3CH4B

The crystal structure of human phosphomavelonate kinase at 1.8 a resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
195
structure length
188
Chain Sequence
GSMAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphomevalonate kinase
publication title Crystal structure of human phosphomavelonate kinase at 1.8 A resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 65
structure length 188
sequence length 195
ec nomenclature ec 2.7.4.2: Phosphomevalonate kinase.
pdb deposition date 2008-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04275 P-mevalo_kinase Phosphomevalonate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ch4B00
2ZRJA 4X8HA 1G64A 2P6RA 4POAA 1GRRA 3B1XA 2KI5A 1T4GA 4OK3A 2YZ2A 3IQWA 4X8LA 2FFHA 2ZRAA 1KGDA 1OV4A 4DLYA 3EZFA 1XPRA 1WE2A 2BV3A 2YWHA 4MA4A 4BECA 1E94E 3NBXX 5JSZA 2GK7A 2P0EA 3GJ0A 3CM0A 1NN1A 4URYR 2DWOA 1T0HB 2TMKA 3LQQA 1XCGB 5CIWA 5AK0A 3T61A 1SXJA 3QBTA 2FE4A 2W0MA 4Y0AA 1RFLA 5TV2A 5C4MA 3WRXC 4QJ4A 4HDQB 3KX2A 4BPBA 1EGAA 1KI1A 2XOKD 2NO9A 4KFSA 1ZD8A 1G9XA 3CO5A 4MITA 4ZO4A 3U3KA 3VKWA 3BBPA 3KL4A 1CJVC 2O8BB 1AIPA 4TZ0A 3T12A 1NBMD 1D6JA 2ZYUX 3X1XA 2MMGA 4A2QA 1Z83A 1E0AA 5KPDA 5TVKA 3V4FA 2A5GA 4TL9A 4DB4A 4PPGA 4QJ5A 5FPSA 3ETLA 2CL6X 1U90A 4Q9HA 2CMKA 3VX3A 1E0KA 4FCTA 5K8IA 1L2TA 3RSOA 1AKEA 2FDCA 4L8GA 4KO8A 4QBGB 1HEIA 2CLCX 4Q1BA 2GAOA 4CT5A 2ZVPX 2C8VA 2ZJZA 2ZJOA 4Q1DA 3BIFA 1PLJA 5LD2C 1R5OA 2ASEA 3OIUA 4DT1B 2C9CA 5JI2E 4KFRA 2ZJ5A 2ZS9A 2C5LA 2XZLA 3Q72A 4ZKEA 3ASYA 1GRQA 1PUIA 3R9IA 2HXSA 3QEOA 1OFUX 3P4XA 2AK3A 5CJPA 1W36D 2WWXA 2PMKA 5ELXA 3BH0A 4Q1AA 1K8RA 2OE2A 2OSBA 1W4CA 2C9OA 2W2TA 3L0SA 4RZ3A 1J2JA 1FTSA 4NCIA 3RSLA 1FX0B 3MRSA 4D4KA 1U99A 4P4SA 3TQFA 3QUSA 5IK2A 1D5CA 5FUWA 1SVLA 3OEEA 1MH1A 4Q4JA 1M7BA 2GJKA 4RD3A 2ZS7A 4Q19A 5AR1A 4A2WA 1E2JA 2CHGA 3O47A 2QM7A 3U3RA 4DDVA 4RSGA 721PA 4LJ8A 4HAVA 2ZR0A 3H1TA 1MOZA 5KU1A 4W5JA 3SR0A 1P9WA 2DWQA 5DSZA 4PO1A 3TSZA 2QMUA 3C15C 3KB2A 3KXKA 4TLDA 4LSGA 3EIEA 1QG2A 3VKGA 2XXAA 4HDOB 3AKCA 4YONB 3G5UA 1Z8FA 2YVUA 2IA5A 1DO0A 5EUQB 2XGJA 3H4MA 4P4UA 3W9YA 2IS4A 3CX7A 4D0LB 1KMHB 3OIYA 2GXUA 2ZRDA 3SQWA 1VG9B 2OCPA 1EX6A 1QVRA 4B47A 4E03A 4JL5A 1FPMA 5BXQC 2JCSA 2ZI7A 1NVVQ 3B6EA 1Z6XA 4DCUA 4TSFA 4B2IA 1T9HA 1YZNA 2ECKA 2VBCA 2C04A 2VSOA 4MRRA 3GJ5A 4OI1A 4B3FX 2QP3A 3A1UA 4XWAA 1XPOA 3W3ZB 4HUQB 2QMEA 2QP4A 2O8DA 4EJSA 3THWB 2ZSFA 1E2NA 2VHCA 1ZNYA 1NLFA 2Q9CA 4PHTA 4W5HA 2OXRA 4R2HA 5B58C 4D26A 1LS6A 1E2LA 2LKCA 3B5JA 3FKQA 1GSIA 2JEOA 1JBKA 1CULC 3OAAA 1ZNZA 3X1YA 3AGPA 1BMFD 3DZDA 2DBYA 1CU1A 2LWIA 5C46F 2WSSA 3KJEA 2RH5A 3RHFA 4DDWA 2O5VA 3T35A 4ACBA 2GAAA 4DLRA 4UXHA 4QNRA 4TT3A 5G40A 1P6XA 1P2UA 5JJLA 3FVQA 1CEEA 2PBRA 3KFXA 5LD2B 4KYUA 4XTCS 1CTQA 1E9RA 2F9LA 2OCYC 2X19A 3BB4A 1G18A 3W6PA 1NMYA 2NMVA 4JL6A 4H9GA 4DDUA 4WAUA 4XOIA 4B2LA 1XXHA 2ZRHA 1E4VA 1S4QA 2PX3A 1QHGA 2WPDD 3UANA 1FL9A 3PFIA 4GOKA 2BMEA 1EFCA 1JJVA 1JQJC 1KY3A 1NY5A 3MFYA 2J87A 3OFND 4TYNA 1WF3A 4URZR 4QXAA 1NRJB 3ECCA 4LJ5A 1GAJA 3WMEA 2RGNC 3AKYA 4EPXA 1IY2A 2ZTSA 2ZSBA 1DAFA 2E9SA 4LYFA 3K70D 1TPZA 3O8BA 1KMQA 3FYHA 1E9BA 5A0FA 1X8JA 5KNBA 4ILEA 1R0YA 4JT4A 2QAGB 4NL4H 1COWD 1ZBDA 5EE9A 4DBLC 2XNSA 3EZ2A 2AKYA 3A4LA 2VQSA 4QM7A 1SVWA 3VKHA 2R65A 4FXPA 4NYIQ 5GJVC 5EXTA 3BS4A 2VA8A 3LVQE 4LWZA 1TUIA 2FSGA 3ZZTA 4U7DA 1KI2A 121PA 1S1MA 2OZEA 4NE2A 4C7OA 4JJKA 2VF8A 2IHBA 3R9XA 2GZAA 3M4YA 2CCKA 1OYWA 2PLFA 2L0XA 2QT1A 1YQTA 1XEXB 5JS8A 4NONA 1E0SA 4GBMA 4KYIB 3U44B 1K5DA 2QT0A 3LX5A 3UIEA 4D80A 2O8EA 3CZPA 2GTPA 5DO9A 4AG5A 3VNUA 1QHYA 1E2MA 1M7GA 4JSTA 4TMTA 4CGZA 1N5LA 3PQCA 3PUYA 1N2CE 2I1VB 4TL7A 2V54A 4KLNA 3D7MA 3IO5A 3NC1C 3LXXA 2P6UA 4DVGA 2WMNB 1OXTA 1XEFA 2G88A 4TYWA 2J7PA 3BB1A 2QPAA 5DYIA 2GF0A 2BVNA 3TGPA 2GXSA 4DWJA 2FN4A 2W6JA 3EARA 3IDQA 3RRNA 3CH4B 3X2SA 2P2LA 1D9ZA 2SHKA 4ZI2A 3ZGXA 2VP6A 2PLRA 1JAIA 1CS4C 1G4UR 1G5TA 1KHTA 4BFSA 4D25A 2KBFA 5FTLA 1SQ5A 4R98A 3S1AB 4A6XA 4LX0A 5FPKA 1NIJA 5FFMA 2QSZA 4EPTA 5TDHA 2F3TA 2FF7A 1NNEA 2BHRA 4OQLA 3T15A 2OFXA 2VP9A 3K9NA 4DCTA 3LBIA 3AGQA 5C4GB 3BK7A 1XBTA 4BFTA 4FI3C 2GDJA 3MGCA 2IS2A 2R6GA 3BORA 2QTHA 4RCZA 4LJ7A 2IF2A 2ZSAA 2Z43A 1E9CA 1P9RA 5JRZA 1C4OA 3C5HA 4Q66C 4A6PA 1IM2A 1IN5A 1M74A 2Q6TA 1PJRA 2GRJA 2RGEA 3VMFA 2NPIA 1DAKA 1W0JD 2Q21A 3AB3A 5HE9A 1WB9A 2NO7A 4K81B 2ZITA 2RMKA 4HB3A 1NSFA 2AX4A 1FTNA 1S3SA 1E9AA 4JIMA 1WMSA 4JLJA 3LBNA 1CKEA 3ZH9B 4CEHA 3ZQJA 1S9HA 2W6IA 4ITRC 4O0MA 2JDIA 4PQRA 1DAGA 1HE8B 1XD2B 4LHYA 2GCOA 4IVRA 1RC8A 2FSHA 2WMOB 5EE1A 4AIIA 5J4VA 2YWEA 4C2UA 5IK2D 4TMVA 5KSOA 1A2KC 4GSYA 1FW6A 3OEED 2JJ1D 4DLUA 5J5CA 1Z2CA 3TE6A 5J47A 5JHGB 4M1OA 1KO7A 2CVFA 3MWJA 1ZC4A 3P20A 2V55B 1AA9A 4PAMA 1JXMA 2BBSA 1QDEA 1QHXA 4US1R 2JLVA 4LPKA 1KI9A 1G3UA 4DHEA 3KZ1E 4LCBA 4L16A 4QNMA 1KO4A 3BE4A 1O3YA 2IL1A 3MWYW 2QUZA 4TYQA 4AYTA 2Z4SA 4BFWA 4XWKA 3GLGA 4NP6A 4JL8A 1R0XA 1GOTA 4LJYA 4OI0A 2ZJYA 3LV8A 5CK5A 4NHOA 1OT3A 1HE1C 1LFDB 1A82A 2IX3A 4OYHA 5SZJA 4NYMR 1L4YA 4A0FA 3THXA 2IYWA 3AF1A 1TQ2A 4Q9IA 4EPWA 2OESA 1KI3A 1QVAA 2HV8A 4GNKA 5CYPA 1XCMA 4KVAA 2OM2A 3RLFA 1AS3A 1R0ZA 1AQYA 1GKUB 3L0IB 1Z07A 4V03A 5TXGA 3UMSA 2A5JA 1ONBA 4HB4A 5SZHB 1UADA 2REBA 3LD9A 4TLBA 4B32A 1KK2A 2YC4C 4PSAA 5EXPA 5B30A 4LC0A 3LRPA 4BFUA 2QBYA 4X8MA 4B6EA 5J4YA 1E9FA 3RS3A 4D4JA 1G7RA 1QHHA 1X86B 2WM9B 4Q18A 2Q3HA 1G17A 1G6HA 2XOKA 3PENA 1U94A 4MDEA 1CJUC 1NLZA 3VHLB 2ANBA 4CEIA 1R2QA 1E2IA 4UXIA 1TF2A 1E2KA 3GD7A 2OLKA 2WSMA 3WYFA 1SVSA 1MV5A 3BGWA 1YZQA 3FDIA 2WJIA 1MO5A 1GIAA 2QL6A 3BJIC 3E70C 4M1SA 1AS2A 1OIVA 2VH5R 4F38A 3FPAA 3OAAD 3WP1B 4DCVA 5F3WB 4KBGA 2XTNA 5BYKA 2WSSD 4P32A 5EJEA 4WXPA 5C2JB 3GLHB 1B0UA 4Q7MB 5CK4A 2ZYTX 1NN3A 1E2EA 5FOUA 3WHLA 4XIGS 3QPWA 5J4HA 5DLQC 1TQDA 4NYJQ 4QGHA 4QM6A 2UKDA 2CCGA 3K0AA 3QXSA 2PEZA 3NH9A 3DM9B 4B43A 4JVLA 5DI3A 2AHOA 3A1TA 1U8ZA 3K0CA 2VHQA 4P0TA 3EPKA 2IXFA 5SZKB 4RKEA 3TSOA 2J45A 4GMXA 3G82C 2EU8A 3I73A 2VIIA 4ZIRA 2AK2A 4ARZB 2E87A 3TBKA 3U4QA 4OHXA 1X8LA 3K0FA 5EE0A 4W5WA 2J5XA 3CNOA 1Q21A 4LI0A 4US2R 5CM9C 4Z8XA 3SYLA 4MRNA 1E9DA 5DE3A 1KSHA 4MDFA 5JJKA 4HAXA 2VP2A 4PSKA 3KB1A 2K5UA 4PPFA 2R9VA 3EZ6A 2F55A 4G5SA 4MKFA 1NJGA 1Q3HA 3DHWC 4PC3A 4KHZA 2OO7A 1VPLA 3A4NA 4TN1A 1R5NA 2DR3A 4I1SA 4TL6A 3WY9A 5KDOA 4B6FA 4LGMA 2HF8A 4M9SA 1AQUA 4BLTA 2QTVB 4Z8YA 1Q44A 1Q3TA 2KSQA 4AI6A 1Z06A 2FH5B 4G5GA 1NKSA 4L9WA 2FZLA 4F4CA 1AM4D 2N1BA 4HZUB 2FOLA 4UNPA 3CLVA 4AC9A 3JVVA 1W44A 2WWHA 3KDSE 1P61B 3CW2A 5JWHA 2O8CA 1XF9A 3O8DA 1VKJA 2NO0A 5JI3E 2ZRFA 3LBHA 3THYA 4NDZA 1TMKA 5A4JA 3I8XA 1X8KA 1JXOA 1OLOA 1Z22A 4L9SA 4TZ6A 1M8PA 3R7WA 1XPUA 3FGNA 1GILA 3AP2A 2VP0A 4FWIB 1P73A 4NCKA 4V0LA 3R20A 4L4UA 3W5JA 3NEYA 2G0TA 4TLCA 2H57A 3GFOA 1HURA 4ZPXA 3BC1A 3VR4A 3EZ7A 3KTAA 3SBDA 3A1VA 1OH6A 2ZRLA 3F3YA 3IUYA 2W6JD 2QEQA 1BYUA 1Z5ZA 2EVWX 2P5SA 1DVRA 3EPLA 3MJRA 1SVMA 1ZD1A 3F5FA 4TTQA 2YINC 2CNWD 1CJMA 4H1UA 4C2TA 5JCZA 1VCMA 2F1IA 4LRWA 4R2IA 2I3BA 3TW8B 3PV0A 1K6MA 3EC1A 3AEZA 4RD2A 1BMFA 2ZPTX 2R6CA 2GESA 4LDJA 1G8FA 1QHNA 5KO2A 5DGXA 1TAGA 3A1WA 4A8JB 1E1RD 5KSYA 3QF4B 4Q4HA 2J9RA 2NGRA 4CVNA 2KWIA 1D2MA 3AUYA 3TIFA 1MABA 1U2RA 2RGAA 2FA9A 3NEJA 4PFSA 3B8HA 3VX4A 4BEJA 4RD1A 1N6NA 3W6OA 3IEVA 3DMDA 3AP1A 3E1SA 2OBNA 4IJMA 5EE5B 1E2DA 2X77A 3GJ6A 3A58B 3RWOA 3U3JA 1U8AA 4M1TA 2ZRGA 3UWOA 3GLIA 2IYTA 4URVR 4CEJA 2VTKA 4WOPA 4URWR 1WQ1R 4IRUB 3GPLA 2WPDA 4PHHA 4QG7A 4RD0A 1XZQA 4CYMA 3OFNA 4YDSA 2F9MA 3VU9A 1JR3E 3IBYA 1IN8A 1KI7A 3QKSB 4V02A 4BFVA 4JLMA 3DDCA 1GRNA 2BOVA 4JLOA 4OKSA 2W6ID 5H68A 5TY0A 2F7SA 2UZIR 1ZW6A 5G53C 3ZVLA 5KYKA 5FBRB 1NKTA 3KXLA 1UEIA 1ZM7A 1Y63A 4A2PA 4C0SA 2I4IA 5KNDA 1GFIA 1KO5A 5HZKA 5ANRB 3KJGA 1Z0DA 3NIBA 4IFBA 4A0RA 1M1YE 4ERNA 2O8BA 3CF2A 5G41A 1SULA 1COWA 4B76A 3KQNA 2RGCA 1LW7A 1Z0AA 3PUZA 3IEUA 2OFWA 2ZRMA 3I61A 1G3IA 2BMDA 1XMIA 1ZNXA 2QRNA 4BZPA 4D0NA 4TL8A 1VCIA 1AK2A 4UJ3A 5D3MB 5BN4A 2O0KA 2HLDD 2R44A 1G7SA 2GZDA 3VQTA 3SJAA 3U61B 4PZLA 3A6PC 2YYZA 5HR5A 4IEEA 5JEDA 2FNAA 4EFMA 3EA5A 4B3CA 2OCBA 1DE0A 3K09C 1XRJA 4QKQA 4NBSA 1GL7A 3ZVRA 2IYZA 4QHYA 521PA 1GM5A 2XTZA 3U7EB 4BLOA 1ESNA 2ERYA 4JS0A 2CL0X 2BBWA 3EASA 3Q5DA 5EUMA 5FPTA 4EDHA 4DT1A 4C0KA 3UG7A 1ZVQA 2B21A 4HATA 2CXXA 3N2IA 4OQMA 4A1FA 4F91B 4J0QA 2ZYWX 1NL3A 5FH9A 2QPTA 4ASUD 1VMAA 3HJNA 1UBGA 4HI0E 2A78A 2PZEA 1CIPA 1L8QA 5DH9A 4PQFA 2IHYA 4DSNA 5LDDC 3NXSA 2IXGA 4UNRA 3ICQB 3BAFA 4BRUA 3JVUA 1IY0A 3AH8A 4U02A 4XJXA 5KHOC 1ZM2A 2ZSEA 2GHIA 2QG6A 4GOXA 4M1KA 2CHVA 1P2TA 2YWGA 2OFOA 2YV5A 2BBOA 3G0HA 1ZNWA 3L8ZA 4Q4AA 3CRVA 2IBMA 1US8B 1OW3B 1OPXA 2DFKB 3NHBA 2R6AA 2N42A 4TQ9A 5FUXA 2O8FB 2IYLD 3B60A 3SJBA 3AKEA 1PVOA 4JVNA 4I99A 3B1VA 3EPHA 3PXGA 4LOAA 2H8KA 5L3SB 1XDBA 3FOZA 3Q7PA 3QOFA 4G01B 3GMTA 1U9IC 4Q47A 1YRBA 3SBEA 3AVXA 2IYRA 2O52A 3KKPA 3LW7A 1UKEA 3MUFA 1R8QA 2AL7A 2JA1A 4QC2A 2VLIA 2IUTA 3BOSA 2LKDA 5DHAA 1E1QD 1SVIA 2QU8A 3CZQA 1M2OB 1ANKA 4MKHA 4II7A 2ODNA 4YXWD 4GFDA 1J8YF 2QA5A 3SFZA 1W0JA 1KMHA 1DAIA 1Z0JA 3P1JA 4JLNA 3W8NA 4JVSB 4DXAA 2J7KA 2ZRBA 4MYHA 1OF1A 4E09A 4MYUA 1W4BA 2QROA 4P33A 1IJEA 3ICEA 4JKIA 1GP2A 1YZKA 4MRVA 2ZEJA 2FSFA 4EUNA 1T6NA 2XITA 3SJZA 2WJGA 4I81A 3IHWA 4DSOA 1X3SA 1LV7A 1XZPA 4CDGA 1O87A 1PUJA 3LW8A 3SJCA 4YMTA 1F2UB 1XJCA 3GLHE 5B64A 5C18A 1G5PA 3THWA 1EFTA 2ZU6A 1D8TA 3CRRA 3ZYCA 2JJ1A 3VR3A 1XJ0A 1G8PA 5E4FA 3TW4A 1U98A 2RAPA 1ZJ6A 3ZZ0A 2Q9AA 3GJ3A 2FX3A 4ESVA 1NSTA 2QAGC 3HU2A 1JPNA 4HEJA 2ZANA 1SXJB 1U0LA 2IF0A 2QPOA 1JPJA 1QHIA 2X2EA 2YOGA 3B2EA 3GLGE 3DZ8A 5J40A 3LAWA 1KI6B 2IW3A 5FUYA 4BZXA 1NMZA 1U9IA 1ODFA 5FI1B 4HAWA 1J8MF 1EX7A 3CR8A 5FPYA 1RRGA 4JBWA 3WHKA 4C0LA 3Q3JB 1RJ9B 1YZUA 2P3SA 1C9KA 4JSYA 4R9UC 4Z51A 1TTTA 3KUCA 2YWFA 5FR1A 3RS4A 2NTYC 3FWYA 3DKPA 4AKIA 2WIAA 4JMPA 4M22A 4KITB 3T5DA 2WKPA 2QBYB 3B1YA 1F5NA 4AKEA 3W3AA 4F92B 2BKEA 1IQPA 1GZSA 2CK3D 2QMOA 4KJZA 5AWFC 3SYNA 1TEVA 2V7QA 2IYQA 3SS8A 1WBBA 1T3SA 1U0JA 3ZVMA 3QXXA 4DEYA 5E95A 5JCPA 2GJAA 2VRWA 5EP4A 2A5YB 1I2MA 4Q7KA 1M7HA 3IO3A 3TNFA 4WA7A 1ZC3A 2GEUA 5G3YA 4XWOA 2J0QA 2JJ2A 1Z6YA 3RS0A 4BLQA 3EPJA 3TR5A 5KDDA 1NBME 2FSIA 2GJ9A 4U00A 2FWRA 1P60A 2WVJA 3L8YA 5KTYA 3CH5A 1E2HA 2RGBA 4JZKA 4CT4B 1EG7A 3DOEA 1CXZA 3P26A 4M4SA 1N25A 2UZ3A 3HYTA 3NDPA 2EYQA 4GPTA 1NIPA 2ZQ5A 3KKNA 3BB3A 1XTJA 2ZR9A 3SHWA 1Q1QA 1KDPA 1GWNA 3FE2A 3CX6A 4NYIR 3P4YA 4D82A 1ZIOA 3DL0A 3K1JA 1T8UA 1FUUA 3NDBB 4KFUA 1M34E 3OIVA 3CIOA 5E7IA 2DB3A 3U44A 3AVTA 4AD8A 4GZMA 5EQTA 3OZXA 2EFCB 4C3ZA 4CIDA 1XD8A 2W2XA 3QKUA 221PA 3CF0A 4GMDA 3LLMA 3RWMB 3VAAA 5F98A 2HCJB 2XX3A 2EQBA 5TMPA 1GKIA 1R0WA 2X2FA 2IK8A 1R7RA 2BJVA 1OYYA 2ZI3A 1VYUA 4B34A 5JWOA 2B8WA 2OEPA 4JLVA 4TMZA 5E7MA 4D4MA 1FMLA 4RKFA 4KV9A 1OH7A 3NC0C 4BLPA 1AS0A 1II8B 3PEVA 5CLLA 4B2PA 5HPYB 1OIWA 3CRW1 2QM8A 3HDTA 4F4IA 1KNQA 3AF4A 1U81A 1F2TB 2DHRA 2JLRA 2NO6A 3AVPA 4F4JA 1VHTA 2HT1A 621PA 2EFEB 3LDAA 3T34A 3MG9A 2DWPA 2ERXA 4B3BA 3U6BA 4HB0A 4F93B 2DFNA 3RYTC 3TR0A 4B33A 2GK6A 4IKEA 3QKTA 2D62A 2O8DB 4EJSB 4AKGA 4PHGA 4ZDJA 3KFVA 4EPVA 4D0GA 3CF6R 2G77B 1FNMA 3LFUA 2GCPA 4RJLA 2RCNA 2JIZA 3TAHA 4BE7B 2G0NA 5FOWA 3PG5A 2W00A 3SDZA 3GQBA 4NU0A 1EWRA 1G20E 2IWHA 3NH6A 3WNDA 5CITA 1PLLA 5BWMA 4MUAA 3I5XA 1KI8A 2FFBA 4QGAA 2WBLC 1HV8A 1W0KA 4RFSB 4URXR 1NN0A 3REGA 4MRSA 1MRNA 2BEKA 3ZS9A 2RGNA 5EXXA 1BS1A 1T5IA 1N3BA 2G1JA 1OKKD 1XD2A 4URUR 4BGDA 2D2EA 2CE2X 3EWSA 1KKMA 3K0EA 3UMFA 1RRPA 2CNWA 1XMVA 3FHCB 3B9PA 4M8NE 1GNQA 4EQ6B 1WDTA 1UEJA 1G16A 3OIWA 3QJYA 3MMPA 3AVUA 2J59A 5AJYA 5GVSA 3WMFA 1KYIA 1SKQA 1AZTA 2AWNA 4NCHA 4Z1MD 2D06A 4AK9A 1HUQA 4QBFA 1E1RA 2ODEA 3KKOA 5EZ6B 1IBRA 1JJ7A 2IC5A 4M2LA 1HT2E 4IOMA 2ZR7A 4M1YA 4JYCA 3TRFA 4ABYA 1G4AE 1G3RA 5FTMA 1KSJA 3PR1A 4NZYA 2HJVA 1R8SA 2JGNA 3ZJYA 2XNDD 5EXSA 3AVOA 1Z3IX 2PCLA 4YDHB 2V6JA 5CDFA 1OFHA 2FEOA 2QZ4A 3KJHA 2Z5FA 5KSPA 1P7CA 2H92A 4FIDA 4N3NA 3GLIE 2QENA 2Q0HA 4FMBB 2D3WA 4KSBA 1UKYA 5HTKA 4ZCIA 1DOAA 3RS5A 2C03A 4LYHA 3RRMA 1LB1B 2QN6A 2ZUDA 2ZJAA 5H70A 1CR2A 1ZMXA 3D8BA 1DAHA 3DKVA 1OFTA 1VG8A 2C78A 2QQEA 3TUJC 1N0UA 3I32A 1YR6A 5J4KA 4DCNA 3KQKA 2FMXA 2CCJA 1QZXA 1E96A 4RZ2A 1R5BA 4JLPA 2PZFA 2ZIAA 3GEIA 1ZM9A 2WOOA 4DLTA 1G19A 1E32A 3A8TA 1OHHD 4RD6A 5BN3A 3QIAA 4I1VA 4JJZA 3WBJA 2RGXA 3HU3A 4Q4LA 4D4LA 3UXMA 4B75A 3I5YA 4C9BA 1EFHA 4S2EA 4JLAA 2A9KA 4KLZA 1N6OA 3NBFA 1E69A 1F48A 3GJXC 1CP2A 2HLDA 3FMFA 3HR7A 4DCSA 3QXHA 3H86A 3RS2A 3OEHD 1W4RA 1RE0A 1W4AA 1Z2AA 2V1XA 1Z0IA 4D81A 3QXCA 5BN5A 1OXXK 3U7HB 2IYXA 1CR1A 3BWDD 5DYGA 1I2DA 1IN4A 5CJ2A 421PA 1W2HA 3LVRE 2DPXA 1LY1A 2BMFA 4QL3A 1I4DD 2ZI5A 3GCGA 2HCBA 4QHTA 5JLJA 1JALA 1YRAA 4YMUA 5L8VA 2HXYA 4G5RA 1H8ED 4DIEA 1ZYUA 3W8RA 3W34A 3BFXA 3LNCA 2REOA 4NKRA 4NYJR 2IXEA 2WKQA 3LH5A 1W5SA 2A3RA 4ASUA 2V7QD 4JT2A 3FKSD 1GL9B 1CR4A 1S3GA 4Y0VA 3WNBA 3I4LA 1SXJE 1YVDA 4L5BA 1G7CA 2H5EA 2JAQA 2WJHA 1E79D 4ARZA 2ZVQX 4QOSA 2EYUA 2F43A 4RVCA 2V3CC 1Q20A 3GEHA 1KAOA 1ZRHA 5FL7D 1JB1A 2JJ2D 2RB4A 4B48A 2AN9A 3GLFA 4I1OA 5AUNB 3CR7A 3C14C 2OAP1 3CWQA 5HCNA 4MGKR 3F0TA 1IXRC 3UK6A 5IT5A 4W9MC 3VTKA 3FHTA 3JZMA 3TH5A 1ZIPA 4CEHB 4IOKA 1XTIA 1MRSA 3TUIC 4BFYA 4IFEA 1KZGB 3UPUA 1KK0A 2GF9A 3OHMA 4HLUC 2O0HA 5FI0B 4A8JC 2QNRA 2GCOB 4AYWA 1HQCA 4RY2A 4HB2A 2W0SA 4FW9A 2V6IA 2HUPA 3H2YA 3PJRA 4EPYA 2QRZA 3WMGA 3AVWA 3KKQA 4HZUA 1E1QA 4R71A 2IUSA 1LNZA 2Z4RA 5FOSA 4YXWA 1YKSA 3HR8A 3WYGA 4I4LA 3EZ9A 2J0SA 2HF9A 1AZSC 2VP4A 2MMCA 2XB4A 2ODWA 3GLGB 2DFTA 1G8HA 5K8TA 4A0GA 3AVVA 4NYMQ 2XTMA 3WRYC 2BEJA 2F1RA 2IYUA 2V4ZA 5G3ZA 1DG3A 2AFIE 2CJWB 1IN6A 4JYBA 4M21A 2JLWA 1G3QA 1W2GA 5EP2A 1AGRA 3ADDA 2BCJQ 3X1ZA 5DN6D 2PMDA 1P2VA 2VF7A 1XTSA 2WWYA 2B92A 2J3EA 4FD2A 4QHSA 4E22A 1TNDA 4OI2A 2ZAOA 3P32A 4UNSA 2ORWA 3U3MA 3CPHA 4Q1EA 1R4AA 1CLUA 2E1RA 1H8HA 3RANA 4ZCLA 5CB6A 1G3MA 4MGIR 2GJ8A 3O8CA 1GITA 1Z6GA 5DI9A 1WA5A 1NN5A 2BM1A 2RKOA 3IIKA 5JHHB 2WAXA 4B3DA 2VP5A 4K46A 3EX7C 1Z08A 3R9WA 1JR3D 1ZM4A 4PPQA 4B35A 3IPXA 3I3SR 3PEUA 2FFQA 4Q1CA 4A8JA 1QHHB 3O8RA 1E3MA 1NVWQ 3K9GA 4FMCF 1VG1A 3N70A 4K8OA 4B3XA 4EPRA 4CEIB 2BMJA 4KSCA 2P67A 2GWHA 2JIZD 4AY2A 3VNVA 3BFVA 3LWNA 5AUOB 1VECA 3TQCA 5HE8A 2V1UA 2GETA 1VYTA 2ZJBA 1SKYB 2BCGY 5CIQA 3EXAA 4M9QA 4ZDIA 2A2ZA 1E2PA 2CK3A 1VIYA 2GXAA 3TSWA 2ZE6A 1BIFA 4DB2A 2D7CA 2ZREA 4IOLA 2WJJA 1W0KD 5DISB 3QKSA 5KSZA 2HJGA 1EWQA 1DARA 3ZDQA 3LX8A 5FOXA 1CF4A 3VFDA 2ONKA 4XD7D 3QNUA 5KUTA 4S35A 3K0AB 3NTUA 4EAQA 2VSXA 3I72A 3QG5A 4GL2A 2P6NA 5DI3B 2HYIC 3BH6A 2WWWA 4LHXA 1GVNB 4C0QC 4KXFB 1TADA 1W7AA 2H18A 4DLVA 2Z83A 2YOHA 3IIMA 3IKJA 1UDXA 1ELOA 3NBZC 1KJYA 4ZIRB 1W36B 4KODA 5AUQA 2D7DA 2ODBA 4PC1A 5AJWA 1RRCA 2GNOA 3N2EA 1LS1A 1T0JB 4XH9B 3K0FB 4H1VA 1E2FA 3KQUA 4B73A 4V0KA 2ZXUA 3SOPA 4HLQB 1QG4A 4PO9A 3W90A 1DEKA 2HYDA 2WWIA 5KDLA 3U6KA 1P62B 3K70C 1E4YA 1X1RA 1GDDA 5GJWC 4DRZA 3FMIA 2YNMA 1T5LA 2ZRIA 3NVAA 4Q9LA 4TLAA 1EESA 1JI0A 2WJVA 1S0UA 2MSEB 2VEDA 3AF2A 1P75A 1FQKA 3A1SA 2MSCB 2AD1A 3MCAA 2VYFA 3QXJA 4LHZA 4V0NA 2GEDA 2RGGA 2WAYA 2I1QA 4PR0A 4D2IA 5F9HA 4LC1A 3J81k 2OBMA 3IPYA 3ZQ6A 3ZVNA 4JLKA 1I4LD 1XXHE 1AGPA 1Z29A 3SC3A 1GNRA 3WNCA 1DTSA 2AD5A 5KOYA 5JMTA 3TJZA 4LBYA 2ORVA 3AV0B 1R10A 3ZD6A 4HSEA 3DO6A 1VCNA 3EC2A 4TLEA 2GILA 4LJAA 4HAZA 2O8CB 1Q22A 3LA6A 2FJUA 3ADCA 3LXRA 2ATXA 4BASA 1N6HA 2AXPA 4NH0A 3THYB 1IXSB 1Q1EA 2A30A 2YJTD 4GZLA 2NOAA 3TVDA 2OLJA 3R7WB 1E6CA 2IWRA 2REXB 4PC6A 2ZUBA 4PANA 4PSVA 4U5XA 5TARA 3REFA 2XB2A 4ZV4A 4IDQA 1OXVA 2G83A 1SXJC 2P65A 5JRJA 2OBLA 4IHQA 4LHVA 3U5ZB 2B7CA 2G9NA 3L0PA 3RC3A 4A15A 4C0BA 3DM5A 3C7KA 3A37A 1RZ3A 2WWGA 2XZPA 4Q01A 4PHFA 2IYSA 1OXUA 4LJ6A 2BBTA 1XB2A 2ONJA 2OT3B 4Q1FA 1QF9A 4N1AA 1YR7A 4L15A 1E2GA 1ZINA 5FBLB 4TYPA 2IUUA 5AUPB 3ZIAD 3K53A 3A4MA 2J0UB 1N6LA 1UDWA 3QBVA 1DADA 1UPTA 3UMRA 4Q4HB 1ZU4A 2XEXA 1CBUA 1G1MA 5IDVA 2YKGA 1MABB 2CVHA 4Q5IA 4AWXA 3AF3A 4WBSA 2CBZA 5L3QB 2VPPA 1XEWY 2ZJ2A 1NP6A 2VHJA 2FZ4A 3DMNA 1P2SA 1TQ4A 2XJ9A 3IBGA 1OKKA 2NO1A 3L82B 2HDNB 1NF3A 2QI9C 1WXQA 3T5GA 1F2UA 1FX0A 3H0KA 3TKLA 3WYAA 4RZXA 1FP6A 1SHKA 1L4UA 3K8YA 3GLIB 4UXJA 5K8LA 5JFGA 1KDTA 2CL7X 4MYCA 3FMPB 5EP3A 5FTKA 3ZZUA 4ACAA 5C1BA 2NG1A 2A7QA 4B71A 1RYFA 5EP1A 4Q03A 3I92A 3GFTA 2WV9A 3PCRB 4OBEA 3VU9B 3UATA 4Z1MA 4A36A 1TUEA 1DELA 1DPFA 4OQNA 1X1SA 821PA 2VSFA 1PV4A 3QKRB 3B78A 1II9A 4C30A 6Q21A 3K70B 3CONA 4HLDA 1KI6A 2GCNA 2WICA 3B82A 3K09A 1JQLB 2FGKA 1Q0UA 3LQRA 4RFVA 1SVKA 2ZRNA 1HTWA 2ZE5A 3SZRA 1T3HA 1DAEA 2XNDA 5H8WA 4A92A 2W83A 1RJ9A 4P3YA 3E5HA 4PZZA 5CDFE 1M6NA 4DKXA 2ZETA 1D9XA 4OHYA 4OK6A 4GP6A 4A4DA 1EFRD 1TF5A 4DLZA 1HT1E 3T1OA 8OHMA 3GJ8A 1S96A 3M6AA 5JBQA 5F9FA 1BYIA 3CB4A 3KQHA 5FUVA 1E0JA 2ZRCA 3EG5A 5FBWB 3NKVA 3WBKA 2EFGA 3FFBA 3PIRA 1F6BA 2BM0A 4P4TA 1NI3A 1YZLA 2ANCA 2IS1A 1NVVR 4OHVA 4HUQA 4YC7A 3QVUA 3M0EA 2QP9X 1RKBA 4XVRA 2NIPA 3IIJA 1ZD9A 4IDOA 3RRYA 4LV6A 4M9ZA 4N0EA 1OHHA 3VR2A 1FP7A 1OB2A 3X1DA 4I1UA 2Z6VA 1H8HD 3V00A 5JSZB 4PZYA 1C1YA 4BQSA 4NCNA 3C8UA 4LYAA 3OEHA 1JECA 2RHDA 1MT0A 1Q1ZA 3RC8A 4Q9KA 3RABA 4TQAA 4EJSC 3U7GA 4AURA 1RVDA 5LB4A 4GP7A 2PT7A 2QQ0A 3H84A 2GBLC 1FNNA 1DS6A 4Q4AB 2PT5A 4IDNA 2JLSA 2IYYA 1H8EA 2JLZA 3ONWA 1W46A 3Q5EA 4R7ZA 2BJWA 2FPKA 2ZE7A 4MYTA 4DUGA 2GXQA 4DC9A 2GJSA 2V9PA 5IHPA 3ND9A 3CUEF 3FKSA 2F1HA 4M1WA 4LHWA 3ADBA 4IEIA 2KE5A 2AR7A 4QBHA 3HPRA 1XU4A 3SE0A 4ZI3A 1E79A 3PEWA 4M53A 1A4RA 1P5ZB 5FOVA 1KAGA 5E7JA 1II8A 1KI4A 1QRAA 1KDRA 4LUCA 3K9LA 4BUJA 5FL7A 4Q7LA 4AYXA 4KI0A 2AFHE 4XTRA 5HKKD 3GLFE 3THOA 5BW8A 1J7KA 1XNJA 1F2TA 3GJ7A 4A0HA 4JBXA 1G291 4BLRA 2QAGA 2ZS8A 4UNQA 1SKYE 1OXSC 3HYRA 2R8RA 4FMCB 4YMSA 4MKGA 4RCYA 2XAUA 5IRCD 3LY5A 4GOJA 2PX0A 1KK3A 4CRWB 1CJTC 4P4SB 3SYKA 5B2ZA 5FPHA 5LPNA 2JLXA 2VO1A 4MQBA 4OQXA 1UBEA 1N5KA 1XEXA 1RW4A 1ZCAA 2DY1A 2GBLA 4Q4JB 4V0MA 2XJ4A 3U3OA 3U7FB 1ZUHA 4ZKDA 1LTQA 1OIXA 1Z63A 1G5RA 1PLKA 2H17A 3TK1A 4DSUA 4ON9A 4OJKA 2OG2A 4MKIA 2GEVA 3UWKA 5D3QA 4B74A 3C4JA 2IEZA 3BRWD 2XZOA 1KTVA 1GTVA 2ZJ8A 1MO4A 4QFMA 3VR6A 4XVUA 3QPUA 3PUWA 4CEJB 2F1JA 2IEYA 1XWIA 4RFSA 2BC9A 2XXAB 4WXRA 1N6PA 3F8TA 1KDOA 1CR0A 1H65A 2QGZA 5DN6A 3R8CA 2XSZD 2JLYA 2F3RA 1W5TA 4WVFA 5LBIA 4C0JA 3QPVA 3SEAA 4OJQA 3LLUA 1T91A 1N0WA 3Q7QA 1KO1A 5F2EA 5IF9A 1G41A 1XFAA 3L43A 4G3XA 4BEBA 1HQYE 3U2QA 1XD9A 1OJLA 2C96A 1ESMA 1A7JA 2J1LA 2NZJA 3PITA 3CWZA 4EQ6A 3CNNA 3S1AA 1S1CA 3CPEA 1HYQA 1IHUA 2ZU0C 4B44A 1KK1A 2QTFA 2WKRA 5KNCA 1JR3A 2RHMA 3QSYA 2ZAMA 4KU4A 4MRPA 1RYHA 2VHTA 4TMXA 4DEXA 4C4PA 3LO5A 2ATVA 4KVGA 3T06B 2C99A 3OE7D 3I8SA 1BH2A 2OXCA 4ZDWA 3HPQA 3N5CA 2C77A 4OK5A 1V43A 1XMSA 2H7VA 3NHAA 2PCJA 3DVLA 3AQ4A 4LYJA 2B6HA 2G6BA 2QSYA 5L3VA 1JEEA 2EWVA 4QGGA 3AF0A 1GL6A 4BZQA 4Q02A 2QGNA 3ND8A 3CBQA 4E5UA 4ZCMA 4TTPA 1GKYA 3QY0A 1A2BA 2JLUA 3B7GA 4UNNA 1CRPA 2UVQA 2BWJA 1VHLA 3NBYC 3W6NA 4F7WA 2QE7D 3OESA 2J46A 4W7SA 2YC2C 1YZTA 2QMHA 4JLBA 3I62A 5FR2A 5FBQB 2HT6A 1Y3AA 4KCGA 1HY3A 3TAUA 1BOFA 3DEFA 4IVPA 3R8FA 3RVBA 5CB8A 4XD7A 1TQ6A 1Q1BA 3FFAA 3TVTA 1Z0FA 1DG1G 3AVYA 1A5TA 1Z0KA 1KO8A 3EIHA 1ZCBA 2KBEA 4UQOA 1WCV1 2KJQA 1II0A 1XXHB 2BKUA 4WIAA 1E9SA 4JLDA 4OI4A 4Q7JB 1MKYA 1UJ2A 2BIFA 3SN6A 2EFDB 1UKVY 5DIFA 3QI2A 3K0SA 3ZLJA 4IXNA 3V9PA 4EKDA 3OF5A 1SXJD 4IDPA 4MGZR 4UJ5A 2ZUCA 5EZ5A 2EFHB 2R6DA 4HZIA 4IOJA 1BO6A 2ZI6A 5JECA 3QEJA 5FBVB 4DJTA 1Z28A 1NJFA 2CDNA 4LV8B 5H1YA 1ZU5A 1HH4A 1VDZA 1X6VA 2GKSA 4LJ4A 4BWYA 2EWWA 4PAQA 4BRWA 4WZ6A 3T1TA 1UFQA 4DIDA 1XTKA 3GEEA 1IOZA 1TX4B 4PX9A 5DNYB 2H1LA 1W47A 3Q9LA 4PXAA 1ZAKA 4C7OB 1FFHA 4FMDF 2JASA 3Q8XB 1E9EA 2O0JA 3KJIA 4MH0R 1L7VC 4LZZA 5CLQA 3L2OB 5UKDA 2IS6A 1JNYA 3RAPR 1RPZA 2ZE8A 4DLXA 5E3HA 2GVZC 4PC2A 2O8EB 3E2IA 1UBCA 1OH5A 3T1VA 1I4TD 2OV2A 3RS7A 4E07A 3AM1A 2FV8A 1MR3F 3IGFA 3HP1A 2V8OA 5FOTA 3VR5A 2FFAA 1JAHA 2G1KA 3FB4A 1F60A 1WBDA 4NTZA 4WZAE 3QE0A 3BH7A 2B8TA 3UG6A 1LVGA 2JJ8A 4AG6A 2RGDA 1V5WA 4Q00A 4G5OA 4QGFA 1NG9A 1NY6A 4TQUS 1XP8A 2Y8EA 3HWSA 1VG0B 4M1MA 3GLHA 4HUTA 4DDTA 4G0NA 2KB0A 1D2NA 2F6RA 1IXZA 3QF7A 1UM8A 3ADKA 1GNPA 3WXMA 2D4HA 2YHSA 3AKDA 3BD9A 1AN0A 1A1VA 4RD4A 3QG1A 1BKDR 2ZI4A 3D3QA 2PEYA 4PC7A 3ZIAA 1RRFA 2ZRKA 1MO3A 3D31A 4DUGD 2FG5A 2DFLA 4OHWA 2X1VA 1OB5A 3MWLA 4PO8A 2W58A 2Z0MA 2WHXA 3EA0A 2OAQ1 1UBFA 1ZP6A 2QORA 3SQXA 4G5QA 1K5GA 5BYJA 4EIWA 1N6IA 2CJWA 1TL7C 2IT1A 1LF5A 2PZGA 4YQFA 2JLQA 3IQXA 5JEEA 4LY6A 4DLSA 4ESHA 1VYVA 5AJVB 1KIMA 2ZROA 2GA8A 1XX6A 2AKAB 1N5JA 5TB5A 1VIAA 4TMKA 3SI7A 3K0CC 2ZSDA 3SNHA 4CW7A 3U60B 4GT1A 1B23P 3PEYA 4LJ9A 5HZHA 3B13B 4M9XA 4G1UC 1TU3A 4JBYA 5JS7A 1S8FA 1KSGA 4TSFD 2ZM5A 1W36C 2R62A 2FU5C 5JJIA 5FL3A 5JZVA 1FOEB 4LPSA 2CLDX 4B3GA 2FPMA 2QAJA 3BERA 2CE7A 3HU1A 3T1QA 1NG1A 3ZD7A 4WW0A 1TF7A 4GRAA 1NBMA 2MSDB 1JEDA 3BXZA 4LBVA 1XTQA 5FTJA 4WZBE 3C16C 2DYKA 3MSXA 3QENA 2ZYVX 2ORIA 1TEXA 5B57C 1DAMA 1KJWA 3SFVA 4EFNA 3AP3A 4QJ3A 1EFRA 4EFLA 3KXIA 1IJFA 2H16A 3SU8A 1CRQA 1SVOA 3B9QA 3TLXA 2NZ8A 1NMXA 2PH1A 4NPHA 1MO6A 4KAXA 3M1IA 5GADl 5AJXA 4DSTA 3FTQA 4IDHA 2FEMA 4TT3D 5HCIA 4ZDKA 1E2QA 2IYVA 1VCOA 1W1WA 1KJZA 1XCPA 4TYYA 3THXB 4DZZA 2C9YA 3P27A 3Q85A 4XSHA 1OFIA 1P4SA 2N46A 3GJ4A 4GDFA 4FINA 4A82A 3QVVA 4BLSA 4O3MA 3B85A 3A36A 1IN7A 3WP0A 4M0LA 4HLCA 1ZM3A 2HEIA 1T3LA 1E99A 3TUZC 1W48A 2C95A 1T8TA 1EFUA 1EK0A 1UKZA 1EXMA 2CHQA 3EIQA 3KUDA 2WWFA 2GVDC 3DPUA 3PUXA 4HLUA 2BDTA 2D2FA 4NCJA 4PPNA 2F43B 4YMVA 2D74A 1S9DA 3QF4A 4LBZA 5GJCA 1D2EA 1KZ7B 1G8YA 2YOFA 3GLFB 1NVXQ 4PAOA 4V0OA 4JKYA 4OQFA 2WZQA 5CM8B 5L3RA 2AWOA 3IILA 4YLGA 1G7TA 1Z47A 2ZI9A 4JVMA 3CKLA 2J0VA 1AKYA 1YJ5A 4PTLA 4Q9JA 2W2VA 4Q21A 1VTKA 1DO2A 2EW1A 4C0AC 2VHUA 3JZAA 3ZS8A 5M04A 2G3YA 2C98A 3QQ5A 2NPFA 4LV5B 3B1ZA 3EAQA 1FUKA 2C2HA 4N0DA 5FTNA 3VR1A 3C5CA 3V4RA 3MD0A 3W5IA 1Z6TA 2A5DA 3D6TB 3PUVA 1GUAA 2LCFA 4LBWA 5HKKA 4IW3B 1SGWA 5P21A 1P3JA 1QHSA 3BFKA 3DOFA 4MGYR 4KFTA 4XSGA 1WP9A 3C41J 1YU9A 2DCUA 3KKMA 3GP8A 2PJZA 3CNLA 4TTRA 4O25A 1KNXA 1U8YA 3KQLA 1YZGA 3RDPA 2JATA 5CYOA 5AJZA 2J7PD 4C0HA 2PJRA 2AXNA 2R6FA 1N5IA 4P31A 4FCWA 4FWTA 3U4QB 1KSFX 1S2MA 5D3MA 5SZIA 1FMJA 4HDCA 4TMWA 1YR9A 3CX8A 3CPJB 4FN5A 1J90A 2QY9A 1SHZA 4BFXA 1FQJA 4V0ME 1E98A 3EW9A 2WJYA 1R6BX 4QRHA 3AUXA 1ZUNB 2FPLA 2Q3FA 4CF7A 2X8AA 2B7BA 2Q3MA 4AKHA 1XJQA 4D6PA 4O2LA 1NLYA 1IONA 2FGJA 1KY2A 2J0UA 5KPJA 1IAQA 1G6OA 2Q9BA 1GG2A 2OHFA 1HA3A 3CRQA 3MJHA 3IHLA 4US0R 1KOFA 3MWKA 1LF0A 5L3QA 3L0OA 2XSZA 4GI7A 4OHZA 4KBFA 2NQ2C 4NMMA 3EWAA 1QBKC 4BFZA 4TWZA 4CZ2A 4DLWA 1DBSA 1Q57A 5A5GA 1RIFA 3MAAC 4X8OA 1U0HC 1NVUQ 1UF9A 2GZHA 1J70A 1P72A 5LB2A 5BQ5A 1JR6A 4QBIA 4FCVA 1FZQA 2OCAA 2A5FA 1PZNA 3K9HA 1US8A 1IY1A 3X1WA 3GFPA 4XVQA 5K8UA 2O8FA 2WOJA 1N6RA 3KTAB 4IVQA 3QKRA 2VL7A 2OUKA 4PQYA 2JDID 4Q48A 3UKDA 1UAAA 4RZUA 5L3SA 3OE7A 1N6KA 5EE3A 1Z6AA 4Z54A 5JWRA 1OH8A 1YE8A 3B1WA 5GJBA 2OILA 3NWJA 3VHXA 4A9AA 1YR8A 3FHOA 3PVSA 1G8GA 1G21E 2J41A 3SHFA 4UKDA 1CJKC 1TU4A 1WRBA 1YHNA 3MLEA 1J99A 1F3OA 4FMDB 2R2AA 4HAUA 4O2RA 4OL0A 2WIBA 3I1FA 1N0VC 4IXMA 2QE7A 3RRZA 5DHFA 1XEWX 3CRMA 3TMKA 4LK2A 3AVQA 1P9NA 3RNLA 1OSNA 3FMOB 1OE0A 3NG1A 1AJEA 1KKLA 1XMJA 2CEAA 4HAYA 1Q12A 4YMWA 4HYYA 1XTRA 1SZPA 3ASZA 1W49A 1ETUA 4MUBA 2PL3A 2P5TB 2ZRPA 5J4LA 5GVRA 2WTUA 1ZUIA 2CLSA
chains in the Genus database with same CATH superfamily
4D4GA 2QKYA 1G64A 4NJOA 2GZ2A 4V2IA 4XCXA 1GRRA 3UAYA 1K0UA 2PYZA 1OPRA 3GDGA 5KVVA 4CEJB 3CE6A 3EJWA 2FFHA 4DLYA 2BV3A 3AETB 2IHTA 5CBPA 2BP7B 4UEQA 3UB2A 5LKRA 3NBXX 2MYPA 3KDAA 4IG4A 1GGKA 2JH8A 1D4OA 3HCNA 5JSZA 2ZBUA 2XCSB 4RUKA 3JQ8B 1G9SA 3JD3A 2INGX 2WIFA 4KZKA 3VR6H 2RHBA 3T61A 1SXJA 1IC6A 2RE8A 4IF4A 1EZ4A 4Y0AA 1DXQA 5TV2A 3ZG6A 2FDCA 2CNBA 5TRTA 4CMHA 2P2DA 2BFPA 2PS3A 4HDQB 1NQ5A 2IPMA 3B51X 3KX2A 3OCWA 3FRJA 4P0PB 2AKEA 1P0QA 2WPNA 1X7YB 2VPWA 1KI1A 4U7PB 3LP6A 4G67A 2XOKD 5CEJA 3B38A 1ZD8A 1KQ3A 3CO5A 4M55A 4PNHA 1CJVC 3DT6A 3C85A 3QSGA 4K3VA 1WVIA 2X7JA 2XRMA 3ESCA 3QWFA 4RGBA 1D6JA 5KYXB 2ZCUA 3ZWNA 1Z83A 3TF5A 1X7DA 4KREA 5KPDA 3GFVA 3V4FA 5T8KA 4DB4A 3V1UA 2CL6X 3GFSA 4EYGA 2I2CA 4PCVA 3VX3A 4YAIA 4FCTA 4JELA 4R1OA 2BDUA 3AINA 2YYYA 3RJTA 5DRYA 4JEUA 1WDLA 1XQ6A 1UKBA 1AKEA 4J4TA 1ETHA 1W581 1C81A 4AF6A 4L8GA 1ONPA 2R1VB 3K20A 3LI2A 3DHNA 3FZGA 4KO8A 3LSYA 3SS9X 2Y68A 2Q0XA 6Q21A 4Q1BA 4RL6A 4Y67A 4CT5A 2P8JA 9LDTA 4D96A 1A7UA 1JMVA 1VIVA 2XYHA 2DPMA 4RK6A 2ZJZA 2XUJA 5J1SB 2IPXA 4J75A 3HCAA 2XNKA 4TT8A 3QHPA 2HRQA 3HGTA 5CPFA 4YP6A 1Z36A 5TJHA 1BG6A 3Q72A 5K5EA 4QJBA 4PY2A 3GP5A 2HXSA 4IIXA 5LQDA 1D8AA 1QIMA 4TKMA 5DZSA 3QEOA 3ED1A 3OCJA 2AFIA 5HF5A 4YRKA 1V11A 1XRPA 1YB7A 2P2NA 3JTMA 3JWJA 4J0GA 4ARIA 2HJRA 1U2DC 1JHAA 4HNUA 1JTFA 4RU1A 3MBIA 2W2TA 4GX5A 4LXHA 2VBFA 3KQPA 1J2JA 4PLPA 5EWLA 4D4KA 3K96A 3RS8A 4L76A 3NFRA 5KQSA 2FPGB 5ALOA 1D5CA 5IK2A 5FUWA 1SVLA 2SNIE 3RIHA 3OEEA 3TNJA 3TDNA 3WIUA 4Q4JA 3ZUGA 4A3SA 2DUNA 4KR9A 1M7BA 2ZS7A 1AGXA 2ZB4A 1E2JA 3KPJA 1KVUA 3RJ9A 3I9MA 2QTMA 1EH5A 1U1IA 4RSGA 2G06A 2JLCA 3QFTA 3OFVA 3LHFA 4U7HA 2OCXA 4RAQA 1EVIA 2CW5A 3SR0A 4BNFA 3T7CA 4CM7A 3CGGA 4O1HA 1MNAA 1PFVA 4KE9A 3UYKA 4BQPA 3C15C 1CP3A 2C07A 3KB2A 3KXKA 2YV2A 2X2OA 3P9SA 4K6KA 4TLDA 3RVOA 1QG2A 3VKGA 2XTJA 4HP8A 2XXAA 3AKCA 1X80A 3R3ZA 3LE8A 1V7CA 2A9OA 2I33A 2Z58A 3AL3A 3L41A 4FYMA 2XGSA 4U3JA 4YONB 1JHMA 2R6JA 4OGWA 4MAAA 4IGEA 1R6DA 1Y6ZA 3BQ9A 4ZAZA 2BD0A 1CT9A 2ZB2A 2IS4A 3TNDA 5B2EA 1G2IA 1K9VF 3T4PA 2YDXA 3OOJA 4INJA 2QTBA 1Y33E 3OE5A 1I94B 1H4SA 3H9JA 3AJ9A 4ZI7A 4E03A 4JL5A 1FPMA 2PBFA 5BXQC 1D4ZA 1JHYA 1IUOA 2R3SA 3RYCB 1TDJA 3EXEA 4TSFA 4B2IA 2G1UA 1G2QA 4OI1A 2VSOA 3I52A 3GJ5A 3LC0A 2E4AA 2J9FB 1U2DA 2WD7B 3AO0B 1FIUA 3P0JA 1NURA 2H6EA 2P3QA 4XWAA 4CV0A 1S2NA 4HUQB 1U2TA 3OM8A 1QFYA 2QMEA 5FPQA 4BNNA 1YI0A 1MCZA 4NOLA 1A9ZA 1Y3HA 2OWEA 4EJSA 2ZSFA 4F11A 1Q0LA 4E7PA 5AVTA 3H99A 3NEAA 3IXMA 3TECE 2VHCA 1ZNYA 2HRZA 3OOHA 5ERYA 4D92A 2CNLA 1RC0A 1TUBB 4E2ZA 4MAFA 4MDYA 1VKRA 5G2OA 5B58C 5KCZA 1SAYA 1LS6A 3FRIA 3FKQA 1YBMA 1S89A 2OQIA 3N8IA 4MB2A 4MHTA 1WXHA 2JEOA 4WLEA 5CA0F 3OAAA 3O9ZA 2QQGA 2QRQA 2Y27A 5LU9A 4UUNA 3IT2A 3JVEA 1CU1A 3X43A 5C46F 4UQPA 1QP4A 5FLYA 2JFNA 1EDZA 2VOJA 2O5VA 2RHTA 3BMNB 5BMVA 1ZCFA 3EXIB 2V0GA 4REMA 5C8VA 2GPTA 3KWJA 4TT3A 1P2UA 2VAWA 3W4IA 1RRVA 3DW3X 1DT3A 3QMMA 4WT7A 1EFPB 1TCBA 2AZMA 3G02A 1KVRA 2OCKA 1CTQA 1Q3KA 3HWRA 3QX9A 4QYXA 4XTCS 4DM4A 1G18A 3II6X 4YMGA 1BD3A 5HHTA 1VB3A 4MIEA 2QVLA 3UAVA 3I37X 4B2LA 5FEUA 4I5EA 1C9JA 4NU6A 1AQIA 5ALGA 3IHTA 2PGOA 2YW9A 1FJ2A 1FBNA 1OWOA 2WV7A 3AJRA 3CN7A 2PX3A 3X2FA 4ALIA 3TLGB 3NJ8A 1FFDA 1FL9A 2LIPA 3EGXB 1EBFA 4KK3A 4ARCA 4TYNA 2NV0A 1FRZA 3EXHA 3INGA 3MFYA 4RIHA 2I2AA 1KOLA 5JU6A 4AMZA 4X1YB 4QXAA 3ECCA 4JWKA 3ENNA 4DSZA 3WMEA 1ISRA 2JGLA 4S0ZA 4EPXA 4QYMA 1JPUA 4C6HA 2ZSBA 2C2MA 4NFSA 5F3DA 4GPAA 1PGOA 1DAFA 5ADWA 5HZMA 3VJRA 1Y89A 4G65A 3O8BA 4YRPA 2HWXA 1O03A 2CHEA 1Y8QB 2PRKA 3NDIA 5DGDA 4N7MA 1E9BA 4XLLA 5JAZA 1TJNA 2MINB 5KNBA 5C5CA 1R0YA 4ISCA 1I3MA 4BO2A 2X1HA 4NL4H 3GCWA 4DBLC 3TGWA 5D87A 4DWOA 5BSGA 4BU1A 1L7XA 3Q3CA 1GRVA 2B2NA 3I2YX 4FXPA 4NYIQ 4UMEA 5EHIA 5GJVC 2CNNA 1O94C 3O8QB 3BS4A 3R40A 4IZ6A 3T3EA 1P33A 4QU9A 4U6QA 3ZZTA 4X9XA 4U7DA 2IDZA 3W5UA 2JFXA 2OZEA 4HWPA 4NE2A 4ROSA 5F1YA 2HJSA 2FLKA 1CRLA 2F59A 1EIZA 1PAUA 1UK7A 2VYQA 2EHJA 3M4YA 1YUMA 3O6VA 1BQEA 1QK3A 3OT5A 1PIWA 4NQZA 3IAXA 3I4FA 3LIIA 2UZ1A 4M1EA 4ZZ0A 3U44B 1TVKB 4INOA 3LX5A 2XCQA 3CZPA 4PZCA 3VNUA 3ZDXB 5JCXA 1OGYA 4R1LA 1E2MA 3BIJA 4JSTA 1D0SA 3KYCA 4WN3A 1I14A 1ZVJA 1BNCA 1PFQA 1DT5A 2MWMA 3TL3A 2I1VB 4HVAA 4O8CA 4NCAA 2GN8A 2V54A 5JZMA 4KLCA 4WEOA 3KLBA 1O4VA 1QLWA 3NC1C 3LXXA 3PC2A 2NZYA 4FGUA 4E5DA 4D5EA 1RYEA 5FA8A 2G88A 1E8NA 3V3KA 5JSKA 1PV2A 1GEEA 1Q84A 2FOIA 1GRCA 3UGKA 4EI2A 4ZWNA 3TGPA 2GXSA 4PSCA 2FN4A 1HE4A 3EARA 3MHPA 1I24A 1RP7A 1W88B 3LC7O 3ROKA 3RRNA 3STXA 2P2LA 3W9UA 1D9ZA 3B20A 4KEAA 2SHKA 5IDYA 3ZI0A 3UJ3X 5ALSA 1KBQA 2ZYGA 5C1IA 1CS4C 2NZVG 4H0CA 1G66A 1G5TA 1UPBA 3LDGA 3TINA 2I67A 1UWCA 3GJSA 5JVDA 1E7WA 1SQ5A 4A6XA 1J20A 4CM4A 4LX0A 3V6MA 4U7FA 2IPNA 1E63A 5DM0A 1O94A 2DT5A 3A10A 3T15A 1VBNA 3WB0A 4BO7A 2XVMA 5JNSA 3BK7A 1VLLA 1XBTA 3O7MA 3L7YA 4N5IX 1JLLA 1N5RA 1P0FA 1NX9A 4OB8A 3VNQA 3H3FA 2HDHA 2WHQA 5AOBA 3GUHA 2R6GA 3OHPA 4RCZA 1ISMA 3PNMA 4L9RA 2OZKA 3BULA 2IOQA 4RJJA 4F1WA 4IMIB 3RNOA 5KI6A 1BWQA 2C2OA 2WZBA 3PC7A 1JE0A 4D97A 1PJRA 5E2BA 4HAOA 2GRJA 2RGEA 3IR6A 3COJA 4G97A 3UCEA 3OBIA 5BWOA 2QR3A 2Q21A 3AB3A 1WB9A 1IFXA 1GUDA 2QN3A 5CCEA 1EIWA 1BVYF 2ZITA 4B4WA 4QREA 4B6RA 2JHAA 4HB3A 1VE9A 4C6SA 3TZ6A 2WVHA 2X2PA 4N40A 4PVCA 5MDHA 3NWPA 3CSDA 3S5UA 5AO9A 1K3FA 1POXA 1YBFA 4Z3KA 3AY3A 4JLJA 4F45A 5FADA 3ICWA 3KKEA 4KQWA 4YRSA 1BQ3A 2M9MA 1TKBA 2YIDA 3DDSA 1M5UA 4BAUA 2CDCA 4PQRA 4DMKA 4DY6A 1Q77A 1Q50A 3ZHBA 2BE9A 4LHYA 2GCOA 3CRNA 4BQFA 4AQ7A 3KLNA 4FFOA 2FSHA 1RCUA 5EE1A 2QK4A 5EIXA 2PD4A 3DAYA 1KQPA 4C2UA 1CF9A 3CJTA 2ILVA 5IM4F 5EESA 1A2KC 2Y0BA 5IC6A 4DLUA 5FQOA 3MQ2A 4ZD6A 3A2MA 3SM3A 3P20A 1BZYA 2HH9A 2I8AA 4PAMA 2SCUA 1T2CA 1QHXA 3N0VA 4US1R 5A6SB 4Z0PA 1YS2X 2QN2A 3LLVA 4DHEA 1UK9A 1TEHA 3LYUA 2R5WA 3G8DA 3RGWS 3RUHA 1KO4A 4LXIA 3BE4A 1CZNA 4UULA 1SD5A 3H11B 3DYIA 2Z4SA 4TYQA 3T9FA 4BFWA 3R3SA 2CYBA 3ZXYA 3PHHA 2E21A 3DTVB 4QECA 5EC8A 2XCLA 1G5IA 1OXBB 4XW2A 1L4YA 4BB9A 2MTBA 1AV6A 1RPTA 1U02A 1V6AA 2OESA 1QVAA 4LTDA 4V3CA 1A72A 4NE7A 1AS3A 2EBFX 4P54A 4ZHQB 3CCBA 1OTXA 1GKUB 3SJ7A 4V03A 4AAYA 3FX2A 3D2LA 1PP4A 3NU1A 3W3AD 4F46A 1U7UA 1VL6A 2VJMB 2A5JA 1KEZA 1YAHA 2CLIB 4OHKA 1VXOA 1CV2A 5DLEA 4HB4A 3TIIA 3GLQA 1VA4A 2TECE 4DRXA 2QZJA 3ZCQA 2WZDA 1ZKMA 1CB7A 4QDKA 4LC0A 2ZUFA 4HDRA 4X8MA 3K2IA 2PMBA 3I1JA 4B6EA 3JRNA 3KP1A 1G7RA 2IRWA 2PQMA 4GQBA 4ZXFA 4DR2B 1TJ4A 2WM9B 3HFSA 1G17A 2NAFA 4BIIA 1N8NA 4F6LA 1QIEA 2VKTA 2XZTA 4UFPA 3VHLB 2FVYA 5KC8A 1R2QA 4FBGA 4Q9DA 3HJFA 3FWHA 3DFUA 1E2KA 3GD7A 4JJ6A 3ZWCA 2QYHA 4XPZA 3BCSA 3X44A 4R0MA 3UJ6A 3WYFA 1NC1A 2H31A 3BJMA 3LA8A 1JXQA 4MQFA 4MUIA 3FDIA 1UFKA 1V3VA 1GZ4A 2ZK7A 1K4YA 1MP0A 3B7PA 4WLVA 2EAUA 3QW4B 2ZQZA 2WSSD 5KS2A 3R3JA 3FFTA 2XHEA 4NBTA 2WFMA 3USES 1GZDA 3FPBA 5BN5B 1KARA 1M2GA 1CQIA 3GLHB 2VUHB 1M6YA 4R68A 3EQ6A 1AKWA 3TB4A 1XLUA 1NWHA 4ZT2A 5FOUA 1ENZA 3QPWA 4TS1A 2FN9A 1M34A 2V0CA 3EYAA 4RVFA 2I78A 3NAZA 4LXXA 2OD7A 3GEGA 3MJEA 4NYJQ 2HRBA 5IHXA 1FYFA 2UKDA 2BFNA 3IP5A 3K0AA 4LRSB 1Q74A 1H2WA 1NNUA 4WBNB 3Q15C 3FGZA 2PEZA 2PH3A 5NULA 5KQMA 1R64A 1E5DA 3KLOA 2VHQA 1WSAA 5SZKB 2VCEA 4MI9A 1HFJA 1W8DA 4RKEA 3KD3A 4CLHA 4WADA 1KMNA 4L0MA 4EVSA 2J45A 4GMXA 1GPBA 1OLUA 5DIZA 5K05A 1LZLA 1F1BA 1SOWA 3RSSA 2VIIA 4M8IA 4PTLA 4ZIRA 1GQOA 4CQMB 2A0UA 1XALA 1VL8A 2GM5A 4MJ3A 2HSJA 1X74A 4RGYA 3TOCA 1ZMBA 3NTQA 1P19A 4UM8B 2CMDA 1OFGA 1R9NA 3PSHA 5FWYB 5IP5A 4I8IA 8AT1A 3V80A 2J5XA 5K8CA 4R2KA 4JCOA 4XDHA 4DIOA 4US2R 1ECPA 3EDQA 2WU1A 1VB5A 2X8JB 1R15A 5DE3A 4CF6A 3ESBA 2Y1GA 5DM4A 1TB4A 4HAXA 4EHDA 3NUQA 4OQEA 1DXHA 2JFWA 4P82A 3U0BA 2YHBA 1BHO1 4C43A 2P2YA 2V96A 4K6HA 4G5SA 4RZHA 4MKFA 1RM4A 1Q3HA 1NWCA 1SC1A 1XO1A 2XR1A 3F7MA 3PNOA 3U3DA 3A4NA 1TUGA 4OQQA 4I1SA 2O0MA 3OQ6A 5THQA 1XZJA 1MGOA 4LGMA 3KZXA 4MRMA 1K4MA 1A9SA 1S2OA 1YA8A 4M9SA 3RU7A 2Y0CA 3PIIA 2Y9MB 4LJLA 1ADGA 4Z8YA 1Q44A 1G8MA 4OBBA 3HDGA 1OI2A 2HREA 1Z06A 1I1HA 2FH5B 5BV0A 4G5GA 1NKSA 1YQ9A 2R79A 4L9WA 2N1BA 1WO8A 1LQ2A 2WM3A 4B6GA 1Z4NA 1SUPA 5KYTA 2P1DA 2QMYA 3FDFA 4YH1A 3CVVA 4ICIA 2B2XA 2ZUVA 3HACA 4CGYA 4TOIA 1MB2A 2NO0A 3ZUPA 2ZRFA 4QUIA 4XB6B 3P2MA 1GCUA 1TMKA 2G76A 2DQYA 3I8XA 1X8KA 3B6IA 3WKCA 2O23A 3JQQA 1OLOA 4LNUA 4J0IA 5TS2A 3R7WA 4B80A 4R8MA 3AP2A 1LI4A 3W5JA 1DV1A 3K92A 4L4UA 4YIKA 4RTLA 4OSPA 4C06A 2G0TA 2J33A 2YFKA 3DLBA 5U4QA 1HURA 5EWMA 3BC1A 5EKUA 1OAOC 3SBDA 1E3QA 1EAYA 2O8NA 3A1VA 3F3YA 5IDXA 1VCHA 2EVWX 2P5SA 3RUAA 4IHAA 3VBCA 1FQOA 2Q5FA 2PKYX 4A26A 4L8YA 3F5FA 4RF4A 2CNDA 2CNWD 1CJMA 4E46A 2YDYA 1VCMA 1YB2A 1SA0B 2H4XA 3JX9A 2I3BA 3Q3EA 4K9MA 2BH2A 3TW8B 1PG5A 3EC1A 1U0TA 1BMFA 2H4HA 4IIUA 5HGJA 4PW0A 1DOHA 3ZY2A 4A8JB 3K71B 1YWGO 5F78A 4JNCA 5AHKA 3TMAA 1PZXA 2KWIA 1Z68A 3AUYA 3NHFA 4QULA 1U2RA 5TPWA 1Z2EA 2FA9A 4EBFA 4PFSA 5EXDA 3DAOA 4ETWA 3CE9A 2RAUA 4TGLA 1YGPA 3RPEA 1LC3A 3DBRA 3AI2A 4BVGA 2V7XA 5CLGA 5DF1A 3E4CA 4CIBA 5H0IA 2FDRA 1V0JA 2XYVA 4RD1A 4QYIB 3DMDA 3LJKA 3AP1A 1VHQA 2OBNA 4IJMA 1B0PA 1EVZA 1E2DA 3ZTTA 2VYVA 3A58B 2HA7A 4M1TA 5LZ4A 3BN3A 2YYSA 3UWOA 3R0IA 2Y6VA 4G1VA 2IYTA 3GLIA 4CEJA 2VTKA 3PQ7A 4WOPA 3PQDA 1WQ1R 3L05A 4A2CA 1ACJA 4PHHA 4QG7A 3I2FA 2PLNA 1JKFA 4RD0A 5P8WA 1JHOA 3JQ8A 3QKSB 1IZ7A 2J4DA 3HSYA 4CIWA 3LTNC 4IJKA 1SWVA 4ZT7A 2WA1A 1GRNA 4OKSA 4YACA 3FWZA 5H68A 4E1BA 2IYNA 8ABPA 3GQVA 3A1DA 3RHTA 4AXXA 1WLSA 4ZVMA 1NKTA 3KXLA 4HK4A 3OQJA 2LP4Y 1SMKA 1EFAA 2JHFA 4YCJA 4L2IB 4C0SA 2WNIA 1X7YA 2I4IA 1IJBA 3L6UA 5AI5A 2EC5A 1SWWA 3KJGA 1FNSA 2YJ4A 3QH4A 4A0RA 3MA0A 3QNMA 4Z9FA 1THZA 5CYGA 1JNXX 3N8NA 3VPBA 5JYEA 1ENOA 2H2FA 3FR8A 5I7HA 3W3AH 4QPNA 3PQ8A 1LW7A 1Z0AA 2VJPA 3I6ZA 3ZE1B 1A8PA 1MGPA 2OFWA 1PR0A 1G3IA 3NORA 3L1IA 4KPUA 3STUA 4ZCRA 3IMFA 5INTA 4ZARA 1IHOA 3DXYA 3O4VA 1GTZA 1U28A 5DWQA 3DL4A 2WMDA 3LP8A 5D3MB 2HLDD 2R44A 1QXSA 4YAWA 5B1SA 4MUMA 1D4AA 3OM9A 3TS1A 4EW1A 2YYZA 5CXXA 1ZITA 3NBUA 2P1ZA 4EFMA 1EVEA 1N7JA 1DE0A 3AHDA 2GLXA 2R1VA 1XRJA 2X4DA 1GFZA 2QM3A 4M7RA 1C7FA 2B25A 3C3JA 4NBSA 3L9XA 4X95A 1EM8A 521PA 3TWOA 3DCJA 1OROA 1WUIS 3CT6A 4ZOLB 1HOTA 3L4KA 2H63A 5B6IA 2VHXA 4JS0A 1GJRA 1MIHA 1YVUA 3CCFA 3OE4A 3Q5DA 4UAUA 3M4JA 3LSTA 5FB3A 3JQBC 3T38A 4CR6A 4RKRA 4EDHA 2WDPA 4W6ZA 3UG7A 1TRKA 4ZOEA 4C0KA 1UC9A 2B21A 3DHYA 3M5DA 2CXXA 1Q7TA 5HM8A 2IUYA 1H22A 2X5XA 4OQMA 2H9YA 1XC7A 4HTAA 4J0QA 4ZQCB 4BKPA 4BMXA 2JI6A 3NQ41 1JUDA 2IPOA 3UY4A 1UXKA 1WZ2A 2EGGA 3AONB 4J91A 4ASUD 4YV2A 4YAGA 1UBGA 2H0AA 1JT2A 2VJKA 4FEYA 4HI0E 4NF2A 4DSNA 5LDDC 1BRTA 3OIFA 1ZQ1A 2JCVA 5PNTA 4UNRA 1QU2A 3JVUA 3M4ZA 1H2BA 3AH8A 3WLIA 5J59A 2D5LA 3ZPXA 1VE7A 3UK1A 1Y5RA 1MQ8B 2GHIA 2FPGA 2QG6A 1N34B 2XXJA 4OD0A 2X9LA 4ER6A 2EWMA 2OFOA 1ONSA 3HI4A 4LGCA 4MVCA 1RRMA 2K87A 1ZNWA 3TQQA 3G0HA 3L8ZA 4ZGWA 2VQFB 3JAWB 3BSSA 4BP8A 5HVNA 1OPXA 2C31A 3TX2A 3WL6A 5JSUA 1DC7A 2W90A 2YN0A 1O6ZA 1FFSA 1JMYA 4TUYF 3F6PA 2R5NA 2Y1OA 3P8ZA 3V1MA 1B93A 1ZD5A 2OGSA 3B1KA 4I99A 2YWJA 4LOAA 4U9UA 1XDBA 1PX2A 3NBKA 3WDSA 5BUZA 3FOZA 1G8KA 5EIEA 5DMHA 4Q6WA 3OEWA 5D84A 4GZ6A 1O58A 3VHXB 4NBVA 3AVXA 4I55F 5BPHA 3RVLA 2YWRA 3RG8A 4S2UA 2LKDA 4QSHA 1E1QD 2QU8A 4O4IF 3ANXA 1M2OB 1ANKA 4MKHA 5GM2A 2ODNA 4YXWD 1XAGA 3RFFA 2IEAA 4QZVA 1E8DA 1KEVA 1SKBA 1MQAA 4NEHB 5GWXA 4MYHA 2R1UA 4EX6A 1R8XA 1QLJA 3V7NA 4OGKA 2PA0A 1PEKE 1GCOA 1IJEA 2UVPB 3D54D 3EA4A 4JKIA 1W5FA 1DWUA 2ZEJA 5C34B 1C9MA 2P9HA 4H3HB 5HIJA 1M6VB 3DBIA 1HZJA 2WNSA 1M8GA 2F4VB 4ZU1X 1JFFB 4KMSA 5AKHA 2J9FA 3WRXA 1LV7A 1XZPA 4NS1A 4E31A 1PUJA 3LW8A 5DK4A 3SJCA 1HDXA 4OHRA 1K27A 3R0QA 1X70A 1HMYA 5IBPA 1B76A 4NZPA 5B64A 1AK1A 4XWYA 2A9PA 6NULA 1G2PA 1QYRA 2BONA 3DFKA 3MYYA 1D8TA 4K26A 1ENYA 5GOTA 3I05A 1TUBA 1EP1B 4BS9A 4W1SA 4BMSA 5I3ZA 1FFYA 4YYZA 3KV3O 3ZZ0A 2Q9AA 3GJ3A 4OM7A 1H5UA 4ESVA 2Z2XA 2ZTUA 1RWMA 4ETIA 3HKDB 4RY9A 1G9TA 3LWZA 1X1AA 4FILA 4NHEA 1JPJA 1ORHA 1ZESA 1WUTA 3RU3A 5DULA 4DNOA 2W4MA 3HVJA 3L8CA 5HDQA 4DNQA 5HKAA 4ETMA 4ZJZA 3MQFA 4FFWA 3WHKA 1LJ8A 1RRGA 3EPPA 4JBWA 3MOSA 1YZFA 1EQUA 1U2QA 5IC4A 1C9KA 2IE0A 2RHOA 3AXTA 4J7AA 4Z51A 5FR1A 2J6HA 3PD1A 1UMDB 2NTYC 1MN6A 4X24A 1EFPA 3KUUA 3RS4A 1W6RA 3ZU2A 2RCYA 4M22A 3HVUA 3V7WA 4KITB 4MS4A 2VHYA 2WKPA 1UJNA 2ZUTA 1UPCA 4AKEA 1BDBA 1G8AA 3UWDA 2P0YA 2UDPA 2BKEA 2ARKA 2CK3D 1LLDA 3B6MA 1GSAA 3O38A 2C1EA 4GXQA 4YIHA 1TEVA 2V7QA 4TPKA 3BUSA 3PEEA 1G5HA 4NBLA 4ZAWA 5ITVA 3LWDA 1U0JA 4UC0A 3T99A 3O82A 3QXXA 5AW2A 1QM5A 4JP1A 2K6GA 4IS2A 4MVJG 1ITZA 3WGOA 1SZJG 4YRQA 2FCAA 2B98A 2C3UA 1L7DA 1Y5IA 1KYZA 2C8LA 2JGDB 3D7RA 4Q7KA 4B82A 4C22A 3VR4D 3Q3IA 4JXKA 4J3JA 2IPAB 4ALLA 4WKCA 2OZPA 2P9TA 2X6TA 3PC4A 4HXEB 3HEAA 1ZC3A 2J0QA 5G3YA 4XWOA 5DNVA 1TT5A 3HMKA 1Z6YA 3L4BC 3T3GA 4ZTZB 3BMOB 4D79A 2VI5A 1FJXA 1Y8QA 2Z1MA 4GWGA 5KDDA 1NBME 2FSIA 3DCNA 5A4FS 3HXQA 5TPZA 3C8HA 3W1WA 4ZOBA 5DLYA 2ZIFA 1O77A 2RGBA 3Q1LA 5ER9A 4CT4B 1IHPA 3DOEA 3P26A 1N25A 2PMWB 5HNKA 4QT4A 3HBFA 3ZWXA 3HYTA 1J33A 3NDPA 4E4RA 2XBMA 1PKEA 1DKOA 2NTJA 4XRGA 1NATA 2EYQA 5IVKA 2ZQ5A 3PNBA 1ISSA 1SBQA 4NNPA 4F5YA 2VG8A 4MW5A 1AB5A 1XTJA 4FDLA 5LQMA 1D4FA 1JSXA 3E8MA 3I23A 2DR0A 2Q6LA 3OJCA 3DL0A 1UQRA 1BKSB 2Q62A 3DBHB 3FOWA 4MPRA 4KFUA 5E7IA 2V7VA 2YNMD 1FSFA 4ERXA 1Y1TA 3FCYA 1TVKA 4OXIA 3U44A 2DB3A 3AVTA 4CUZA 1FDRA 5FUMA 1JRLA 3H9EO 3SR4A 4FLFA 2Z9BA 3IEXA 4HQ0A 1Y34E 5DJ5A 4C3ZA 4CIDA 3ZNNA 5HUHA 1XD8A 3UPTA 4DXHA 1BX3A 5A1TA 3GVIA 5A5DA 3DVAB 221PA 1XPJA 4PZ9A 4BVHA 4JT8A 4MO2A 4QG3A 5IBCA 3WGIA 3LO8A 1R0WA 1E3EA 2IK8A 3T9EA 3WA6A 1XCOA 2OYSA 3PTZA 4JJEA 1T1GA 2VPZA 3DNPA 3TL6A 5JWOA 1NRIA 3O84A 5E7MA 2C2YA 2ZYIA 2HSWA 4RGVA 1FMLA 1QR6A 1NP7A 2HMVA 4XQEA 3WGLA 1IWOA 1GGEA 1AS0A 1OZHA 4Y2XA 1W88A 4GX0A 1NVFA 2JZOA 1ZOIA 2GJ4A 1YVRA 2QM8A 1DBQA 3HDTA 3LXUX 4IZIA 4BIMA 4N47A 4C4TA 2H1IA 2JLRA 2X0KA 3A25A 3WE7A 1U8XX 2XNHA 1RIIA 4JB3A 3JQAD 2EFEB 2XGGA 3GO4A 4HT3B 2ONZA 1QIJA 1MAAA 4WSOA 3DTNA 4D9GA 5BSVA 1WHSB 1OC4A 2ERXA 3IELA 2PZBA 1TJ5A 2D4AA 3JALB 4JJAA 3EUWA 1XQ9A 4IIHA 1ZMRA 3BZWA 4QAQA 1FRVA 4B33A 4M7OA 1PL8A 3QLUC 5TLSA 1QPZA 1CY0A 1NUHA 4P7FA 1X9GA 2O1SA 1WXXA 2QW0X 3GK3A 4L8FA 3TW0A 4EHHA 4EPVA 3MJ4A 3N74A 4KQFA 3IDAA 3CS3A 5HJ7A 4O4HA 3GG2A 2GCPA 3UC5A 3TAHA 3HCEA 1M5RA 1U0OC 4IYRA 5E1DA 5FOWA 2VN8A 3PFGA 3TLMA 1ZPDA 2Q6IA 3VPGA 5ICCA 1D07A 4JOSA 3DJYA 3ILSA 4RK1A 1NZDA 3GQBA 4F4UA 3PX3A 1EWRA 4HR7A 4ZAYA 1FYEA 4ZOCA 3BTSA 4KTTE 4HOYA 3S8EA 3NH6A 4S1PA 1PLLA 2ILTA 3GRKA 2C4UA 1BFUA 2FHPA 2DFPA 2R25B 3N7TA 4QYWA 4ZT3A 5GGYA 1ZXBA 2P9CA 1KI8A 3OPMA 5IULC 3I5XA 3KT6A 2CXUA 4UCWA 4BWGA 1W0KA 4RFSB 4RVHA 3SVZA 4H08A 1NN0A 1WB6A 2C29D 3AIIA 5KX5A 4MRSA 3KYIB 3ZGYA 5ALIA 3H8SA 3CO0S 3V42A 4X1KB 5A71A 3I0ZA 3N8GA 4J1NA 5LZ7A 2P4UA 4BGDA 4MUNA 1U3WA 1Y8RA 2PUJA 1XRRA 1DDOA 4R3UC 4DIFA 5EERA 2EBHX 4AUKA 2V5AA 1RRPA 4F3YA 1QAMA 4M8NE 3FHCB 3B9PA 3ONDA 2VJOA 1WDTA 1SBIA 2Q4RA 1A4IA 3QZUA 1UEJA 4MV3A 5DXAA 3UGTA 3WADA 1G16A 3ZXSA 3AVUA 4O08A 4W5QA 5EJ2A 4QYTA 3VRHA 3D0QA 1A27A 1WMEA 4DMFA 4EP1A 3WSWA 1KYIA 1AZTA 4OJTA 3ZY4A 4AK9A 4U2KA 3ZDDA 5EZ6B 2PZMA 3IPAA 4I2VA 3N6XA 2QJFA 2X40A 3LXMA 4M1YA 4OMUA 2RONA 5T3YA 2JGEA 3H11A 3S1SA 2Q1UA 4HDKA 3RRXA 1NJ8A 3A9WA 3OZ7A 3DC2A 2HJVA 2ENWA 1R8SA 3PK0A 3ABRB 3D0KA 1G98A 2AOUB 3H8WA 4G4GA 1RI5A 3T54A 1GPAA 3ZJYA 1ULTA 1IAVA 5GP1A 2C8JA 4HRYA 1L5WA 1I01A 1OFHA 2QZ4A 4HGPA 2ALJA 1X94A 3PYMA 4OO3A 3E81A 1KQGA 5KSPA 1P7CA 1D2CA 1I2BA 3KOZA 2OPHA 3JR7A 4FMBB 4KSBA 2JHPA 2LRHA 1GGVA 2VYNA 4YJ3A 1QYDA 3SHTA 1FXSA 3C74A 4BO1A 1BWSA 4QTTB 1DOAA 5DHQA 5KTTA 1Q0TA 3F73A 2ID7A 2VJMA 2D5BA 3R9XB 3E03A 3P9PA 3EQ8A 4DLBA 1FSZA 1SCAA 2ZJAA 5H70A 3U0VA 3LQKA 3BXPA 1GU1A 4LRQA 1DAHA 1ZA2A 3S2YA 1OFTA 1VG8A 2IHZA 2X58A 1ZH4A 3KB6A 4Y8VA 4D3YA 3TUJC 1F3LA 1OA0A 5J4KA 3KS9A 4RH0A 2YXNA 3PFKA 1BE8A 5YASA 4CEHB 5KAMA 3BFPA 1R5BA 1WTCA 3EISA 3P0EA 4JLPA 1PHPA 2EIXA 2ZIAA 2AG8A 2WOOA 3GEIA 1NLUA 3KLMX 1ECLA 3NALA 1G19A 1H69A 3A8TA 4RD6A 3C3PA 1SVNA 5TGTA 3N2KB 4QDZA 4DILA 6PFKA 2R751 3GROA 1HPLA 2P90A 1DIBA 4Q4LA 3RCBA 4B75A 1ONNA 4EHFA 1EFHA 4G0WA 4IH4A 4JLAA 1EWTA 2BSXA 4FYPA 1N6OA 3NBFA 4HN9A 1C0EA 3FN4A 3GJXC 1FDOA 1DC5A 1UC8A 4IIVA 4TSKA 4KJXA 3OU2A 2G70A 3AU8A 3QXHA 4L51A 1IATA 1RYDA 1W4RA 2ZIWB 1E3SA 3WFZA 1Z2AA 3FYUA 1CPYA 3VR4H 3WLAA 2Y6UA 4D81A 3N39C 3O1HB 1H2XA 4EKGA 5TE9A 5BN5A 4HRAA 1K8ZB 2IYXA 3FPSA 4LFAB 1VRVA 3BWDD 3Q2IA 4F21A 3L0CA 1I2DA 1IN4A 1KJ8A 2O9JA 3A27A 421PA 1IZ0A 1H0HA 2DPXA 1NM5C 2BMFA 2GTIA 4QL3A 4AMUA 5JLJA 4EENA 4OYYA 3AB8A 1KVSA 2VDVE 4G5RA 4YCMA 5F1OA 4HDMB 4DIEA 4CIYA 1JDUA 1FNCA 3BFXA 2PS1A 3VJMA 2REOA 1CZKA 4NKRA 1HX7A 2PMFA 4P2BA 4ZQEA 2NYAA 2WKQA 4RNDB 2YMLA 3FNRA 1A9PA 1ZJJA 1W5SA 2W43A 2WFLB 1YB1A 3OQIA 4JT2A 3FKSD 4Q37A 1CR4A 3M5CA 4RM3A 3WNBA 3CUVA 3I4LA 2QD5A 2ZUUA 2F3SA 1G7CA 2H5EA 2JAQA 2QF7A 2C83A 1RXYA 4MWBA 4DNPA 3W2GA 4CL2A 2X6RA 4X1YA 1T2DA 5A05A 1JP7A 5FUBA 3WISA 2WTMA 3UXHA 1ZRHA 1WIWA 1VGQA 1BMTA 2P4QA 3FOCA 4B48A 5JD5A 4C5CA 3M8KA 1OFVA 5AUNB 1FP1D 5K0ZA 3HUFA 3RTDA 4K1XA 2EKQA 2BGMA 4MGKR 4G07A 2QPLA 3ABZA 1AF7A 1JYSA 1USUA 1ZH6A 4OY3A 1ZIPA 2O8VA 3UZUA 2AOTB 5BV2P 1HNZB 1KKUA 2PYDA 3NHYA 1ZQ9A 3VPSA 2WUEA 2JFUA 1Y6QA 3ZHZA 2GF9A 1YF3A 4A8JC 2BN4A 3E9YA 5DTIA 1R18A 3RAGA 4RY2A 3WICA 2GPSA 4FW9A 4K88A 2V6IA 2VFAA 4X94A 5E6UA 3L6CA 2YIJA 1NM5A 4M0MA 3KKQA 1WVGA 3GAFA 1FRFS 4I5FA 1GKLA 5IMSA 1LNZA 2Z4RA 4S1VA 5BWBA 4WHMA 3EG9A 4KIUA 4I4LA 1YZHA 4CKEB 1AMUA 3PI7A 2E3JA 3DV0B 3OZIA 4XI9A 3CW8X 2C5BA 3G5TA 4CDMA 2VP4A 1FYDA 2XE4A 3IVMA 4AM8A 2Q2OA 1F1JA 3WL7A 2J09A 1VSVA 2VDRB 4I5IA 5K8TA 1CZLA 2FMTA 5JR3A 1Y3DE 3F78A 2V4ZA 5G3ZA 1A77A 2WUWE 4W9RA 4XIFA 1XTPA 2CJWB 2COUA 2IDMA 3C3CA 1LVHA 4E5KA 3BJRA 1W2GA 2ETVA 5EP2A 5DX8A 4XR4A 1BVHA 1F12A 5CVEA 2I4LA 2EJVA 1K92A 3LZ6A 5EIWA 3CNHA 1XTSA 3AMVA 4FD2A 4BNDB 4E22A 4ARUA 4WNAA 1UZAA 4H31A 3QUAA 3AIMA 1SELA 1IOVA 2O1XA 2J3JA 1H8HA 4GZ5A 4Z9AA 4ZVTA 1L1QA 4ZCLA 3RANA 3ZCTA 3QPBA 1MC4A 5ALLA 3IV6A 3O8CA 1PE0A 2ZPAA 1SA0A 5HM6A 1NN5A 2OFPA 1IBMB 3ETHA 4C88A 2BM1A 5E6RB 3TW8A