 3BWDD 4JL8A 3W8NA 4URVR 3B1VA 1TQ2A 2KSQA 1ZCAA 1NSTA 4XVQA 3NBYC 1XD2B 1Z6XA 3CONA 4DEYA 2XITA 2BV3A 4P4TA 4URZR 4JYCA 2A9KA 2BJVA 2C77A 3IEUA 2C03A 5F2EA 3U4QB 2VTKA 4JLBA 2IUSA 3GD7A 1B0UA 1G17A 3HU1A 4AKEA 2GJ8A 2FN4A 2ZUDA 2PX3A 2ZVQX 4UJ3A 3WNDA 1T9HA 4ZIRB 3PITA 3FOZA 3QKTA 1YZTA 5AJYA 1E2PA 3FYHA 4C3ZA 2J0UB 2W6JD 4AKHA 1Q20A 4IXMA 4M1KA 3QOFA 3DM9B 2MMGA 2QAGA 3AF1A 1P60A 3A1SA 3HR8A 4JL5A 3GJ7A 3BFVA 1Q1EA 3QE0A 3REGA 4ZV4A 5A4JA 5JFGA 1SVMA 4WA7A 5J5CA 1AS3A 4US1R 4IDHA 2WKQA 1NMXA 1QBKC 4RD0A 4XWAA 1H8HA 5BYKA 1HEIA 2ZRHA 4PC6A 2R62A 5CJPA 3UG7A 2IUUA 3TNFA 4A0HA 2HT6A 4Q1EA 2X77A 1NI3A 1QRAA 1I2DA 3BH6A 4LJYA 4B73A 3M6AA 4ABYA 1OFTA 3FPAA 4BECA 1E4YA 1SVIA 1Z08A 4MA4A 1Z29A 3TVDA 2VYFA 1COWD 1FOEB 1ZD1A 2AXPA 4AYWA 2ZI3A 2D4HA 1R4AA 3ETLA 2HCJB 1YJ5A 2PL3A 4L9WA 5KDOA 2WWYA 3SDZA 4N0EA 4L15A 2D06A 5B57C 4LHVA 2G3YA 2OFXA 4MGIR 1HT2E 5FOUA 4EFNA 2IX3A 2F43A 4TMTA 3RNLA 4IDNA 1OHHA 2VLIA 5GADl 1G20E 1VCIA 5LD2C 2XOKA 4LY6A 2ZSAA 5ELXA 5FTLA 1VYVA 1KO7A 2O0KA 2N42A 3VKGA 3KKOA 1NVVQ 1UDXA 3K09A 3ICQB 3UG6A 3WP0A 1P2SA 1G9XA 2DFLA 4CEHA 3QEOA 1R5BA 3EIQA 1Y3AA 4Q9KA 2IF2A 2H57A 2H7VA 2QAGB 4J0QA 3AM1A 2QTHA 3PEYA 1K6MA 2ZETA 4DLUA 3X1XA 1W1WA 4RD4A 3GEHA 1XU4A 2VP9A 3KB1A 3AVWA 2NO6A 1G4AE 3A58B 2XNDA 3A1VA 2EFCB 1HA3A 3QENA 4ESHA 4DCSA 2BEJA 2REBA 3O8RA 4Y0VA 2WOOA 1RRFA 2YNMA 3OE7D 5EE5B 1K8RA 3IIJA 1RIFA 3BE4A 2FGJA 1TU4A 3GJXC 4LJ6A 1SZPA 5EXPA 3THXA 3SR0A 1KJWA 1SKQA 2IT1A 3CNNA 3OEED 4HAYA 2BBOA 2HYDA 2LCFA 3KDSE 1E2DA 1KK2A 2KI5A 2CHVA 3RRMA 4ZCIA 3SQWA 1IN7A 1PUIA 1W0JD 2V6IA 2ZRDA 1RJ9A 3UXMA 4XWKA 3U44A 2ZJZA 1LV7A 2ZYVX 2OAP1 1HY3A 4ACBA 1G8FA 2F43B 4QGGA 1EWQA 5FOVA 3FHOA 4A6PA 1E2MA 1NKTA 5L3RA 4EFLA 4HATA 2EFEB 3NDPA 1G7SA 3REFA 1Q3TA 1RW4A 4B75A 4O3MA 1S1MA 1OH5A 1AS0A 4D4LA 2VP5A 1X3SA 1KHTA 1QVRA 5DE3A 3ZVNA 2NZ8A 1PVOA 1P62B 2V55B 4DLSA 1AN0A 1XB2A 5AWFC 2LKDA 3SYNA 4CEHB 4FINA 4OQMA 1T3LA 3PG5A 4QBHA 4DBLC 1Z06A 4GMDA 5TDHA 2C9YA 3B5JA 3ASYA 3A37A 4M1WA 4CEJA 3HJNA 3U2QA 3SOPA 5IT5A 2VHUA 5DNYB 1WDTA 1Z63A 2FU5C 5AJVB 4FW9A 3L0IB 1TTTA 3RWMB 5KNDA 3I3SR 5HCIA 1TQ4A 1TX4B 3QF7A 4Q1AA 4EDHA 4TSFD 3AGPA 1WA5A 1ZNWA 3NBXX 2WWGA 3B1WA 4BEBA 1CRQA 2IK8A 2WHXA 1GKYA 2CL0X 2IL1A 3K0FA 1R0YA 2FMXA 4TT3A 5CK5A 4YC7A 4IOJA 4OI1A 5TB5A 3CRRA 4A2WA 1VCOA 3KKNA 3SJCA 3O8DA 4IVPA 5FI0B 3THXB 1NIPA 4B71A 2BMDA 2F1RA 5G3ZA 2WWHA 4UXHA 1OIXA 4MUAA 1GNRA 2RGGA 4C30A 4XVUA 3W6NA 5M04A 1RJ9B 3U44B 2GTPA 3AH8A 3T61A 4KLNA 3X1DA 3HPQA 1E2LA 2EFDB 4OI4A 1T3HA 1XEXA 5KUTA 2OZEA 4NYMR 2ZYTX 2A2ZA 2YOFA 4JBWA 3QJYA 2RKOA 1UKVY 1ZP6A 2QY9A 3R9XA 2WMOB 5EJEA 4HZUA 4M9SA 4DUGA 1Z47A 1S0UA 3VKWA 1E9SA 3UPUA 1UEIA 2CCGA 2IW3A 1G7TA 4XTCS 4CEJB 1S2MA 3AVXA 1RC8A 1U94A 1W36B 2WJJA 3ZQ6A 5JHHB 1Z0AA 1FX0A 2KE5A 4GL2A 1SVSA 1E96A 2OXRA 2P6NA 2Z43A 3QXSA 2JLYA 4HB0A 1AA9A 2ZUCA 2GA8A 1LVGA 2QGZA 1GILA 5KPDA 3KXLA 1XTIA 2I4IA 4FMBB 1CLUA 2H1LA 4BFSA 4D26A 3CX7A 1MOZA 4MH0R 5KOYA 2JLWA 3K0FB 4B2IA 1NKSA 4NE2A 2WSSA 3OZXA 4FMDF 1E9BA 4KV9A 3TR0A 3THYA 3BRWD 4ARZA 3HDTA 4LUCA 4DLVA 4JJZA 2V7QA 1S3SA 3NKVA 4ESVA 1X8KA 3DDCA 1KI7A 2B21A 2QMEA 4B2LA 2FOLA 2AD1A 4OQLA 2JATA 2YINC 2J0QA 3QBVA 3TMKA 2QAGC 2D7DA 2GILA 1G5PA 3PVSA 4YXWA 1QHGA 5JI2E 2FA9A 1DS6A 3FHCB 4IRUB 1ZIPA 4OHZA 3NBFA 2CXXA 2Q21A 3CLVA 2EWVA 1XEXB 2ZQ5A 1DE0A 4P32A 1M1YE 1T8UA 5EP2A 1NY5A 3MFYA 5A0FA 5EXSA 3TLXA 4BLPA 1ESMA 3U3RA 3AVQA 1IY1A 1Z0FA 4GNKA 4PX9A 4IDQA 3NH9A 2ZJ2A 4O2LA 4NL4H 2PZFA 1DBSA 3WYAA 1QHYA 1YZNA 2WOJA 3TK1A 2JLSA 3WRYC 2EYQA 1VG0B 4URWR 2JEOA 3BB3A 1U90A 1FX0B 4YLGA 5EP1A 2FSGA 2RGAA 5FUXA 1N0VC 2AR7A 2P5TB 3KFXA 1P9RA 1AQUA 3SFVA 1JEEA 5JS8A 3KQNA 2JLVA 3NBZC 4DKXA 4UXIA 1TEXA 2GETA 4MITA 3THYB 4URUR 4ARZB 1KJZA 2YKGA 3A1TA 3QVUA 3JVVA 3LW8A 4QL3A 2ZM5A 1OXSC 3RABA 3VHXA 1CS4C 1SQ5A 4CZ2A 2EU8A 1H8HD 2AX4A 3TBKA 5DLQC 1S3GA 3WRXC 5EZ6B 1VKJA 3EIEA 4KBGA 1OB5A 3RRZA 2XZOA 1QHXA 1WB9A 2ZPTX 3QPWA 2HXSA 4MKHA 2ZRFA 5EXXA 2ZE7A 2VHJA 3PV0A 2QBYA 2IUTA 2X8AA 1XZPA 1E9EA 3OESA 3RSOA 2XJ4A 2FH5B 2W6JA 4HYYA 2QROA 3RRNA 3BJIC 1YR9A 1IXSB 1G64A 5KDLA 5J4VA 1YZQA 2I1VB 1N6NA 2PBRA 5JJLA 4FCVA 3UKDA 4TTRA 1YR8A 4D0GA 2FDCA 4Q18A 3QKUA 1E79A 3VFDA 1JNYA 4I4LA 1OT3A 1SVWA 3TSWA 4JKYA 1OHHD 3KXKA 3H0KA 2ANCA 5BN3A 3ZGXA 4I81A 4RCZA 1W7AA 2ZJOA 4HEJA 1Q1BA 2G83A 1XTQA 2BCGY 3EASA 3VX4A 2WWXA 3TGPA 3MGCA 1HYQA 2ZE5A 4Q00A 2A5JA 2KB0A 1R8QA 4DDWA 1E2JA 1QDEA 2R6AA 4GI7A 4WZAE 1VIAA 4GFDA 4M1TA 1COWA 1Q1QA 2WAXA 4B47A 1DEKA 5KHOC 2AWOA 3UWOA 2ONKA 2D3WA 1X6VA 3C8UA 3TUJC 3RS2A 3SYLA 2WZQA 4DDTA 3I5YA 1KZ7B 2XAUA 2VA8A 2G0NA 4Y0AA 3B85A 2EWWA 4LBWA 3EWSA 3U3JA 4HUQA 4JLMA 3K9LA 1EFHA 3K9HA 1FUUA 1Q21A 1KIMA 4OKSA 1G3MA 2V4ZA 4GMXA 3IHWA 3HYTA 4G5OA 4U02A 3N5CA 5L3SA 1G8GA 2KWIA 4UNRA 3MJRA 4RZ3A 4A9AA 2W83A 2QBYB 3CR7A 1W36C 1RYFA 2QP4A 1XTSA 1R10A 3DOFA 3NIBA 2ECKA 4GZLA 2X2FA 3I8SA 3SJZA 4CVNA 2OV2A 4B32A 5E95A 3D31A 5B2ZA 3UMFA 3X2SA 4DB2A 2ZAOA 4C2TA 4HSEA 2NO0A 1NMYA 5HKKD 4HB4A 3BXZA 2PCJA 4HAVA 4D82A 3RLFA 1XDBA 1FL9A 1WMSA 4IDOA 1ZU4A 1Q1ZA 3IIKA 4DDVA 1YRAA 2WPDD 1E1RD 4M2LA 4CT4B 5CIQA 4ZI3A 2FWRA 3W8RA 3AEZA 2O5VA 3ZD7A 1N6HA 3KFVA 1E3MA 3TVTA 2CJWA 2VF8A 3OE7A 2IYTA 2G77B 4Q7LA 3VR5A 3DKPA 2AL7A 4GRAA 1G18A 2IS6A 1RKBA 2PX0A 1JR3E 1P2UA 1W46A 2F9LA 2GVDC 2UZIR 3BERA 4JBYA 3THWA 2UKDA 3OEEA 2EFGA 1DAIA 2ZSBA 3RC8A 1EGAA 1TF2A 4RD2A 2WJYA 2PJRA 4MGKR 3T15A 4FWIB 5JBQA 1VDZA 3LQRA 1KK1A 3LLUA 1W0JA 1NVVR 3EZ7A 1RE0A 2IHBA 1TADA 2F3RA 3AB3A 5C4MA 1Q3HA 4DLYA 4AWXA 4B3DA 2ZJAA 4HUQB 5FPHA 2J5XA 2GZAA 2JLRA 3T5GA 4B3GA 1BH2A 1V5WA 2GAOA 3VNUA 5L3SB 3Q7QA 4AG6A 2QM8A 2JIZA 1XD8A 1Z28A 4PAQA 3UANA 2BBSA 3QY0A 2V6JA 4LHYA 4QG7A 2ATXA 4C0AC 2HLDD 3EA0A 4RD1A 1C9KA 1HTWA 1E9DA 2OLJA 1R6BX 5CB6A 2DB3A 2ZEJA 2FG5A 2OEPA 2F9MA 1XP8A 2QP3A 3OFNA 1W5TA 4IEIA 4EIWA 1N5IA 1QF9A 2GJKA 2WJGA 5CB8A 1D2NA 1P61B 5JCPA 4LV6A 3TUIC 2FPLA 4Q9HA 4OHYA 1FQKA 3LVRE 4JLOA 521PA 1BOFA 1N5JA 2QE7D 3BC1A 4E09A 2FE4A 2OFOA 3AKYA 3TQFA 1Z6TA 4YMWA 4F93B 1OFUX 4KI0A 3AVOA 2CJWB 4XSGA 1UKYA 1J2JA 3X1YA 1GIAA 3MD0A 1D9ZA 1E1QD 1KSJA 3CRQA 3IBGA 4EKDA 4BWYA 4BGDA 4DUGD 3QKRA 3THWB 2KBFA 5LD2B 4LBYA 5GJWC 2QMHA 4QJ4A 1FTSA 3C5CA 2QAJA 3DZDA 2X19A 2BKEA 4HB2A 1AGRA 4Q1DA 1XXHE 2Z6VA 4L16A 1CIPA 4ZDIA 1JJ7A 2IXEA 2ZR0A 3BFXA 1EFTA 1X1RA 1DO2A 1E32A 3L8YA 4U7DA 3BIFA 4F91B 4G5RA 4Q01A 5HTKA 3U5ZB 4LX0A 3VKHA 2AK2A 4NCKA 5GJVC 2LKCA 3JVUA 2ZJBA 1VMAA 1U2RA 2CMKA 2FFBA 3LV8A 4KFTA 4Q1CA 1G3RA 1P9NA 2FSHA 2Q9AA 4Q9LA 2RGCA 5D3QA 4IOMA 4KBFA 5EP4A 3RYTC 1F60A 2FX3A 3PEVA 1YRBA 2CL7X 2V7QD 1Z2CA 2GXUA 3IKJA 5KPJA 3WYFA 2ZU6A 4OHVA 1XTRA 4B35A 3GP8A 2CK3A 2CHQA 2HJVA 1EXMA 5DH9A 4D2IA 3U3KA 2BMJA 1I4DD 2WWIA 3BH0A 4LJ5A 4L4UA 3TR5A 4M9QA 3AKEA 4MGYR 4Q7MB 4YXWD 2XJ9A 3GFPA 3JZMA 4HAWA 4NHOA 3W5JA 1WE2A 5JECA 4E22A 5BYJA 2DFKB 2ODEA 3ZLJA 1W0KD 1FZQA 3CF6R 4PSVA 4Z51A 1OLOA 2BKUA 3RS5A 1A2KC 2GNOA 5C46F 3WXMA 2NO9A 4Q47A 2VP4A 4RZ2A 3EPHA 1IN6A 4OI0A 4BLTA 4JBXA 4QM6A 1MABA 1PZNA 1ZINA 2BBTA 4Q4JA 4BLQA 3QKRB 1KYIA 4OQFA 1CJKC 4KSCA 3KQLA 3R8CA 1VECA 2XNSA 2R65A 3N70A 4W7SA 3K70D 4X8HA 4B44A 1JR3A 4UNPA 1LB1B 3HU3A 3UMRA 2EQBA 4OYHA 821PA 2A30A 2GEVA 3MJHA 4X8OA 1ANKA 3TUZC 5P21A 4RVCA 2GBLA 5GJCA 4Z8XA 2KBEA 4H9GA 4DDUA 2PEYA 1ETUA 3ZZTA 4YONB 2BDTA 4OHWA 1E2FA 2DY1A 2FPMA 2YYZA 2WICA 5SZJA 1KO8A 2IBMA 1IBRA 3F3YA 1XMVA 221PA 4OK6A 2WJIA 1AQYA 1FNNA 1N6RA 3L82B 2JLUA 3IQXA 4WXRA 5EUQB 3ADKA 3SHFA 5KSYA 2BEKA 4DB4A 1UBGA 4MYCA 1II9A 1XMSA 3P1JA 2JAQA 1ELOA 3CWZA 3NEYA 2C8VA 4Q9JA 1G41A 5FTMA 3TW4A 3HP1A 3QUSA 4Q66C 4N0DA 3UATA 4BRWA 4Z54A 2WJVA 4PPGA 2H92A 1WQ1R 2K5UA 4C0QC 5F98A 1J90A 2GEUA 4G5QA 5TV2A 2IEYA 3EARA 4WIAA 4A4DA 2GDJA 4M4SA 4P4SA 3CNOA 5JSZA 3C16C 2ZXUA 4Z8YA 3TKLA 4DEXA 3QKSB 3IILA 4C0SA 4M21A 3R9WA 4BFXA 2QM7A 3KJGA 5G53C 3AUXA 3AF2A 1ZBDA 4JLNA 4R98A 4DC9A 1MABB 3PJRA 1E79D 4Q4JB 5LBIA 1Z0KA 1NBME 4R9UC 4I1VA 4Q48A 4R2IA 4JMPA 4Q03A 1A7JA 1DVRA 4LK2A 4CYMA 1DO0A 2J3EA 2BIFA 4LDJA 3EPKA 4FI3C 5JRZA 4TTPA 2V54A 2B8WA 3GPLA 1XD9A 1SKYE 1T5LA 1KDOA 2IYYA 1NNEA 1TMKA 3ZJYA 2YWFA 1OYYA 4AC9A 4OJQA 3QBTA 1B23P 5J4YA 5KSOA 5HZKA 3ICEA 5FPSA 2QA5A 4KSBA 1AK2A 3PCRB 1U9IC 5HE8A 3G82C 3B9QA 3ZZ0A 3GJ8A 2VRWA 2ZI5A 4BZQA 3B7GA 2H17A 1KI1A 2GWHA 2ZI4A 2IEZA 2MSCB 1ZNZA 3NG1A 4QJ3A 2V1XA 4JLJA 4LPKA 2WBLC 4A8JA 1C4OA 2R6DA 4W5HA 4LJ8A 1N6OA 1OH7A 4A15A 2QPOA 5KO2A 4NYIQ 4S35A 1P7CA 3M0EA 2DBYA 4I99A 4G3XA 4BUJA 3P20A 1SXJE 4NONA 1GUAA 4F7WA 4P4SB 1G1MA 2OXCA 3HR7A 5JSZB 5TMPA 4PC2A 1ZM9A 3T06B 3AKDA 2CHGA 4AK9A 4URYR 2J45A 2JJ2A 1L8QA 4FD2A 2ZRPA 2NGRA 3ND9A 3KX2A 4RJLA 2Q3FA 2F1IA 3C7KA 2MSDB 1P75A 1E94E 3I92A 3OIYA 4BLOA 4UNSA 4ZDWA 4EAQA 4YMVA 3B82A 3HPRA 3DO6A 2IYWA 4BZPA 1HURA 1MRSA 2ZRAA 5LPNA 4NMMA 5KSPA 3PEWA 1KI6A 5FBVB 4WXPA 1RPZA 4TZ6A 3W6PA 3PXGA 1FFHA 1C1YA 1NLFA 1LS6A 3M4YA 5AUPB 5JMTA 3A1WA 2BWJA 1JBKA 4IVQA 4Q19A 3VNVA 4LOAA 1UEJA 4ZDJA 3IBYA 5FOXA 5FTKA 3ZVLA 5KNCA 1DAMA 3UIEA 1Q0UA 2ZRLA 3D6TB 5HKKA 2ERYA 5DHFA 5FFMA 4NTZA 1GKUB 3V9PA 3I73A 4BFVA 2W0SA 1HH4A 4AYXA 1QG2A 3CBQA 4B33A 4I1UA 2NMVA 1G6OA 1NY6A 2FFQA 2I3BA 1KNXA 4BFYA 3BB4A 2Q0HA 4YDSA 3I61A 3AF0A 1F2TA 2CLDX 3FDIA 2J9RA 2WPDA 1E1RA 3L0OA 4A8JB 2R9VA 5FPYA 1D6JA 2F6RA 1Z8FA 5L8VA 3AVVA 2JIZD 1FQJA 3GJ4A 2DPXA 4LYFA 4F4IA 5J47A 1E0KA 2ANBA 2B7BA 1TAGA 4A36A 2REXB 3K1JA 5EP3A 2ZUBA 3GEEA 1W44A 1EX6A 1ZM7A 4LWZA 3BBPA 4DSTA 3P26A 2QSYA 4TQUS 2YOGA 3QXJA 2OBLA 3OFND 1Q44A 1M74A 2BC9A 3LVQE 2MSEB 3AVTA 4JSTA 3GLIE 1IN8A 5SZIA 3U7GA 1DTSA 4M1MA 2CDNA 4DZZA 1KMQA 4QJ5A 4XIGS 4IVRA 4C0JA 4GOXA 4V0LA 3MWYW 4XH9B 4L8GA 421PA 1ZYUA 4QKQA 4KLZA 4URXR 3V4FA 1KI6B 1DARA 2ZRCA 4TMKA 3TSZA 1RRCA 4GP7A 2EVWX 2C04A 2RGBA 3W3ZB 4PANA 5EE1A 4MKGA 2IWRA 3SNHA 2HLDA 1U8YA 3LA6A 4K46A 5CJ2A 1KY3A 3MSXA 3IO5A 3WMFA 1G8HA 3PIRA 4N1AA 3CRW1 4IJMA 5H70A 4LHWA 2LWIA 3FB4A 2OESA 3I1FA 4DCVA 2SHKA 5AUQA 4B3BA 3J81k 3Q5DA 3KQKA 4OL0A 2ZE8A 2QE7A 4PHGA 5FR1A 5E3HA 1NSFA 3PFIA 5F9FA 1F6BA 4LRWA 3VR2A 4E03A 1F2TB 3AF3A 5DYIA 3FE2A 1NL3A 3SJBA 4BQSA 1GP2A 3U7HB 3A4LA 3AQ4A 1L4UA 1DAGA 1E6CA 3RRYA 3B78A 2RH5A 1E1QA 3DOEA 3MRSA 3WP1B 1XJ0A 4XTRA 4DLTA 1E4VA 2JCSA 2NG1A 2O8CA 1KOFA 2H5EA 1NN1A 5ANRB 5LB4A 2VHTA 2P67A 4II7A 2GJAA 2GBLC 2CK3D 3EC2A 4HDCA 1OPXA 1P72A 2P2LA 3FKSA 4QC2A 1M8PA 5AK0A 4DLRA 3CF2A 4DLWA 5JZVA 2QNRA 3KKQA 2CE2X 1PUJA 2H16A 2ZS9A 3QIAA 1OFIA 4D4KA 4D25A 4IOLA 1OXTA 1R0ZA 1R5OA 3TRFA 3W34A 1E2NA 5G3YA 1IHUA 1EX7A 1GWNA 3CWQA 1ZIOA 1Z07A 2G9NA 1P3JA 3RSLA 3Q7PA 3DMNA 3GJ5A 1E2HA 2TMKA 5FR2A 5GVSA 1H65A 2FZ4A 4KFRA 1CULC 4RSGA 3RWOA 3T1OA 3WMEA 4JYBA 4AI6A 3WNCA 4ZO4A 4TLEA 2VSXA 3U61B 2WKRA 4WOPA 2XTNA 2DCUA 4X8MA 1Q22A 1AKYA 2WWFA 1JR3D 5FL3A 4KFSA 1PLJA 5IHPA 1U98A 1PLKA 3PUVA 2FGKA 1MV5A 4JT2A 5TXGA 3L43A 2BM1A 4MRSA 1AKEA 4DSOA 2QN6A 4EPXA 1OYWA 1SVLA 1N5LA 2IYLD 2J87A 1W0KA 2A5DA 1A1VA 2ZE6A 5JRJA 2XGJA 2ZROA 1RVDA 3VU9A 3OHMA 2GXAA 1E2GA 1J7KA 3V4RA 4PZZA 2GZDA 2O8CB 5BW8A 1XWIA 1IXZA 1UBEA 4HZUB 1R0WA 1N6KA 3K0EA 1SVOA 1TQDA 2G0TA 1N5KA 2ZR7A 4TMWA 3OF5A 3I32A 3WY9A 1H8EA 3CPEA 5HR5A 3KQHA 2HXYA 3K0CA 3QNUA 5CITA 1CR0A 2PEZA 4P3YA 3ZQJA 2QEQA 1XRJA 2WVJA 1KAOA 2CNWA 1PLLA 2Z5FA 3PUWA 3WNBA 5J4HA 3GLIA 1FP7A 5L3QA 4PPNA 4W5WA 2R8RA 5E7JA 4NYJQ 5CDFE 2QPAA 1OXVA 4DLXA 4WW0A 4LJ4A 3MG9A 1JI0A 1UM8A 5FOWA 3RDPA 3RHFA 4A8JC 5J4KA 1II8A 2ORVA 4PZLA 5AUOB 3ZH9B 1Z0IA 3EPLA 4BRUA 3T1TA 1OV4A 4WZBE 3ADBA 2V3CC 4PO1A 4HZIA 2Z0MA 4MDEA 5A5GA 3ZD6A 4P31A 2RCNA 1CXZA 2ZS7A 3T12A 5JI3E 4B34A 4CEIA 1U8AA 3M1IA 3SJAA 3Q3JB 1NRJB 5D3MA 3CR8A 3VR1A 2WAYA 1ZAKA 5DI3A 2GRJA 4LI0A 4M53A 1ZUHA 2QUZA 4TMZA 4A92A 1U0LA 4EPYA 1KAGA 4UKDA 1DAKA 3LH5A 1ZC3A 3AKCA 5L3VA 3SBEA 2QRNA 3Q72A 4I1OA 1JXOA 4FMCB 3P32A 3KZ1E 1WBBA 1IY2A 1OKKD 2F1JA 2REOA 2VH5R 1ZD8A 3BFKA 5DGXA 3VU9B 4B43A 4XD7D 2N46A 2OSBA 5IK2D 1W5SA 3KKPA 1D2EA 3LLMA 1LFDB 4KITB 4Q7JB 2D62A 2QL6A 3LWNA 4GZMA 1NJGA 4LHZA 5TARA 3ZVRA 2IC5A 1T0JB 3AVUA 4JSYA 2ZR9A 4QOSA 2IA5A 3R9IA 4CIDA 4US2R 3K70B 4V02A 4K81B 2ASEA 3W3AA 4RFSA 4CF7A 1XPOA 2BCJQ 4C0HA 3MLEA 2F1HA 4M1OA 3SQXA 5EE0A 3VX3A 3SFZA 3GLIB 4JS0A 4LYHA 4UQOA 3SS8A 2H18A 1U99A 5B58C 4LV5B 2NQ2C 2JGNA 4JKIA 2P6UA 5EQTA 4PPFA 2JJ2D 4C7OA 1II8B 2A7QA
chains in the Genus database with same CATH superfamily
3VPXA 4H17A 1AHNA 2P2ZA 3RSCA 3H1TA 5HZHA 3JZAA 2BJWA 1L6RA 4DRYA 5KCZA 2G9VA 1XLTC 4ON9A 1ONBA 1BA2A 1W59A 4I1PA 3ZQ4A 1ZSNA 2NNWB 1A9YA 1W47A 3DD5A 1DPFA 3DL4A 3K9GA 3V00A 3BUSA 3U5TA 1XNJA 1KMHA 5EXTA 3U7RA 3K6SA 3R44A 2PGDA 3IAXA 1DAEA 4FLFA 5DSTA 1ICEA 2A9PA 3JRXA 4QHTA 3TZHA 4BEJA 1KTVA 4ZYXA 2NZYA 5HKOA 2AZXA 2PY6A 2GVNA 1O87A 1OJLA 4KN8A 1OT5A 4M0PA 4GMHA 4ZMRA 3FDXA 2VS1A 4C43A 1Z4JA 2F17A 3Q7RA 1Q7BA 1LA2A 1VRWA 3DHYA 3KU1A 3LXXA 4MLCA 3Q3EA 2IPMA 3DBOB 1ADCA 2QT1A 3MRVA 4PX5A 4RK0A 3T5MA 1B3RA 3L9WA 1DKQA 4UM8B 5HEKA 1PN3A 1A82A 1Y7TA 2UYOA 4XAQA 1BYIA 4WJLA 4FLEA 4JJEA 1CQJB 4CQMA 1J22A 5EJ7A 4WBSA 4E1VA 1IM8A 1AKNA 5AD1A 5CFQA 3C5HA 2C4HA 1QGUB 1EJ0A 1PHPA 3ETCA 3LQQA 1NBAA 4O1MA 2IU3A 3OZEA 5JNLA 1IUOA 4Z7OB 4JVOA 4S12A 4LBZA 1SHTX 2WF8A 3A1UA 1QKKA 2OD9A 3F78A 2PJZA 3OSUA 4ZCLA 1KDTA 3U37A 1HSZA 3D8BA 4N6OA 2I65A 1UH5A 2AQHA 2OYCA 2C9OA 3RHZA 1FFEA 5F4BA 3UJ7A 3WNVA 1C81A 3I72A 2J3JA 1ZUNA 1RWQA 2F3TA 5G4LA 2O7VA 1QGYA 1T1JA 2AN1A 1GRNA 2PKWA 3C14C 1RAGA 1YZGA 3HWRA 1T6BY 2OM6A 2WTAA 5FPPA 1C3VA 1XTVA 1ZOPA 4PTYA 1U8CB 2FUEA 4GBMA 2WSMA 2EJTA 4G1FA 1E64A 2K2QB 1FYVA 4NYIR 1XCPA 1SC6A 4KYUA 3KVVA 2QV7A 5IVKA 3FNQA 2HDHA 4POAA 3GLUA 3I01A 2VT6A 3AUTA 2GBGA 3ZGZA 1QE3A 4FT2A 1P4GA 2GD2A 4JX9A 4L28A 4J3NA 4U63A 3ENZA 4B3XA 5ALVA 3SHQA 5JAZA 2CJFA 3R20A 1KMHB 3NR2A 1T8TA 1TC1A 1VHWA 3BQNB 2FFRA 4LTNA 4WCFA 5TF0A 3RV3A 3TMYA 3WLHA 2D00A 1NBMD 2I2CA 1X1TA 2ZYUX 3I6MA 4EJMA 4JVNA 1Z74A 3ZK8A 4TWAA 3EB9A 1S7GA 4WLOA 2VQFB 1LDEA 1SXJC 2CMDA 3RU2A 3F7OA 1XX6A 3QKWA 4MIOA 3DBIA 5FI3A 1A5AB 1YWGO 1O2DA 1T5SA 1YVDA 2H2FA 5C5CA 2O3TA 1QOZA 1GAJA 1LVHA 4Q4AA 1W4CA 4X90A 2VXYA 4RVOA 2I5PO 4MKIA 4A3SA 2P90A 1Y4ZA 3KUCA 1EFUA 3H9GA 1Z6GA 4ZYWA 4Q16A 5D5HA 2COEA 2HYIC 1GXSA 3EWNA 4MUNA 4MYRA 4TYQA 4CQMB 1NQUA 3QKIA 4TQ9A 3VR2D 2ZRMA 5AVJA 1O6FA 1D9XA 1PO7A 3L18A 1KAEA 1QR6A 4NCNA 2VHCA 5AK6A 3TW8A 3D3QA 4DXAA 2YJZA 3B60A 2JW5A 3CLRC 2PZMA 4RK4A 5K3EA 1Z2EA 3U3MA 4GT1A 3ANTA 1ZUNB 4WEOA 1UJ5A 2I3DA 4HFJA 1MW9X 4C7XA 1O3YA 4WBNA 2TYSB 1NBEA 1T4CA 4XPZA 2HWXA 2JAXA 2PLRA 3MGKA 1K92A 4PLCA 4NJMA 1QZUA 3VZPA 3ZTTA 3D8TA 4UNIA 5BORA 3PLAE 4HYEA 4MRVA 4QGHA 5JMPA 4AN1A 3E70C 2W6IA 1XNHA 3Q5EA 3Q8XB 4V24A 4BJ3A 4LI3X 2NU6A 4QLBA 4FP9A 1YA8A 3QSYA 1OYOA 1GNQA 5LA6B 4CGYA 2OCAA 3USES 5J3JA 1VXRA 3ZV7A 4AY5A 3ZG6A 5BO5A 1VJTA 1GPYA 1SULA 2G7MC 4UDYX 4WCFB 4ARAA 5KQSA 1P73A 1YS4A 4ZQHA 3RRJA 3HJHA 3DEFA 2PX5A 3ZDYB 2X6QA 4OQZA 2WT8A 2Q27A 4UBOA 1CJSA 3A26A 4EA9A 4LXXA 3V2GA 1BQ4A 1D07A 4ID3A 3WLTA 1PJRA 4GL4A 1EVJA 3UK1A 4ZAYA 1I32A 5EA2A 3RVLA 4DCTA 5JADA 4A0RA 1LTQA 3QXXA 1U7XA 2PZGA 4R7ZA 4J0JA 3WL4A 4TTIA 1GZ5A 2OG2A 4A27A 2DWOA 2EFHB 5KJFA 2GAIA 3AV0B 3LW7A 5ESWA 4D3ZA 1JDBC 1B16A 1LBIA 4FS3A 4L74A 4YT4A 1SBYA 2XCUA 2YIJA 5BWMA 4P3XA 4WNCA 3RBZA 3AUKA 1C9EA 3U4DA 1PS9A 2XIJA 2YQ5A 3K20A 4GOJA 4RF3A 4UBIA 3SYMA 3URMA 2FEMA 3OOEA 2GAAA 3OHSX 1K6JA 4PFJA 2IU0A 1M0WA 1UQRA 5FHRA 5H3HA 4MKZA 5BYBA 3W6OA 1YB2A 1U7OA 1EX9A 2PX2A 3NFYA 5CM8B 5U1PA 3LP6A 1ZSYA 2JIMA 1QHSA 2XB6A 4HMQA 4B6GA 1SHKA 4PIVA 2YCLA 4HWPA 4Z9BA 5FO1A 3SLKA 5EI5A 1W9HA 3K53A 3QPVA 3FZYA 5F23A 1CNMA 1TF5A 3QG1A 4WBNB 8MHTA 2ECQA 1T4CB 3CX3A 4Z9YA 5JG7A 1MJHA 5I9NA 5IWAB 2NTEA 3HUFA 4MVJE 4NJMB 4A0QA 3PNKA 2VCYA 1PWZA 1UWCA 4TRJA 4DQXA 4LECA 1YRQA 4EVQA 1VYTA 1SB8A 4WZAB 1WCV1 2OHJA 2NU6B 3N9IA 4EI7A 2H51A 3A6GA 3W06A 2NTVA 3EDOA 3CA8A 5DN6D 1O6CA 1PGJA 1WAMA 4G0OA 1IM2A 4MDHA 3HFRA 5CVDA 2FYTA 2B8TA 3B8HA 2H07A 4F1JA 1B8PA 1XBTA 3S2SA 2FPOA 2OHGA 3PXEA 5JLJA 3H65A 5CB0A 2JLQA 3REQA 4AYTA 1M5RA 4AS3A 4KODA 1GG8A 1ZKDA 1QVAA 5A1JA 2ZUUA 1E2QA 4LQDA 1XF9A 2WJHA 1EGHA 2OV6A 1HX7A 3M5WA 4MQLA 2CLOB 5FUVA 4Q3CA 1SCKA 4NPCA 1UFQA 3EXEA 4GC5A 1GKKA 4R83A 4A6XA 3V9AA 2WM9B 1DKLA 5KU7A 3ISTA 3QYJA 3MS4A 3MQ2A 4HDSA 4ZD6A 3Q11A 1UXJA 5I9BA 3F67A 4PHTA 3QY9A 3C7CB 4J0DA 2C5LA 4M8KA 1KU6A 1TC2A 3RAGA 3B51X 2ORIA 4LXIA 3G89A 3ZS9A 3GNQA 3WHPA 3N8NA 5K6TA 5ALPA 1X1AA 1DAFA 1ZESA 3CVXA 3KYCA 5ED4A 3D7LA 2FSPA 5KTSA 2GPNA 3WSTA 5B64A 4TYNA 3NIDB 1U8UA 4K3UA 3JX9A 4FXOA 3IXLA 2I2FA 3WGHA 1ZUIA 2H7XA 5C37A 4MEJA 4PQFA 4DCUA 4EZBA 5K6RA 1BMFA 4MS4B 2G5TA 3ENVA 1UXHA 2WZCA 2IE0A 3PUZA 3UOAB 1HYBA 3HWSA 4OIFA 4Q1VA 4TWZA 4ZQCB 3RPEA 5I3ZA 1L2TA 2VZ0A 3DL0A 3SN6A 1BRTA 5JYCA 2OLKA 1SCDA 5JYDA 5E9AA 4RL4A 3E81A 2QD3A 4DJTA 2Q3LA 2C5GA 3WIDA 4UMFA 1I2MA 2VSNA 1B41A 4CLEA 2ID4A 4HAUA 2C4WA 3UXYA 1SUEA 2FAXA 3NMUF 3IUQA 4WX2B 2BGJA 2RAPA 2YMLA 4PQYA 5KX5A 4KXYA 2AD5A 2XX3A 1XXHA 5FTNA 2DR2A 1LRLA 2QM3A 3PQ8A 2J5BA 4RGYA 4LJRA 3WQBA 4HP8A 4F60A 4X65B 3Q6NA 1S7CA 1OKKA 3H1GA 3LX5A 3OKFA 4BMSA 3REQB 3JD4A 3MCZA 5LWHA 3OX4A 1SKUA 1UKZA 5J23A 2IDMA 1FYWA 4KIFA 3CZPA 1IZZA 1SCBA 2GUWA 4OGWA 1PEAA 1YTLA 2ZDHA 3H42B 3ZE7A 1IOWA 4OQYA 1DOAA 4M0FA 1Q5PA 4MYTA 3T7IA 1NDUA 4ZDKA 2Y05A 1PW5A 1DBIA 1JFRA 3EXEB 3Q9LA 5EKDA 1ZJ6A 1VHLA 1ID8A 4I5EA 1DC6A 3TAHA 5DW3A 2C3UA 4PG4A 4EKYA 1KARA 4AIRA 4HDSB 1FW6A 4J7UA 1EP9A 2HADA 2X76A 3A6PC 3TOXA 4CNBA 1UXIA 2YS7A 3OEHD 2VBGA 3W6ZA 2Q4OA 3EZ9A 1FLDA 2V5AA 1JFTA 1S02A 3QSGA 2K87A 2KLBA 2G9RA 1U1DA 4P54A 2XZTA 1MIHA 1ZNYA 3SI7A 3ELYA 3WLRA 1ZCBA 3MCTA 2PGIA 1P8AA 4N03A 1VKNA 2ERXA 3T1NA 4AY6A 5LYYA 3E5HA 4E1AA 1OIWA 3EEQA 4M83A 4A23A 1E7QA 1EK1A 1ODJA 1UJ2A 4IWNA 3AF4A 1KZ1A 2AMFA 1ZL0A 3TOCA 4AURA 5K9ZA 2I33A 2O2SA 3F3KA 2VF7A 3KQMA 1VKZA 2OZVA 2QLFA 4OQQA 3UF0A 2G1PA 1BAPA 2BFDA 3IMGA 4UASA 4G81A 3FHTA 4N9WA 4WKPA 4B2PA 5IVHA 2JHFA 2Q6TA 3SDSA 4K9RA 4QVIA 2VZ8A 2X8JA 1VE9A 4KO8A 3OEWA 1HE4A 5KX5B 3WO0A 2XUZA 1XXHB 3CRVA 4M49A 1MJNA 1UPXA 2JAHA 4Q1BA 4TZKA 1ADJA 3HSSA 3QMPA 1L5ZA 4K6CA 1USUA 2VJBA 3FMGA 2VP0A 4DY4A 2IIPA 2DPLA 2YUTA 2EV9A 2OHFA 3D3EA 2BEVA 2WHEA 3H04A 5CU7A 4IINA 2FMTA 1BJTA 4ZOAA 2QF7A 3GLHA 1X8JA 2BHNA 1TUIA 3QYPA 1XC7A 5AJXA 1E9CA 2CKMA 1N0IA 2YVUA 3STYA 2JIOA 4YAJA 2WF6A 3A2MA 5JH7F 3IDSA 4LYAA 2Z83A 3W6UA 3C87A 1NWHA 1UMCA 4V39A 3PUXA 3QV2A 4JN6B 2QENA 1R6UA 3DWEX 3S8MA 3TZCA 5CJJA 1Y6ZA 3AEUA 2C94A 2QSZA 2VBCA 3QVKA 4BZPA 3T3OA 3I9V1 3IKLA 4DG8A 1L4FA 1RXYA 2EC5A 4FSHA 2VXOA 4UD6A 1BKSB 2A8YA 3OAAD 3RBXA 4ZZ0A 3K5PA 3K1ZA 2Z9DA 3N58A 2ZITA 3CC8A 4XM1A 5ALRA 4WK4B 4HVLA 3AFMA 4YREA 3SLRA 4OMUA 2F8MA 2ZS8A 3NM5A 4MUHA 4J8PA 1KO1A 4MINA 2JHAA 1RC0A 1J8QA 2PMKA 2IBTA 3CUKA 2XE8A 3O6VA 3P2KA 4KRYA 4BLRA 4GU5A 4U5XA 5FYDA 4JBGA 4F6RA 1IN5A 3SBOA 1CS0A 4OHXA 3WKEA 1S2GA 3F5QA 3CN7A 1TXGA 1LI7A 2BFDB 4MV6A 3WMGA 5J40A 3DG9A 3NO4A 4RVUA 4BB6A 4CIVA 2WF5A 4XEHA 2JAWA 3PUHA 1NLZA 4MGZR 5C1IA 1BFDA 1WMEA 1IRXA 2X8JB 3PIDA 5CNKA 4JZKA 5HZMA 5IS2A 2B7LA 5EPEA 3A3YA 3TKAA 1GUZA 2PSDA 1YS7A 3ESYA 1HZJA 4MHSA 3UCEA 3SS9X 3EUAA 4D9IA 5JVDF 3K0BA 1H2EA 1W2HA 4N4AA 7MDHA 3UPTA 5IM4F 4YRLA 3SEAA 5BSRA 1NBIA 1JH8A 1CR1A 1NHWA 1M2OA 1TEVA 1GZVA 3O21A 4LZAA 4KQKA 2BEVB 4UTXA 2GNAA 4BO0A 3NAMA 4HUTA 1PJ8A 2XNKA 2CDAA 4QBKA 2PUFA 4EKIA 3GLHB 1KJYA 3B1XA 1JEDA 1ZJ5A 3K96A 1GOTA 1Q0ZA 3W5HA 3P71T 4X7PA 3MPUA 3PR1A 4B46A 4JV5B 3SXPA 5I45A 2GCPA 1KRWA 1JSLA 1J0BA 5JSKA 4UXJA 1PWEA 1UMCB 4LNAA 4DMMA 4DNOA 1DJMA 4MCJA 3KK0A 1CHNA 1U0RA 3RVJA 5C32A 2FI1A 4KQJA 3QUBA 1C8BA 2Q5HA 1YS9A 2DT8A 2C7GA 3CSSA 2P6RA 3L04A 3U9SA 1H2HA 5CBKA 3TTWA 3LPCA 4MJ7A 3HACA 4ZV9A 4AQ7A 1EG7A 2VQDA 1HC7A 3FROA 4IDEA 2C97A 2JCGA 3OBBA 3QXHA 2O2HA 4FGJA 4ZKDA 3PDHA 3PE6A 2XT9A 4BKOA 3GFRA 3W5UA 4XI9A 4ERXA 3DQPA 3R7SA 1JQAA 3EFHA 3IH5A 5LWQA 2OGZA 4PWZA 4EHNA 4D80A 3F6YA 1NTRA 2R1ZA 2NO4A 1CS0B 2QLBA 3D0QA 3RYCB 2C3OA 2W9XA 1S2OA 5AW7A 1IHXA 2PNFA 4ZXFA 1NRWA 2SCUA 3EEYA 3NI2A 4OI2A 4QWMA 1M6YA 4DVJA 5JCJA 2XSZA 4YP7A 4UU1A 1QBGA 3EVEA 2P6PA 4B6FA 3LRPA 4H60A 3PQ4A 4JXJA 4NMWA 1DFHA 1K7YA 1I13A 1R0XA 1A97A 3EWAA 4MYUA 3C5VA 4WLUA 3RK1A 3TEJA 5EIHA 5FTJA 3W1VA 1SKYB 1YDFA 3I1JA 1Z4QA 4NBRA 4YQZA 1ECGA 3IUBA 2J33A 5CCDA 1T13A 1M2OB 1K66A 3HKDA 5IJ0A 4GKAA 3OX3A 3T34A 1VB5A 2YMPA 4A0FA 2LR0A 4OMCA 4C88A 4FNMA 4KXMA 4F3YA 4YCMA 4KPEC 1S8OA 2IYOA 5DRYA 1TM4E 3RK4A 4LF4B 3DXZA 1WPRA 1N1EA 4EJSA 2WYVA 2C2ZA 3HLTA 4QOJA 1X1DA 1F4PA 2VR1A 5FL7D 1GDHA 3AJEA 5TT0A 2D2EA 3VQTA 4QFBA 1WZNA 4DNQA 5EWJA 1M7BA 3O3MB 4MDFA 1V1JA 2X8LA 1F2VA 1RLMA 1RHQA 1RXEA 1SCNE 4CDGA 5LQRA 1YCDA 1VZ2A 1YCFA 2FY8A 3PHGA 1KFJB 3C3CA 4RZQA 3EPJA 1BHQ1 1HRKA 1SHZA 4EGQA 2VHQA 2OBFA 4TS3A 4D46A 4LVOA 2VA9A 3TTYA 2C8LA 4Z7NB 4PLGA 5JJ5A 2VHXA 4CKCA 4TTQA 3QMWA 3JY6A 3IAM1 3T7CA 4CR7A 3LRTA 1FNDA 3QE9Y 4U4AA 4DC1A 2H4FA 2G88A 3U0BA 1L4LA 3B13B 4HEA6 3PX3A 5TC4A 4DJFC 3GJ0A 5AVWA 1XFAA 2QW0X 4JUFA 4R0VA 3TAUA 4EF4A 4PZ0A 3ENWA 1ESEA 1OB2A 2SCUB 4QT0A 3WWEA 5T4BA 4PU0A 4LDQA 1RXWA 2NWQA 5AW4A 1JH9A 4XKJA 5F7ZA 3PXDA 4M0MA 1L0BA 4P4LA 3EX7C 3AVYA 2BMVA 5BOSA 2GTHA 3GJYA 4GPTA 1MC4A 4BE4A 2HQRA 2ZSEA 2ET6A 2NPFA 4WD3A 3JRWA 3G59A 4TPKA 2RIRA 3F3MA 1GUDA 1K97A 2H4JA 2ZSDA 4CTNA 4HDQB 1HV8A 4C5AA 5ICEA 3KEQA 2VN8A 1A4IA 1GGMA 1E0SA 2OBMA 3KPWA 1SOWA 1OILA 4MSUA 4M8SA 5IJ0B 2V8OA 3HKDB 1PG0A 5KIAA 3ZIDA 2JLBA 2YMQA 4Q4DA 4LNHA 4F4HA 4OU4A 2VDKB 5EAIA 3IMEA 4UAVA 5DEIA 3HXQA 1FPMA 1GL6A 1P7ZA 2WJZB 3H3FA 4LWPA 5IVDA 3W5DA 4EW1A 4AICA 3AXSA 3STWA 1U8ZA 2C2HA 3I04A 3MMNA 4UCXA 4DYVA 3K09C 2HA5A 4EJSB 4EVSA 1DC3A 3T35A 5CUQA 3V4OA 5EUBA 1SA0A 2VUHB 2HRDA 4E2YA 4IJ5A 4MPTA 1FBNA 5EWJB 2AWNA 2F7SA 2R11A 2GPJA 2ONYA 3KVOA 3M82A 4NULA 5DI9A 3MUFA 4HLDA 1GCUA 4GI3A 3OE5A 3OO0A 3I9FA 3H9EO 4BMCA 5CFOA 5KQLA 1IZ9A 1SCAA 5LB2A 4ZOLB 2LXNA 2QAIA 3MUEA 1JAHA 3NGXA 4EPRA 4BVEA 2VPPA 1IN1A 2DWQA 3CISA 3ZWQA 5K8UA 5A7HA 4C4XA 4KW7A 4JD5A 2QYSA 2VHWA 5IC6A 1YA6A 2ZTUA 3P52A 4Z0TA 1RZRA 2YZ2A 2D0PB 1XTJA 4B4OA 3O38A 3KHSA 2JJ1A 4G5GA 5EWMA 1JB1A 5CCEA 1D6MA 3IBSA 5L6LB 4NFHA 3LP8A 1N5DA 1N6IA 5DYGA 1A5TA 1FXWA 3ZUGA 1P0IA 1QQTA 1KQOA 3WZLA 4EMSA 2A1TS 621PA 3U4MA 1MHPA 4UBNA 3CTMA 2VJKA 3QVVA 4LWOA 5BOSB 2HF7A 4MARA 2AFRA 2PLFA 3VYTB 4QRHA 13PKA 1GKLA 4DVGA 3PKJA 2JLCA 4BUZA 5C2JB 3KLNA 4GPIB 4TV8A 4QYSA 1QG4A 4KMMA 3EXAA 1NYRA 2E1PA 3DMGA 5GONF 1Y37A 1XDSA 2NXCA 3D43A 3ZHCA 4DIEA 3KJHA 2WF7A 4GOKA 5CT4A 1LPOA 2C0CA 3PPWA 3QTBA 4DBLE 3G23A 2QRMA 5CURA 1F3OA 1FMCA 3ECCA 3HJTA 2C00A 1WTAA 4RIHA 3SX2A 2JG3A 1HFKA 2BGNA 5LDDC 1QLHA 1N0UA 1XEWY 3WNZA 4GNRA 1RP7A 2FOIA 3PWTA 1K63A 5K3OA 4GGMX 2VQSA 1QZTA 1OA0A 2W2XA 1NR7A 1SA0B 1DAHA 1TK3A 1XZEA 2NZUG 3IJ5A 4JJGA 5JAHA 1U1FA 3SIPA 1PL0A 1AUQA 1UWLA 2Q3MA 2IZ7A 4Z0HO 4BDSA 3WTCA 4MRRA 1JA0A 2G72A 3C8HA 3DMTA 3PSHA 3SC2A 3B9BA 5HE9A 4DMKA 4DCOA 2GN1A 2B6HA 4K9NA 4EG4A 1GA1A 1OU4A 2PD4A 3KB2A 3OU7A 4KOEC 1C9DB 3W7BA 1OSNA 2GCEA 3N87A 1C1XA 4A82A 4ZP1A 1OBHA 3QEBZ 4HX2A 3HCBA 4HADA 1SVKA 3AV3A 3PQEA 1U0BB 1IZ7A 4R40A 3EDRA 4DCNA 1MB4A 1RMYA 2GEFA 3R1IA 4P5PA 3WIBA 3RFFA 4OH1A 1NP6A 5G02A 1XDUA 2XTMA 3H8JA 1DEAA 2EX0A 4CL2A 5K4AA 5EWMB 3FOEC 1J8YF 3IA7A 1JN0A 5HFAA 4X64B 2Y2UA 2FFHA 1M8KA 3TW0A 4IKPA 3HYLA 4XZ3A 2OO7A 1V2HE 1TD9A 2E3JA 2E1RA 2G5GX 1KZ4A 2IEAA 1T1GA 1W4AA 2OCYC 3EBPA 3GFSA 5B6PA 1RQ2A 4WA8A 2IH2A 5LDGA 4L85A 3T5CA 4QJ3A 5J4LA 1GZ6A 2EIXA 4RMJA 1DIOB 2WKSA 4KXVA 1J99A 1Q7GA 2YWBA 1MQAA 1HBJA 1RQPA 1Y6GA 2A3RA 3PT5A 4TV8B 1MPXA 1GZUA 2BI8A 4W5TA 3JYHA 2I8AA 1ML4A 5F64A 1RWXA 5HF9A 5DCUA 1L7BA 2WMDA 3L0SA 4U9IS 4LF8B 4IXNA 4UVIA 4L9SA 4D9MA 3RS0A 2CNOA 1WKCA 3BA6A 1ABFA 2JFPA 1A2QA 1LPMA 4B40A 4TS1A 3CEJA 3Q98A 3DO5A 2RH9B 3TRJA 1TZJA 2W6MA 4H7PA 1E9FA 3G1WA 3L7OA 1FFGA 3ONDA 2C5BA 1PYDA 1JALA 2R2AA 3ASZA 1KZGB 3GUCA 1TB4A 4PAOA 4EPVA 1WPGA 4UNQA 4F3CA 2JDIA 1PGPA 3ZWVA 3KZXA 3ZDRA 4EHFA 1DWQA 3DOHA 5DO9A 1XRQA 1CU1A 4PZAA 1WMDA 3BN3A 5JH7A 4YALA 1Y9EA 5BRJA 3SC2B 2ZRKA 4QQ8A 4YHBA 1NW3A 4B83A 1ULTA 5FWYA 2X9LA 1Q7TA 1VLZA 2X1HA 4QAQA 5BT9A 3B6MA 4DWJA 1ISMA 3VGJA 3QWIA 4IH1A 4C3VA 1OWLA 3CZCA 5ECGC 4B6EA 4TM8A 4MGEA 4YR9A 5IRCD 2FVYA 3OJLA 1UBOS 3HA2A 1DQYA 3DLIA 3OIVA 2BHRA 1B0ZA 3EGEA 4J0FA 4KXQA 2YZGA 4AJIA 1SQGA 3Q6IA 3SYKA 4M0LA 1XVIA 4KRFA 4DNXA 3GW8A 3B1JA 3RCBA 4L8FA 3D7MA 3I76A 5KOIA 1E89A 1GSAA 3AIMA 4AMBA 1CEXA 2WIAA 3NH6A 4KRGA 1YJBA 1AV6A 1ATIA 4EJSC 4I1SA 1G3IA 1GARA 1OR8A 4FUTA 2WV9A 3ZY4A 4FDLA 1OZAA 4US0R 5C7YA 1KKUA 1BZYA 1OVGA 2BGKA 5EHNA 4YUVA 4CRWB 4RDCA 4DHWA 5AO9A 3KB8A 2EQ5A 1BX1A 1IOZA 3EY9A 4EB8A 4F6CA 5KQMA 4ER5A 3CVYA 2G1KA 1XTKA 2WINI 2C9MA 1YC2A 2D1RA 1NUUA 2DJIA 4HK4A 1GTSA 3NYRA 4W7IA 1NASA 1USVA 1XVTA 5AI0A 5IM4A 1KDRA 1QONA 3RS9A 3T3MB 1UJNA 3PC3A 2NOAA 2WHQA 1DXOA 1P6QA 1SIUA 2H1WA 3WL7A 3LY9A 2DBVO 1TZKA 3MWGA 1RZ3A 1T3SA 1CQIA 5CEEA 4RPIA 4ZTZB 2GVZC 2JZNA 3DB2A 3EZNA 1ODFA 2G82A 4FVTA 5KTYA 1XZIA 1IVNA 1CFJA 1MOPA 1U6KA 3ES9A 3L0PA 4MRNA 3M70A 3S2YA 1ULZA 4UEJA 5JH7B 5JS8A 3VZQA 5K3DA 5C5EA 1HNZB 2C95A 3O3OB 4FD3A 4PR0A 5FWYB 1THZA 5JC1A 2FW1A 4CBVA 2VHVA 3FUWA 4TYPA 1KAMA 5HPYB 3N5KA 1ZRHA 2QTBA 4MWZA 4MRAA 1AGPA 2OP0A 4ZVPA 3LCJA 3SYTA 3CVWA 2H0AA 3KXDA 5KNLA 3LKVA 1CJVC 3LQFA 4XE5A 2UU9B 1DFGA 2M98A 2FUKA 1GG2A 4XSHA 4HGOA 3IGFA 4ZIRA 3R8FA 3HI6A 3R40A 1T0HB 2FWNA 2J07A 1KSGA 5I4KA 4L8LA 4CKBA 2GPYA 5HBRA 3LBIA 1U31A 1WUIS 2P1DA 4G25A 1W2GA 3U3OA 3SC3A 2H1IA 3ZDEA 2J6IA 2P9CA 4NF2A 3VAAA 2V3WA 1R74A 2OY0A 5LLSA 1KO5A 1E2EA 2BFFA 4QHSA 2E4WA 4MKRA 1LY1A 4BQRA 3OZDA 4A5OA 1AO3A 1XDDA 4IQFA 1GQQA 4M1SA 5LQSA 3U48A 2EJBA 4ZYYA 4K0KB 5KTKA 4HNAA 1GVNB 3WA7A 4NKRA 4QELA 1M54A 1H9CA 4PPQA 1DKPA 2IYAA 2WTBA 3AETB 1VG1A 1EUZA 4KN9S 1ODCA 3ROTA 2NXNA 2J3IA 2J59A 4J7XA 1FNBA 3PGVA 4LGMA 3E8SA 1MKYA 1UFRA 3UVEA 2FEWB 2Y92A 4R1PA 1NUPA 2XVMA 1XZKA 4EA7A 2VAXA 4WLFA 4BU0A 2FKNA 3L40A 1CQIB 2E85A 4HGRA 1VPVA 3VH4A 1SURA 3BWDD 3IVRA 2JFBA 4MPDA 1MENA 4ZU3A 3I39X 1ZCAA 2Q45A 1LPSA 3JD2A 3LUJA 3QFFA 4JFAA 4KTVE 4Y7CA 3BD7A 2P9BA 5ITSA 1QFMA 4B82A 1WMBA 1Z39A 1IUPA 2WSBA 2A9KA 5GM2A 2C77A 3IEUA 1RWKA 1WY7A 1YR1A 1TRHA 2IUSA 4O4LA 1KS9A 2DUUA 3RT7A 4Y3UA 3WGKA 2V7GA 4OHRA 4I2NA 5NULA 4XPIA 2BFMA 4QYWA 1MNAA 4ZIRB 3FNBA 3PITA 4G41A 2O2EA 2Q29A 3T4PA 2VOJA 4NU8X 1VP3A 1H2XA 1V8OA 2IQIA 2RIPA 4CG2A 3NPAA 4CKBB 2W6JD 1Q20A 1GTJ1 1P5HA 2R47A 3TSYA 1QP8A 1VMKA 3QOFA 4M1KA 4NAHA 1H2YA 1PSWA 5C31A 5KS2A 5BQFA 4D43A 1P60A 2OGUA 2OC9A 3VNRA 3HR8A 3N0VA 1FFDA 4N18A 1MW8X 3ETJA 1SVMA 3WA6A 2BFFB 2R86A 5J5CA 1EXWA 3E3LA 3DMTC 2X0EA 2OCIA 3U81A 4EX7A 3JWPA 4WNIA 1TE2A 4HGNA 4HNAB 1XZNA 4KGVA 4WK0B 3WQSB 1BROA 1MDBA 1ND6A 3QBEA 2FX2A 3QQPA 4JHLA 3HA7A 2ZRHA 5BP7A 2HRRA 4WPGA 3HJGA 3F9CA 1LU9A 1A4XA 2I2DA 3BH6A 1I2DA 4EABA 4F7DA 4B73A 3KD3A 1OFTA 3HBLA 4ZJZA 1KRHA 1OBOA 1ZDMA 1Z4PX 4MA4A 3N8IA 1NBOA 1YCHA 4RMHA 1JSRA 1ODKA 1RADA 1PU2A 1YRHA 3HTXA 1COWD 2VDVE 1FOEB 2P9ZA 1NC3A 2V58A 3IJRA 3SBXA 2D4HA 1R4AA 3QWBA 1EWKA 3DMFA 4GQBA 1L7OA 1YJ5A 1NYQA 2NTNA 4FI3F 4L9AA 2CVPA 4XDHA 5EVJA 3TCNA 2EW2A 2AOUA 4N76A 4N0EA 3HJRA 1U6JA 4MWTA 2P3OA 3C5WP 2G3YA 2OFXA 4MIKA 4HQRA 4O4LB 4F3NA 2QUBA 3OD1A 1OHHA 3LCUA 1B2RA 3DUFA 5LD2C 1N8NA 3VH1A 1ULUA 5EYPA 5CT8A 1SCQA 3MEQA 3MTQA 3QW2A 1WBJB 4XPIB 1KDYA 5J58A 4DR5B 2VK2A 3FAKA 1YQEA 4NAVA 4X9XA 2PMCA 2AOXA 3KKOA 1NVVQ 1UDXA 2GARA 2C9ZA 4OB6A 2ZG6A 3WP0A 1XIVA 3UENA 1AHHA 1CNEA 1G9XA 2O5RA 5T4HA 3NT4A 1DFIA 4F06A 3QEOA 3WRXA 5FHQA 3FPLA 3PICA 4XGRA 1CUEA 1TVCA 5B36A 3STXA 4MVJA 1D4ZA 2DTEA 3FWPA 4IXTA 1NUAA 2HBYA 1AUOA 1GFWA 1ZJ4A 1XU4A 3GEHA 1HKHA 3RSQA 2NO6A 3HV2A 3DS8A 2AOWA 1VB3A 1K7SN 1LWNA 2P41A 4I1RA 4ESHA 1HOTA 3KPUA 4L4XA 4DCSA 4Y0VA 5ALZA 3V3TA 4TX1A 2YZKA 1JHRA 4YASA 5EPOA 2BGRA 3VR5D 2WM3A 4P58A 3VO9A 1XMPA 3PS9A 2A4KA 3PE3A 4IV0A 4QPPA 1SH7A 5F76A 2HMVA 5F33A 6NULA 3THXA 3OTWA 1M73E 2W2OA 3ELDA 5AXBA 1RMTA 3A1DA 3H5NA 4KAFA 4WK2B 2GYYA 3HB1A 3D6HA 3V8NA 2OZPA 1CUGA 3AI2A 5BNTA 1NF8A 4BO1A 1WW2A 1A4UA 4OX9Y 3GA5A 1LDGA 1DP4A 1M0EA 3RQSA 1MXHA 1BNCA 3BEOA 1I3KA 4BLWA 2AOUB 2V6IA 1L4HA 2ZRDA 5AYVA 3AY7A 2P40A 2HREA 3WYNA 4AP6A 3OPVA 1LV7A 3AOEC 5AKGA 5F73A 2OAP1 1EFLA 3KL2A 5GP1A 1T2FA 3WRWA 1JYSA 1O4VA 4KH1A 1V4VA 2O57A 1JLHA 4PRYA 5TGTA 1W1IA 4YNBA 3DUFB 2GSDA 1V45E 2CMFA 2XUHA 1YOVA 4L78A 4YO8A 3REFA 4B75A 2PO7A 5EYPB 4Z9FA 1MG5A 1U7UA 1UK7A 5AQEA 4B5KA 1AS0A 4KIWA 4D4LA 2VP5A 1XQXA 2WC1A 3CGWA 1OGJA 3JQGA 1SQFA 2E5WA 2ZJ3A 4L75A 1LVUA 5DE3A 3P9ZA 3HA3A 3QA3E 5DBFA 1DCKA 3DULA 1WULS 2XEDA 4B4UA 4FINA 4GMDA 3EH2A 1JSZA 3B5JA 4WE3A 1NVKA 2PRJA 1XK6A 2XODA 2V0NA 3HJNA 3SOPA 3S8YA 2VHUA 3GZ4A 1Z9BA 5LIRA 3AR9A 2OQRA 5K3AA 2JGFA 2G4CA 1W76A 3ZVKA 2XA1A 4M0DA 1Z5OA 3OZBA 4BJ1A 2EP7A 3W1WA 4DM4A 1TQ4A 5HOEA 4TSFD 1W30A 3G02A 1WSDA 2II6A 3NBXX 3H9QA 2XRMA 4XQCA 5EFZA 5FA6A 4BEBA 3UFXA 1CRQA 2WHXA 2YHUA 1GKYA 1LLUA 4HVTA 2R60A 1R0YA 2R79A 3O3CA 1VFPA 4TT3A 4OI1A 1A8UA 4RQBA 5A4IS 4IIJF 1ORHA 1WVGA 4QXQA 3KXPA 1CP3A 1VCOA 5GZ3A 4JXXA 3ZD8A 3B3QA 3RLIA 1XMXA 4IVPA 4N7MA 2E82A 3THXB 4NMLA 1NIPA 1XVAA 5IG2A 2OYSA 1Y1SA 2F48A 3BFPA 2BMDA 4K9QA 4U2BA 4U6SA 5A2QA 4UXHA 4JI6B 4MNTA 4MUAA 3IUNA 3WADA 4NHEA 5AOVA 1SCJA 1YQQA 1L5QA 5M04A 4BGIA 2B1GA 4GPBA 1EIWA 3H0CA 3LUCA 2HQ1A 2SECE 3G85A 2WP0A 4MW0A 3T61A 2QN1A 5C80A 3HPQA 5B4VA 3NIGB 2P77A 4WWHA 1MLDA 1TM1E 3E9QA 4OI4A 5ESXA 1ILWA 1H3EA 1YOVB 1P9OA 3O2NA 5BNFA 5C35A 1Y98A 1YACA 2A2ZA 2YOFA 3V6LA 2JEYA 4DWVA 1BA3A 3QJYA 4W6ZA 2RC6A 4XQ0A 1UKVY 2O9JA 3IOBA 1D2CA 1FDIA 2NVWA 3EZXA 4CCAA 3BSSA 5LXTA 2JRCA 4HWOA 3UAWA 2Y1CA 4V0SA 1K0UA 1PP4A 4WUTA 3VYUB 3VKWA 2DRIA 1UEIA 1A9QA 1RS0A 4E3WA 1G7TA 2OCGA 4BQQA 2YYAA 3KSUA 3OOJA 4C7OB 1TMYA 1L5OA 3AVXA 4GX0A 1FDSA 2WYHA 2BKLA 5EWLA 3ZQ6A 4ZYTA 3KBOA 3O4VA 4PNZA 3VVLA 4GL2A 1QX4A 1SVSA 3H5RA 4TV9F 4NECA 1Y5RA 1TCVA 2FN9A 2QU7A 2QGZA 1XZCA 4UEOA 5AVUA 3K6SB 2XCLA 5JBNA 3B36A 3IURA 4FFBA 3U13A 3VOTA 2P68A 1CDEA 2J67A 4D26A 1PT7A 1MOZA 3DQQA 3UFXB 3L1KA 2O1WA 4B2IA 3N28A 3OZXA 3K2EA 3WFIA 1DX6A 2R5NA 1E9BA 3DEKA 4NESA 4YROA 4AXBA 4H31A 5A4AA 4HRXA 4ITVA 1H6DA 1PEYA 3Q8WA 3U3XA 3WJAA 4DDHA 1NZJA 4JJZA 1S3SA 2QKYA 1FYEA 1VE5A 2YS6A 3NKVA 3D6VA 5F7OA 5C9ZA 3GROA 1OU0A 1NXPA 5GINE 1EK2A 2VPXA 1NF9A 3NJ8A 2FOLA 2AD1A 1NP3A 2JATA 3AF5A 2YINC 5CDHA 4E5DA 5IASA 3DLAA 1ZLXA 3QLUA 3PVSA 1NDQA 1RWWA