3CHWA

Complex of dictyostelium discoideum actin with profilin and the last poly-pro of human vasp
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
371
structure length
360
Chain Sequence
VQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHDSYVGDEAQSKRGILTLKYPIEGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEAEMQTAASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major actin
publication title Modulation of actin structure and function by phosphorylation of Tyr-53 and profilin binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 117
structure length 360
sequence length 371
ec nomenclature
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3chwA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3chwA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3chwA03
3JXUA 3EO3A 3CJCA 3DWLA 4NO7A 3UKRA 4CZEA 1ZBSA 4DB3A 1R59O 5AZJB 2F9WA 2P9NB 3L0QA 4JAXA 5JICA 3DXKA 4F9OA 4HTLA 1ATNA 3LDQA 5FPDA 3VPZA 5AQZA 1D4XA 4MLHA 3LDLA 3LM2A 3O1WA 4WQ5A 2UYTA 1E4FT 1BU6O 1GLBG 4M7XA 1TYQB 3MN5A 4I6MB 1XC3A 4L3QA 3QMLA 2V52B 2ASOA 4BC2A 3C7NB 5CE3A 3I33A 3EL2A 5AQQA 3LDPA 1BO5O 4H0XB 2P9PA 2E1ZA 1HLUA 4EIAA 2PBDA 3L6QA 2ITMA 1TUYA 3H1QA 3O6WA 4A2BA 3J8AA 2GWJA 1T44A 1NGAA 2P9SB 3AY9A 4JD2B 4B1VA 4EHUA 2VCPA 3CJ1A 1MWKA 2NRHA 3GE1A 4DHYA 1HPMA 3KVGA 4KBOA 1NGFA 1YVNA 5BPNA 3ATVA 3ZETB 5EX5A 1TUUA 2Q97A 1WUAA 3UB5A 2J4RA 3LDNA 3D2EA 3JS6A 5ADXA 4RCHA 5JMVA 5KPRA 5AQUA 1HUXA 3EKUA 5AQMA 3WEEA 5ELZA 2GWKA 3UKUB 3ULEB 4BRGA 2CGLA 1Z6RA 1DGKN 3C0BA 2E2PA 3M3ZA 3RSEA 3VGKA 4BRAA 4EAHD 1P8ZA 5AFUA 2BUPA 4O5FA 3MN7A 5EVZA 2P9KA 3ZX3A 4H03B 3A8YA 1XQSC 3QFPA 3A0IX 4BC4A 3O80A 4JNEA 5AZJA 2P9NA 1EQYA 5F0XA 3U9ZA 4K25A 5KPZA 4CZJA 1HKCA 2I7PA 3BF3A 1RDWX 3SMSA 4BROA 2A41A 3W3DA 3FZMA 3TU5A 3BP8A 2VWBA 4BG9A 4I6MA 4LC9B 5FPMA 1QHAA 2IVPA 2HF3A 3C7NA 4XEIA 4BVOA 3GG4A 5AQIA 3KZBA 1X9JA 3CERA 3HM8A 2H3GX 1BWFO 4BREA 4J8FA 5E26A 2YJFA 1GLDG 2FLOA 2QWRA 2NLXA 2QWMA 1C0FA 1HKBA 1SAZA 2YCHA 3O1BA 3D2EB 4M63C 4WQ4C 3U4LA 4ISGA 5BRFA 1IG8A 3CJ7A 3FR0A 2IVNA 5AQTA 3FZKA 5JLFA 2P9SA 4BRLA 4CBXA 1NMDA 4RTFD 3WXLA 1MA9B 3SMPA 5EY4A 4CBUA 3VF6A 3LM9A 3SLCA 1IJJA 1Q18A 2IIRA 4IJAA 3HSCA 4B1UB 2E8AA 5BREA 3ZETA 5BN9A 4QS9A 2A3ZA 4B1WB 4Y0WA 3GOIA 2DPNA 1T6CA 5F2RA 3TPQA 1MDUB 3BF1A 4YDUA 4FWSA 4FWNA 2CH5A 2OANA 2D4WA 3CJBA 4CZHA 2YHYA 2A42A 2P9IB 3F9MA 3VEVA 3P4IA 3UKUA 3O5BA 3ULEA 3CETA 3FLCO 4PL7A 2FF3B 3WQTA 1JCFA 1DKGD 2Q31A 3QICA 3H1VX 2A40A 3UE5A 4WQ5C 4BRMA 4CZKA 4CJ7A 1G99A 1BA1A 2E1YA 1BDGA 1GLFO 2P9UA 4BRNA 2QWPA 2ZGYA 2HMPA 4FWQA 2QW9A 2BTFA 2ASPA 4CZFA 3QBXA 4A2AA 1NGBA 4JHDB 5AQPA 3BUZB 5AQFA 2NZTA 1SQKA 4BC3A 3MMVA 4WYBA 3G25A 5AQVA 1U2VB 4BVPA 4H5RA 4CI6A 5TKYA 2YHXA 3BEXA 1NGCA 1LOTB 4A61A 1J6ZA 1X3MA 2ZF5O 1KAYA 5BR9A 3CJ9A 2GUPA 2E2OA 3SJHA 4CZGA 2PAVA 1Y64A 1DEJA 3EKSA 3MCPA 5AQYA 3W0LA 3WQUA 3FGUA 5LY3A 3LDOA 3QBWA 5FPNA 2Q2RA 3A5LC 4IJNA 1KAZA 4CD3A 2Q0RA 5AQGA 4K42A 2FSJA 4XH5A 4B1XB 4FO0A 4ISEA 3FFKB 5EXWA 4B9QA 1NGJA 1MWMA 4BQZA 3VGLA 4FWLA 3AAPA 1H1VA 3H45C 3ZX0A 5F1XA 3FE1A 3ATUA 5FPEA 4B1YB 1KXPA 3EN9A 3DXMB 2P9UB 2P9IA 2CGJA 5KQ8A 3ENOA 4M7YA 4ISFA 2P9LB 2D1KA 5AZIA 1ATRA 4QS7A 1JCGA 3H3NO 4CZLA 1HX1A 4BR4A 3R6MA 4BGBA 5AR0A 2EWSA 1NGIA 1QQMA 1V4SA 1YAGA 4GNIA 4FOIA 4H5WA 1HJOA 4BR5A 1S22A 4H0VB 4XH1A 5E84A 1GLJO 3IFRA 4XH4A 3VENA 5KPTA 5ADXH 4BRFA 2E20A 2FSNA 2QM1A 5AQJA 3VEXA 2FF6A 2FSKA 3HTVA 3QFUA 4JHDA 2Q1NA 4CBWA 4Z94A 1BA0A 3VOVA 3AAQA 1U2VA 1S3XA 1QZ5A 2A6AA 3O08A 2FXUA 4NB4A 5AFUH 4E1JA 5AQLA 2VYPA 3DAWA 3FZFA 3I8BA 3U9DA 1ZXOA 1C0GA 3A5NC 3ZX2A 4FWMA 1GLAG 1GLEG 5KQDA 1T6DA 4AM7A 3VF2A 2Q0UA 2YHWA 1RGIA 2YI1A 5I9EB 1SZ2A 1NM1A 3MK6A 2V7YA 3MN9A 3WXIA 4FL9A 3HBTA 4BRHA 4PL8A 5BRDA 2D0PA 4YDUC 3WUHA 1K8KB 5AZIB 3WXJA 3VEOA 4FSVA 3GBTA 3VGMA 3A5MC 1QZ6A 5AQHA 2E88A 4K41A 4BR2A 3R9PA 5AQXA 3MDQA 3DXMA 2HF4A 4H5VA 4BRPA 3CI5A 3WT0A 1BUPA 4IZ9A 4PKGA 5BPMA 2HOEA 4FPAA 2P9LA 3B8AX 1KAXA 4BRKA 4MO5A 1OKJA 1BOTO 2A5XA 4BRCA 5AQRA 1NGGA 4BG8A 3U8XA 1NLVA 4FOEA 3KHYA 4FPBA 4IXCA 2YJEA 5B8HA 3A5OC 4FWRA 4BR0A 1NGEA 3VEZA 2QWNA 5AQKA 3GL1A 2D0OA 4MO4A 3O8MA 4BRIA 2QWQA 1GLCG 1QQNA 1V4TA 3D2FB 4HWIA 4BR7A 5BN8A 2E2QA 1CZAN 2AP1A 3SK3A 3VEYA 4FWKA 3R8EA 2CH6A 4A62A 3CJAA 1U6ZA 2GEMA 2V7ZA 5AQWA 1BG3A 1JCEA 4IWVA 3H3OB 4BC5A 3MN6A 5EOYA 3S41A 4GY2B 3ZEUB 4C23A 4PKIA 2GELA 2F9TA 2W41A 1RFQA 3FZLA 3UKRB 4RWTA 4JN4A 2QWLA 1XUPO 3VF4A 3GDQA 4BGAA 1YXQA 3DXKB 4CZIA 3L4IA 2E2NA 1K8KA 4H5NA 4H0YB 4B1ZA 3VEWA 3ID8A 4FWPA 3CHWA 2I7NA 1NWKA 4CD1A 2QWOA 3LL3A 4H0PA 1YUWA 2P9PB 2WUSA 2GTDA 2V51B 1NGDA 3IUCA 4IO8A 3ENHA 2IVOA 4AM6A 4H0OA 4EHTA 1NGHA 2W40A 3DJCA 5BPLA 2CGKA 1NBWA 3VETA 4DQ8A 3H46O 3H6EA 1TYQA 5JLHA 3CQXA 3D7EO 4O8KA 1E4GT 3WXKA 1GLLO 5LJWA 4BRQA 4QS8A 2ZGZA 4WQ4A 4FWOA 1ESVA 1WOQA 4K43A 2ZWHA 2KHOA 3OHRA 3M1FA 4H5TA 1LCUA 3IDHA 3CQYA 3D2FA 3CIPA 3QB0A 4EFHA 1QQOA 1HKGA 4BQLA 4MLEA 4DCHA 3HZ6A 4JD2A 3QDKA 2ASMA 3WEEB 1ATSA 3HI0A 4CZMA 1Z05A 3IMXA 4PKHA 5LJVA 3RSEB 5AQNA 3VESA 3EZWA 5BRHA 4BRDA 4BR9A 2AA4A 5AQOA 1ZC6A 2QXLA 5AQSA 1X3NA 3M6GA 3VERA 2P9KB 3AARA 4H0TB 3O4WA 3FZHA 2Q36A 3ZEUA
chains in the Genus database with same CATH superfamily
3BY5A 1Q86O 3JXUA 2KLAA 3DWLA 2WONA 4FLUA 2F9WA 4OPKA 2P9NB 3ZSWA 1ATNA 2R7YA 3LDQA 3TTCA 1YTUA 1C0UA 3LDLA 4AHRA 3KKRA 1BU6O 1C1AA 1D9FA 4L3QA 4A57A 4CHNA 4CIFA 1EWRA 4CERA 4DLEA 2ASOA 4FJ8A 2VG7A 4C8OA 2P9PA 3AVFA 3CD6N 1EO1A 4CF2A 3L6QA 2ITMA 4A2BA 4IEIA 3VA0A 4C1NI 4JLHA 1ZBIA 3VQAA 4CJTA 4JI6K 3AO2A 4CHOA 3WNHA 1IKVA 3GE1A 3P83D 3CPEA 4KBOA 4BWJA 1TKDA 1YVNA 4GKJK 5BPNA 3ATVA 2Q97A 3UB5A 4WF9L 1VK0A 3D2EA 4CK1A 3VQCA 4DSFA 4KRFA 4JI3K 3WNGA 3OS1A 3MWPA 3VQ4A 1JLAA 2BDPA 4BRAA 5AFUA 2BUPA 2IAJA 1LWEA 4LF6K 4H03B 2Q3SA 3QFPA 4DTRA 3KKSA 5M1PA 4GV3A 3O80A 3HVRA 1NK0A 5M1NA 3I56N 5AZJA 3CCVN 4B9NA 4A5BA 3HPGA 5KPZA 4CZJA 4CJEA 4CHQA 3T1YK 3SMSA 3SCXA 2A41A 3W3DA 3O4NA 4I6MA 4LC9B 3PY8A 4DV1K 5FPMA 1QHAA 2IVPA 3C7NA 2OPRA 4XEIA 3GG4A 3KZBA 5E41A 1TK5A 5JS2A 4J2EA 5E26A 1GLDG 2QWRA 1NKEA 1RBVA 1SAZA 4XIUA 4ISGA 4DU3A 4KAZA 1IG8A 4DR1K 1LWCA 3FZKA 1XC9A 5JLFA 4BRLA 1NMDA 3ZT0A 3O3HA 3SAFA 2GBZA 3VF6A 4CEDA 1IJJA 3SUPA 4B1UB 4IJAA 4Q0BA 3ZETA 4QS9A 4DMNA 4HUGA 4Y0WA 4OGCA 1NG9A 4JI4K 1QE1A 3DLHA 4V19S 2BH1A 3TPQA 2VGNA 3BF1A 1TAUA 5LMUK 3CJBA 4CZHA 1U45A 3UKUA 3HRGA 3EEQA 4E1MA 2G8UA 3LANA 2FBXA 3QEIA 3CMEN 5JVGL 2A40A 3DM2A 1TGOA 3KWIA 4CZKA 3VA3A 4RG8A 3V1OA 4PWDA 2E1YA 1BDGA 4IG3A 4DKWA 1EP4A 2C1IA 4YOYA 3DYAA 3K0SA 3M5RA 3PX6A 2NRXA 2VGMA 4CZFA 4A2AA 4JHDB 1GOCA 3F5TA 2HHIA 1BCOA 3PIPL 1RDBA 4R5PA 3G25A 4BDZA 4H5RA 4JK9A 5C10A 3HOTA 1NGCA 4B9UA 3LPUA 1X3MA 1J6ZA 5BR9A 1X9SA 3C94A 2E2OA 4CZGA 3MCPA 2QEXN 3W0LA 3WQUA 5LY3A 2QTDA 1KSPA 1ILYA 2ZM6K 4M41A 4CGFA 4JI0K 3DLEA 4CD3A 1RT5A 1C6VA 4IO9L 2OYQA 4FZZA 4ISEA 4BWMA 4FWLA 3HOSA 2PY5A 1NK5A 3ZX0A 1Z25A 3FE1A 4FLYA 1SKRA 3EN9A 3T3FA 2P9UB 1YVUA 3M8RA 4Y1CA 3AA4A 4WCEL 2AJQA 4DQRA 3SPYA 1RT7A 4YY3K 4BDPA 2QKBA 1KVAA 4CZLA 1HX1A 1NGIA 1BI4A 1YAGA 2F96A 1J53A 3L2WA 4BR5A 2YNGA 1S22A 4XH1A 5E84A 2HHTA 2ZJPL 1YHQN 2HVIA 3P31A 2G8VA 3VEXA 2FF6A 1HYVA 3T69A 2EHGA 1VSLA 4HUEA 1S1TA 2Q1NA 4CGJA 1N34K 1RDUA 2A6AA 1VQMN 3TABA 3DAWA 3I8BA 1ZXOA 4DTPA 3OYFA 4FWMA 1XHXA 1GLEG 4C8LA 3K5MA 3VF2A 3I0RA 5FROA 4DFMA 4NYFA 5CY4A 4FJGA 3WXIA 5GIPA 2G8WA 4PL8A 3DI6A 3WUHA 1VHXA 4KHYA 3OYKA 1IKYA 5AZIB 4FSVA 3GBTA 5FLXO 3CQ8A 4ZTFA 3VQQA 4DQPA 5AQHA 2E88A 4NCAA 4M3YA 2YHBA 2ITGA 4KTZA 3U3YA 3DXMA 2HF4A 4H5VA 1K73O 1UOCA 4DTOA 1KC8O 3PSFA 1M90O 4IOCL 2HOEA 2UUAK 3UIQA 1FW6A 1RBRA 4BRKA 1K9MO 2E6LA 3E01A 4DTJA 3R1XA 1TL3A 5AQRA 3MEEA 4JRQA 1ASUA 2NRRA 3PO5A 5FRNA 3OA9A 3ID6A 3QIPA 4DR7K 4FPBA 4IXCA 5FRMA 3ZLJA 2F8TA 4IOAL 1J54A 2YX6A 1YJNN 3MEDA 1NNEA 1NGEA 2O4IA 2O8EA 2VG6A 1HR0K 2D0OA 3O8MA 4FXDA 4BRIA 5A2QO 4OPAA 2KQ2A 3QINA 5BN8A 4CEFA 3J81O 4YFUA 4CJSA 3SK3A 4FWKA 5J2PA 2GEMA 4CHZA 4Z4EA 4N76A 4BECA 2O8CA 2HVHA 2ZQBA 1HPZA 1JLBA 4C23A 1ASWA 2F9TA 3UKRB 1RFQA 1NK8A 3DLKA 1YITN 3VF4A 4IFYA 1DTTA 4E7KA 1TKXA 3SAGA 3S3NA 4Z4CA 3OYNA 2IOCA 4DU4A 5J2QA 4HCBA 1K6YA 4CECA 5CHIA 4YOWA 1S1VA 4O8UA 3OS2A 2HMIA 5C0YA 1VQ6N 4X66K 4FWPA 1EWQA 4Q5VA 1LAVA 3B6PA 1YUWA 4A5AA 3AO1A 4EZ9A 4KI4A 1VQLN 3A2FA 1VQ7N 2W40A 1W97L 4DQ8A 4CK3A 4KHUA 3V9XA 2GX9A 3CQXA 3D7EO 3DRRA 1GLLO 3QEPA 5T7BA 5C12A 1TKZA 1B9FA 4QS8A 4PY5A 4WQ4A 4FWOA 2XY6A 1WSJA 1VSDA 2WFBA 1GOAA 5J2MA 1LCUA 3CCRN 2YKMA 3AVMA 4DFKA 3CIPA 1BIUA 3RVCA 4DCHA 2ZD1A 3QDKA 4CFBA 1IKWA 2ASMA 1ATSA 3NVKA 4KFBA 1Z05A 3IMXA 4W5QA 4BY9C 4BRDA 3K5NA 1L5UA 4DSEA 2P1JA 4CF0A 2W6KA 2P9KB 4DQIA 4IO8A 3O4WA 1TL1A 3ZEUA 3EO3A 3PX4A 3CJCA 3TSQA 4CJPA 4DB3A 4CJFA 4JAXA 1SV5A 2IC3A 3DXKA 4I2PA 4F9OA 4JKGB 4MLHA 4E3SA 2WBNA 3LP3A 4Z4FA 2X78A 4O44A 4W5NA 4AHVA 1XC3A 4I9QA 1SL1A 3QMLA 2BE2A 5AQQA 1HNIA 3LDPA 3FFIA 3TSPA 3PUFA 1TUYA 3C95A 3TR8A 4N56A 3J8AA 3ULDA 4KI6A 1RT1A 4JK8A 3QEXA 1W2BM 4JI2K 1CLQA 3TANA 2O8FB 4NLBA 2P9SB 4JI1K 3THYA 1WSFA 4JD2B 3OYAA 4B1VA 3VQDA 4EHUA 5C42A 3QETA 1KLMA 4DHYA 1YIJN 3TTDA 1NGFA 3SQ1A 4FCYA 2RF2A 1TUUA 3ZCMA 4JI7K 2J4RA 4LH4A 2C1GA 4ILGB 3CCQN 4OO1J 1VSFA 2X6NA 2HHHK 4Y1DA 1VSIA 5AQMA 4NXNK 3QNNA 3ULEB 4BRGA 1J9AA 2CGLA 4AF1A 1L3TA 3MXJA 4IFVA 1ZBHA 4O5FA 3NH0A 5EVZA 3ZX3A 3OYJA 2YNFA 3PV8A 4M3UA 3ASMA 1C0MA 3OYGA 4OPHA 1LW2A 2VQEK 5F0XA 4DV0K 5HL7L 4ID1A 3U9ZA 1NK6A 1EX4A 2HHXA 1SUQA 3CM5A 3KK7A 1S9EA 2I7PA 4JI5K 3BF3A 3EE9A 4FVMA 3BP8A 4LSLA 3NCIA 1VQKN 4AHSA 2EX3A 3ZSZA 1NJIO 4DTSA 3BZCA 4YORA 2H3GX 2RKIA 1BWFO 4BREA 1I94K 2Z1GA 2FLOA 2QWMA 4M63C 2NLXA 4DG1A 1C0FA 1UA1A 4WQ4C 4B08A 5BRFA 3RTVA 1KVBA 4C1NK 3OYHA 5DMRA 2G8FA 3SMPA 4FVUA 3VQ8A 3EY1A 2E8AA 5BN9A 2A3ZA 4B1WB 4B3SK 1N33K 4E7JA 3GOIA 2F4VK 2P5GA 2DPNA 4B3OA 5C2DA 4FWSA 3THWB 1SKWA 4W5OA 2YHYA 2A42A 4LFAK 2P9IB 3F9MA 3VEVA 3P4IA 4DSJA 4G1QA 4C8KA 4O0IA 4PL7A 4OKKA 1DKGD 1VQNN 3ZT1A 3JYTA 1RTJA 3UE5A 4KH6A 4CJ7A 2KKZA 3IRXA 1ITGA 3SI6A 1GLFO 2P9UA 2ZGYA 4FWQA 4KV8A 2QW9A 2D5RA 3ALYA 4YOXA 2BTFA 3PX0A 2ASPA 2NRWA 1HMVA 3P38A 4CJ5A 5AQPA 4Z4GA 3BUZB 1QS4A 1YF5L 5AQFA 2KFNA 2B4JA 4BC3A 1U2VB 4BVPA 4CI6A 2YHXA 3SAHA 3BEXA 4CHPA 3CPWM 3O4QA 5JS1A 3OBWA 3SUOA 4A61A 1KAYA 1HJRA 4FJMA 2OPSA 3AVNA 4W5TA 2W6LA 1UA0A 2PAVA 1DEJA 3EKSA 1M1KO 5AQYA 1JLFA 4YOVA 1ZBUA 1VQ8N 4BE2A 2Q2RA 4B1XB 4WFBL 3CFRA 1IKXA 2F7TA 3PO4A 1LAWA 1D5AA 5EXWA 1FXXA 4NCBA 4JKEA 4BQZA 4QAGA 3VGLA 3H45C 3HVTA 4FJ7A 3P1GA 3V9WA 4DR6K 4DWIA 2HHVA 1WNSA 1S72N 2B6AA 3LP2A 4JYAK 5KQ8A 4N5SA 2P9LB 3IG1A 4CEEA 5AZIA 2Y1IA 3RMCA 1JCGA 1Z26A 1HQUA 4B3MK 3H3NO 4YOUA 3R6MA 3T19A 3C65A 3HT3A 4CGGA 4CK2A 5J1EA 1HJOA 2LSNA 1Q7YO 3CYMA 4JV5K 5ADXH 3LZIA 2E20A 5AQJA 3KK3A 2FSKA 2XY7A 2Z1HA 3QFUA 4U7BA 3LWMA 2O8DB 1VSEA 3AVIA 4CJUA 1S3XA 1S5JA 2FXUA 4NB4A 2VYPA 3FZFA 1YJWN 2PYLA 3A5NC 5CR4A 3TAGA 4CJWA 4GVMA 2HNDA 1T6DA 4AM7A 1CXQA 2YHWA 1RDAA 1RGIA 2YI1A 5I9EB 1SZ2A 1NM1A 4CEAA 3WNFA 3BGRA 5HRNA 4HTUA 4FL9A 3HBTA 4LY7A 3AA3A 3D45A 4DLGA 1U48A 2VWJA 3VQEA 3NAEA 3DOKA 2PZSA 3WXJA 4KH5A 3DLLL 1S6PA 3F9KA 3OYIA 2HBJA 3HPOA 4K41A 5KRTA 3OS0A 3LAKA 3NGYA 3J7ZO 3CI5A 3CCUN 1RTIA 3O9UA 4PUOA 3NH2A 1KAXA 1NK4A 4MO5A 1OKJA 2A5XA 4FLWA 4BRCA 2YHAA 1HNXK 4LFBK 1T03A 3VQ7A 4FOEA 3KHYA 1BGXT 3SV3A 5B8HA 3SQ2A 5TKWA 5HBMA 3CCSN 3ITHA 2O8BA 3VEZA 3SJJA 4E89A 4MO4A 4ELUA 3S3MA 2QWQA 1GLCG 1QQNA 3OJSA 2KZMA 3N4PA 4ELVA 1CZAN 3O3GA 3R8EA 1KCFA 3AA2A 1NJYA 2V7ZA 4IWVA 4BC5A 4K0KK 3TARA 1O1WA 1DT9A 4AHUA 3S41A 3THXA 2OPQA 1N36K 4PKIA 1KTQA 2W41A 3OY9A 4JN4A 2QWLA 3J80O 4DUYK 3GDQA 2E4LA 1YXQA 4GV9A 4OLBA 5K14A 3C6AA 1K8KA 1WAFA 4H0YB 1BHLA 3V6DA 4B1ZA 4DV3K 5M1FA 3ID8A 2YV0X 3HYFA 2P9PB 1L3SA 4O5BA 2GTDA 2V51B 1YI2N 3ENHA 3BDPA 1EXQA 1O13A 4GMJB 4Z4IA 4DSIA 3DJCA 3SZ2A 2KFZA 5BPLA 1HRHA 1NBWA 3H6EA 3Q7BA 3MX5A 2ZGZA 4CFCA 4RW4A 1ESVA 4X62K 5HRSA 4K43A 1B92A 1TVRA 3E9LA 1UWBA 5FDLA 3IDHA 3CQYA 5CZ1A 5CYMA 3D2FA 1XNRK 1QHTA 4JD2A 3TAPA 3IS9A 3HI0A 4CZMA 3VQ5A 4KH4A 3ZSYA 3ENBA 5LJVA 1ZBFA 4M3ZA 3VESA 3EZWA 5BRHA 4Z4HA 2ZJQL 2QXLA 3O9TA 3AARA 5HROA 4FLXA 4NYNA 4PA1A 3DLRA 3AVKA 5HRPA 5AZJB 4IEEA 3S5TA 4CFAA 1W0HA 5JICA 1VRTA 2B5JA 1WB9A 1WBDA 4HTLA 3CCLN 1TK8A 3CXCM 1NJWA 1IBLK 5FPDA 3S9HA 5HRRA 2KTQA 3LM2A 2FC0A 4WQ5A 2UYTA 3V1RA 1GLBG 4M7XA 1TYQB 3MN5A 4I6MB 1XMOK 2V52B 2VQFK 4BC2A 3RMDA 3C7NB 3I8DA 3I33A 4H0XB 4CF9A 1T8EA 2E1ZA 1VSJA 4EIAA 2PBDA 3SBGA 3KD5E 4HHTA 3H1QA 3O6WA 1J5EK 3NBPA 1S6QA 3IKMA 3E1YA 4AILC 1T44A 1SL2A 4FJ5A 3HJFA 3NE6A 1NGAA 4HVJA 4DF8A 1X9WA 2NRHA 3KVGA 1EETA 1RT2A 3SV4A 4GKKK 1FKPA 4J2DA 3ZETB 5EX5A 1NJXA 4UY8O 1WUAA 3HXMA 3JS6A 5ADXA 4M3XA 4AHCA 4RCHA 4FK4A 4DR4K 4FM2A 1RT6A 2KZZA 5AQUA 2NNWA 1HUXA 5GIOA 3EKUA 3WEEA 2GWKA 3UKUB 3EZ5A 1Z6RA 1DGKN 3C0BA 3M3ZA 3RSEA 3VGKA 4EAHD 1U47A 4FJJA 3A8YA 3Q7CA 1XQSC 3J7AP 2RE2A 4E0DA 4BC4A 1JXBA 4JKHA 2P9NA 1NK9A 3P39A 4E7HA 1QVGM 3LZJA 4DSKA 1HNWK 1HKCA 4E7LA 4YNQA 1RDWX 4DS4A 3VTIA 3FZMA 3TU5A 2VWBA 4BG9A 4E19A 3O3FA 4BVOA 3D0PA 4K8ZA 2RN2A 5AQIA 2OPPA 4JS4A 3CERA 4GV6A 1R0AA 5KGWA 4FLTA 1KQSM 1I39A 1X1PA 1OH5A 2YJFA 3O1BA 2YCHA 1N8RO 4O4GA 2GV9A 4KTQA 3JSMA 3QEWA 2A1RA 2IVNA 1LW0A 4BE1A 1RCHA 2FBTA 2VWKA 1VSMA 1OH6A 3OBYA 4CBXA 4RTFD 3WXLA 3OYLA 1X9MA 1MA9B 4I9LA 4FJ9A 3ZSQA 1UAXA 3SLCA 3L4QA 1Q18A 2IIRA 3HSCA 1QQCA 3V9ZA 1Q81O 4RW9A 3CC2N 1T6CA 2ETJA 3CMAN 4N47A 1CXUA 4YDUA 3TAMA 2Z1JA 5C25A 4H8KA 2UXBK 1RTHA 3O5BA 4OLAA 4NCGA 3CETA 3FLCO 2FF3B 4FK0A 1GOBA 2ZJRL 2QKKA 3HL8A 4I2QA 3QICA 1Q8IA 3H1VX 3C6TA 3DLBA 4WQ5C 4BRMA 4HUFA 5AJ3K 4DR5K 3ZT2A 3OJUA 3AGRA 4BRNA 2QWPA 2HMPA 3RRHA 3HP6A 4UQGA 3NGZA 4LF9K 4CESA 4BEBA 3U6FA 3E9OA 1NGBA 1IV0A 3RR7A 2UXCK 3OYEA 4C8MA 3CF5L 2HHWA 2NZTA 3V4IA 1KFDA 3K2PA 4IKFA 4DF4A 2QXFA 5TKYA 2DFEA 4M3WA 3ZT4A 4OVLA 5C2FA 1C1CA 3HO1A 2ZF5O 3CYGA 4JK7A 1S9GA 5KRSA 3KWGA 2HHUA 5SZTA 4ZHRA 3CC4N 1Y64A 4LF4K 5HOOA 1T7PA 3NF7A 4B9LA 4JS5A 3FGUA 5I42A 3NF9A 2O8DA 3OYCA 3C6HA 3A5LC 4IJNA 1KAZA 2Q0RA 3AV9A 2FSJA 4XH5A 3ZSXA 4FO0A 3DOLA 3M8SA 1NU0A 3QLHA 1BCMA 1MWMA 4CEOA 1D9DA 5GADP 3AAPA 4R79A 3G10A 4CE9A 2OCEA 4FJNA 3N4QA 2IDOA 4B9SA 5FPEA 1XWLA 1KXPA 3DRPA 3DXMB 3SYZA 1JJ2M 2CGJA 3ENOA 4M7YA 4ISFA 5IWAK 2D1KA 4WFNL 4JKFA 1RBTA 3MEGA 3V9SA 4BR4A 4BGBA 3TAFA 2UUCK 4F8RA 3LAMA 5HP1A 1YJ9N 4H5WA 3KJVA 4H0VB 1GLJO 3LP1A 5C24A 3IFRA 5KPTA 4BRFA 4WFAL 3NF8A 2IGIA 4IDHA 2FSNA 2QM1A 3ZSOA 3MAQA 2PYJA 3HTVA 4JHDA 2DFHA 4CBWA 1FK9A 1BA0A 3VOVA 1WLJA 3AAQA 1QZ5A 3O08A 2VG5A 4B8CA 4E1JA 3NH1A 5AQLA 4CGIA 1RTDA 2O8CB 4EZ6A 1WSEA 3ZX2A 3AVAA 4FJIA 1TV6A 2Q0UA 1OH7A 2ATQA 1L3VA 3MK6A 2V7YA 3T7ZA 3QERA 4F3TA 3AO3A 2D0CA 4FW2A 4H4MA 4BRHA 1QVFM 1VRUA 2XY5A 2D0PA 2X6SA 4AHTA 3RMBA 1QSLA 2OZMA 3AGKA 4QCLA 4YDUC 1Q9YA 1WSHA 2F8SA 5DK5A 1A5VA 3LP0A 3VQ6A 1XI1A 1S1WA 4CGHA 3A5MC 3CFPA 3V81A 2OTJN 1QZ6A 3AVHA 3M8PA 5M1QA 3SPZA 1XNQK 1T3VA 5HLFA 4OPJA 3DMJA 3MDQA 1YTAA 4NLCA 4BRPA 3L2QA 4U67L 3PSIA 5BPMA 1U4BA 4FPAA 3B8AX 4ILHA 3OYDA 2UUBK 4KB0A 4KHPK 4IG0A 1HYZA 1BOTO 1TKTA 2GUIA 4B9TA 1W9HA 4KPYA 1VSKA 3I55N 4BG8A 4CEQA 4JI8K 1NLVA 3HPHA 3A5OC 4FWRA 1HNVA 4DFJA 3RMAA 2QWNA 4KO0A 4CF8A 1LV5A 1Y97A 2FBVA 2HBLA 4IFEA 1NJZA 4JKCA 4IDKA 4BR7A 4DR3K 4DQQA 4FJXA 2E2QA 2AP1A 4OKJA 3AO4A 4FJHA 1ASVA 3S3OA 3CJAA 3KLEA 4DFPA 3L3UA 5AQWA 1JCEA 4Z0UA 5EOYA 1JLEA 1D8YA 4EP4A 3KLFA 4GY2B 3ZEUB 2XHBA 5GINA 4RWTA 1XUPO 3KD1E 4BGAA 3DXKB 3L2RA 3NGIA 5I3UA 4CZIA 3LALA 1WN7A 4HCCA 2E2NA 2HNZA 3F2KA 5LL6Z 3VEWA 1TAQA 4FW1A 4CJLA 3NVMA 4DTMA 3TAQA 2QWOA 1QSSA 1KD1O 4KHSA 4MDAA 2WTUA 4JKBA 4FZXC 2IVOA 4PQUA 4AM6A 4H0OA 4EHTA 5M1OA 4ZTJA 1RT4A 5DM6L 5CYQA 2CGKA 3M8QA 2WC9A 3H46O 4ICLA 1WBBA 4B9VA 1TYQA 3THYB 1Q9XA 1FKOA 4DR2K 4O8KA 2QA4N 4BRQA 2HHQA 3CC7N 3KLHA 4RW7A 3M1FA 1N32K 5JVHL 4E1NA 1RBSA 1KVCA 4BE7B 4FYDA 4BE0A 1RNHA 1QQOA 4MLEA 1IO2A 1JL1A 4PKHA 1K8AO 3LPTA 5C15A 4F4KA 1F21A 4CGDA 4KHQA 5AQSA 4WE1A 1X3NA 3M6GA 3VERA 3VTHA 3ZSVA 3FZHA 2E6MA 3L2UA 3K5LA 3OW2M 2O4GA 1VSHA 4NO7A 3UKRA 4CZEA 1ZBSA 4YOTA 1R59O 4DUZK 3L0QA 2JGUA 4JRPA 2FBYA 3AVJA 3K9KA 4K8XA 3VPZA 5AQZA 1D4XA 1N6QA 3O1WA 1E4FT 3NHGA 4OX9K 4O55A 3G4SN 1EKEA 3EYZA 1BIZA 5CE3A 1OH8A 3KK1A 3EL2A 4YHHK 1W7AA 1BO5O 4CW7B 3E9PA 1HLUA 2W42A 1YT3A 3QEVA 2IS3A 4DS5A 4L8RB 2GWJA 3VQ9A 1BISA 1HQEA 1IBMK 1VQ5N 4PHTX 3F73A 4CFDA 3AY9A 2VCPA 3CJ1A 2UU9K 1MWKA 1HPMA 4CIGA 1BL3A 2QI2A 4KHNA 2ZE2A 5KGXA 3CG7A 1U49A 5BR8K 4DV2K 4KREA 3KLGA 3LDNA 4CF1A 5JMVA 4LF7K 2E5LK 3L3VA 3QO9A 5KPRA 3RWUA 5ELZA 4RW6A 1S1UA 3QESA 3L8BA 2UXDK 1NOZA 2E2PA 3O9RA 5GAEP 3NDKA 1P8ZA 4J2AA 1CZ9A 3IAYA 3MN7A 2P9KA 3LDSA 1JKHA 3HSTB 2HHSA 4IOXA 3B6OA 1OVYA 1SS6A 3A0IX 4BACA 2OZSA 1NK7A 4JNEA 5SWMA 2YNHA 2QK9A 1EQYA 4TSXA 3HM9A 4K25A 1JL2A 3CCJN 5D3GA 4JKGA 4G9ZA 4BROA 2XO7A 1QTMA 3SNNA 3OYMA 4X64K 1IH7A 4CJKA 2HF3A 3BZKA 1CZBA 1WSIA 4QOZB 1X9JA 1U04A 3HM8A 4GW6A 4J8FA 3SUNA 4M45A 3U4LA 1HKBA 3D2EB 3CJ7A 3FR0A 3VQBA 2Y1JA 5AQTA 3ZYYX 2O8FA 3JAMO 2P9SA 4CBUA 5EY4A 4EP5A 1JLQA 2HSTA 3LM9A 5GAGP 5BREA 1VQPN 2NRZA 2RPIA 3TAEA 3U3GA 5F2RA 5KI6A 1MDUB 1P90A 4CEBA 4FWNA 2CH5A 3G71N 2OANA 2D4WA 1C1BA 3ZSRA 4ELTA 1ZBLA 3ULEA 4RW8A 3G6EN 1HNZK 4XJXA 3CCEN 3MX2A 3WQTA 1JCFA 2BANA 2Q31A 5J2NA 3DRSA 2NRTA 1VQ4N 3AA5X 4E72A 3AVLA 1G99A 4O0JA 1KFSA 1BA1A 4LF8K 3CCMN 2P51A 1E3MA 4DV7K 3MWTA 3I0SA 3PLAA 1MU2A 1SL0A 2JWKA 3QBXA 3E66A 2OTLN 3C6UA 4B8AB 4DV6K 1SQKA 3MMVA 4WYBA 3KTQA 5AQVA 3MCAB 1NKBA 2BGGA 1LOTB 1L3UA 1VQON 1DTQA 3HK2A 3CJ9A 2GUPA 3NFAA 3SJHA 4DTXA 2G8IA 1XMQK 2X74A 1RBUA 2WOMA 3LDOA 3QBWA 3AVBA 5FPNA 5M1KA 5AQGA 4K42A 4DU1A 4CJQA 4F3OA 2PFUA 3DLGA 4LD0A 3LWLA 5MLCQ 3FFKB 2G8KA 4B9QA 1NGJA 5DM7L 4MQ3A 3ISNC 1H1VA 1DLOA 1JXEA 4DQSA 3RRGA 3KLIA 5F1XA 4FM1A 3SQ0A 3ATUA 4B1YB 4GVEA 4C8NA 3THWA 4OGEA 2W00A 2P9IA 4J2BA 1IBKK 4LH5A 4NXMK 1TK0A 4JKDA 3K5OA 1A5WA 1ATRA 4QS7A 1WSGA 5AR0A 1T05A 2EWSA 1QQMA 1V4SA 4CJVA 4GNIA 3D6RA 4FOIA 4N41A 2NRVA 1RDDA 3THVA 3CM6A 1HYSA 3VENA 4XH4A 1RT3A 2O8BB 5CZ2A 2JLEA 4CCHA 3L2VA 1VQ9N 5LMNK 2G8HA 4Z94A 3TWHA 1U2VA 1LWFA 4FLZA 5AFUH 1N5YA 2KW4A 4M3RA 4X65K 3TTFA 4DV4K 4JEPA 3U9DA 4FJKA 2HB5A 1C0GA 3CFOA 4FZYA 1JLCA 2NUBA 2XY8A 3VN5A 4B9MA 4DSLA 3THXB 1GLAG 5KQDA 1JLGA 3P5JA 3WNEA 4B3TK 3KK2A 1KRPA 3MN9A 4KB1A 3H08A 4FJLA 4CHYA 5BRDA 3RR8A 3PIOL 2RHKA 1K8KB 3K9JA 2HBKA 3VEOA 4W5RA 3VGMA 3QIOA 3MXMA 4FM0A 4OKEA 4I7FA 4DTUA 1BI4B 4M3TA 4MDBA 4A59A 4KTWA 5KTQA 4BR2A 3R9PA 5AQXA 3OTOK 4KKOA 2DY4A 2P5OA 3WT0A 1BUPA 4IZ9A 4BDYA 4KHWA 4PKGA 3MECA 2YNIA 3O9QA 1KLNA 3NMUA 2HBMA 2P9LA 1WAJA 1OVQA 3KIOA 3TI0A 1NGGA 1FJGK 3U8XA 4LF5K 2YJEA 3SQ4A 4BR0A 1NKCA 5AQKA 1BQNA 4CJ4A 3GL1A 4AH9A 1V4TA 3D2FB 4HWIA 2DFFA 1IG9A 1RDCA 3VEYA 4E7IA 3K59A 1REVA 2CH6A 4A62A 3AVCA 1XHZA 3K58A 1U6ZA 1BG3A 3H3OB 4FK2A 2JWLA 3MN6A 4MFBA 5GAHP 3AO5A 5H1SQ 1S1XA 1NOYA 2GELA 3FZLA 4OJRA 2YKNA 4F2RA 4CIEA 1VAZA 3L4IA 4AQYK 1SKSA 4H5NA 3VQPA 3HP9A 3OYBA 1ZYQA 1C0TA 4ILJA 3V1QA 3QNOA 3CHWA 2I7NA 2D0BA 1NWKA 2I5JA 4CD1A 3LL3A 4H0PA 2WUSA 3MXIA 1A5XA 1NGDA 3IUCA 1G15A 4JKAA 3TSUA 3ZT3A 2OA8A 4M42A 3T1AA 3AVGA 2D0AA 2O8EB 4F2SA 1NGHA 5IT9O 4CEZA 4IBNA 3SUQA 4CJ3A 3VETA 2HW3A 3OVNA 1RILA 5JLHA 2A1SA 2Z1IA 1E4GT 3WXKA 3G0ZA 5EU7A 5LJWA 3O9SA 4CJRA 2XRIA 3V9UA 1WOQA 1B9DA 3NF6A 3EE8A 5JENA 2ZWHA 2KHOA 3OHRA 4DTNA 2HNYA 4H5TA 4H4OA 2DTUA 1Q82O 3WXMB 3J7YP 3SBTA 3QB0A 4EFHA 3R3LA 1HKGA 3VMFB 4BQLA 1QSYA 3HZ6A 4LFCK 3WEEB 1J5OA 1I3AA 4B3RK 1BQMA 4ID5A 3RSEB 3T1HK 5AQNA 4BR9A 2AA4A 5AQOA 1ZC6A 4FLVA 4CVNE 4DV5K 4LSNA 4H0TB 3K57A 2Q36A 1NMNA
chains in the Genus database with same CATH topology
1Q86O 3OW2M 3JXUA 3EO3A 2KLAA 3CJCA 3DWLA 4NO7A 3TSQA 3UKRA 1ZBSA 4YOTA 4CZEA 1R59O 4DB3A 5AZJB 2F9WA 4IEEA 2P9NB 3L0QA 4JAXA 5JICA 3DXKA 4F9OA 4HTLA 1ATNA 3CCLN 3LDQA 3K9KA 3CXCM 5FPDA 3VPZA 5AQZA 1D4XA 4JKGB 3TTCA 4MLHA 3LDLA 3LM2A 3O1WA 4WQ5A 2WBNA 2UYTA 1E4FT 1BU6O 1GLBG 4M7XA 1TYQB 3MN5A 4I6MB 1XC3A 4L3QA 4A57A 3G4SN 3QMLA 2V52B 2ASOA 4BC2A 3C7NB 5CE3A 3I33A 3EL2A 5AQQA 3LDPA 1BO5O 4H0XB 2P9PA 2E1ZA 3E9PA 1HLUA 3CD6N 1EO1A 3TSPA 4EIAA 2PBDA 3SBGA 3L6QA 2ITMA 1TUYA 3H1QA 3O6WA 4A2BA 3J8AA 4IEIA 2GWJA 3IKMA 3E1YA 4C1NI 4JK8A 1T44A 1W2BM 1VQ5N 4PHTX 1NGAA 4NLBA 2P9SB 3AY9A 4JD2B 4B1VA 4EHUA 2VCPA 3CJ1A 1MWKA 2NRHA 3GE1A 4DHYA 1HPMA 3CPEA 3KVGA 4KBOA 3TTDA 1NGFA 1YIJN 1YVNA 5BPNA 2QI2A 3ATVA 3ZETB 5EX5A 4UY8O 1TUUA 2Q97A 1WUAA 3UB5A 4WF9L 2J4RA 3LDNA 3D2EA 3JS6A 5ADXA 4RCHA 5JMVA 2C1GA 4ILGB 3CCQN 4OO1J 5KPRA 5AQUA 2NNWA 1HUXA 5GIOA 3EKUA 5AQMA 3MWPA 3WEEA 5ELZA 2GWKA 3UKUB 3ULEB 4BRGA 2CGLA 1Z6RA 1DGKN 3C0BA 2E2PA 3M3ZA 3RSEA 3VGKA 3O9RA 4AF1A 4BRAA 1P8ZA 5GAEP 5AFUA 2BUPA 4O5FA 3MN7A 5EVZA 2P9KA 3ZX3A 4H03B 3A8YA 3Q7CA 1XQSC 3QFPA 4IOXA 1OVYA 4OPHA 1SS6A 3A0IX 2RE2A 5M1PA 4BC4A 4GV3A 3O80A 5M1NA 4JNEA 5AZJA 3I56N 3CCVN 4JKHA 2P9NA 1EQYA 5F0XA 3P39A 5HL7L 3U9ZA 4A5BA 1QVGM 4K25A 5KPZA 4CZJA 3CCJN 1HKCA 3KK7A 2I7PA 4JKGA 3BF3A 1RDWX 3EE9A 3SMSA 4BROA 3VTIA 4G9ZA 2A41A 3W3DA 3FZMA 3TU5A 3BP8A 2VWBA 4BG9A 4I6MA 4LC9B 1VQKN 5FPMA 1QHAA 2IVPA 2HF3A 3C7NA 4XEIA 4BVOA 3GG4A 1NJIO 5AQIA 3KZBA 4YORA 1X9JA 3CERA 4GV6A 3HM8A 2H3GX 1BWFO 4BREA 1KQSM 4J8FA 5E26A 2YJFA 1GLDG 2FLOA 2QWRA 2NLXA 2YCHA 1C0FA 1HKBA 1SAZA 2QWMA 3O1BA 3D2EB 4M63C 4WQ4C 3U4LA 4ISGA 5BRFA 1N8RO 1IG8A 3CJ7A 3FR0A 2IVNA 5AQTA 3ZYYX 3FZKA 4C1NK 5JLFA 2P9SA 3OBYA 4BRLA 1NMDA 4CBXA 4RTFD 3WXLA 1MA9B 3SMPA 5EY4A 4CBUA 3SAFA 4FVUA 3VF6A 2HSTA 3LM9A 3SLCA 1IJJA 3L4QA 5GAGP 1Q18A 2IIRA 4IJAA 3HSCA 4B1UB 2E8AA 5BREA 3ZETA 1VQPN 5BN9A 4QS9A 2NRZA 1Q81O 2A3ZA 4B1WB 4Y0WA 3GOIA 3CC2N 2BH1A 2DPNA 1T6CA 3CMAN 5F2RA 3TPQA 2VGNA 1MDUB 1P90A 3BF1A 4YDUA 5C2DA 4FWSA 4FWNA 2CH5A 3G71N 2OANA 2D4WA 3CJBA 4CZHA 2YHYA 2A42A 2P9IB 3F9MA 3VEVA 3P4IA 3UKUA 3O5BA 3ULEA 3CETA 3FLCO 3G6EN 3HRGA 4PL7A 4XJXA 2FF3B 3CCEN 3MX2A 2ZJRL 3WQTA 3CMEN 1JCFA 1DKGD 5JVGL 2Q31A 3QICA 3H1VX 1VQNN 2A40A 2NRTA 3UE5A 4WQ5C 4BRMA 1VQ4N 4KH6A 3KWIA 4CZKA 4CJ7A 2KKZA 1G99A 1BA1A 3CCMN 2E1YA 1BDGA 3AGRA 1GLFO 2P9UA 4BRNA 2QWPA 2ZGYA 2HMPA 4FWQA 4DKWA 2C1IA 2QW9A 4YOYA 4YOXA 3M5RA 2BTFA 3MWTA 2ASPA 4BEBA 2NRXA 2NRWA 2VGMA 3P38A 4CZFA 3PLAA 2JWKA 3QBXA 3E9OA 1NGBA 4A2AA 4JHDB 3E66A 5AQPA 2OTLN 3BUZB 3F5TA 1YF5L 5AQFA 3CF5L 2NZTA 3PIPL 1SQKA 4BC3A 3MMVA 4WYBA 3G25A 5AQVA 1U2VB 3MCAB 4BVPA 4H5RA 4CI6A 4JK9A 5TKYA 5C10A 2YHXA 3SAHA 3BEXA 3CPWM 3HOTA 1NGCA 3OBWA 1LOTB 4A61A 5C2FA 1J6ZA 1X3MA 2ZF5O 1KAYA 1VQON 4JK7A 5BR9A 3CJ9A 3KWGA 2GUPA 2E2OA 3SJHA 4CZGA 2PAVA 3CC4N 1Y64A 1DEJA 3EKSA 3MCPA 5HOOA 1M1KO 5AQYA 2QEXN 3W0LA 3WQUA 4YOVA 3FGUA 5LY3A 3LDOA 2QTDA 1VQ8N 1ILYA 3QBWA 5FPNA 3C6HA 2Q2RA 3A5LC 4IJNA 1KAZA 4CD3A 2Q0RA 5M1KA 5AQGA 4K42A 2FSJA 4XH5A 4IO9L 2PFUA 4B1XB 4FO0A 4WFBL 4ISEA 5MLCQ 2F7TA 3FFKB 5EXWA 4B9QA 1NGJA 1MWMA 5DM7L 5GADP 4JKEA 4BQZA 3VGLA 4FWLA 3AAPA 1H1VA 3H45C 4R79A 3HOSA 3ZX0A 5F1XA 3FE1A 3N4QA 3ATUA 5FPEA 4B1YB 4GVEA 1KXPA 3EN9A 1S72N 3DXMB 2P9UB 2W00A 2P9IA 1JJ2M 2CGJA 4WCEL 5KQ8A 3ENOA 4M7YA 4ISFA 4JKDA 2P9LB 2D1KA 5AZIA 1ATRA 4QS7A 1JCGA 4WFNL 3H3NO 4JKFA 4YOUA 4CZLA 1HX1A 4BR4A 3R6MA 4BGBA 5AR0A 3C65A 2EWSA 1NGIA 1QQMA 1V4SA 1YAGA 4GNIA 1YJ9N 3D6RA 4FOIA 2NRVA 4H5WA 1HJOA 4BR5A 1Q7YO 1S22A 4H0VB 4XH1A 5E84A 1GLJO 2ZJPL 1YHQN 3IFRA 4XH4A 3VENA 5KPTA 5ADXH 4BRFA 3P31A 4WFAL 4IDHA 2E20A 2FSNA 2QM1A 5AQJA 3VEXA 2FF6A 2FSKA 3T69A 1VQ9N 3HTVA 3QFUA 4JHDA 4U7BA 2Q1NA 4CBWA 4Z94A 1BA0A 3VOVA 3AAQA 1U2VA 1RDUA 1QZ5A 1S3XA 2A6AA 3O08A 2FXUA 4NB4A 5AFUH 4E1JA 1VQMN 5AQLA 2VYPA 3DAWA 3FZFA 3TTFA 1YJWN 3I8BA 4JEPA 3U9DA 1ZXOA 1C0GA 3A5NC 5CR4A 3ZX2A 4FWMA 1GLAG 1GLEG 5KQDA 1T6DA 4AM7A 3VF2A 2Q0UA 2YHWA 1RGIA 2YI1A 5I9EB 1SZ2A 1NM1A 3MK6A 2V7YA 3MN9A 3WXIA 5GIPA 3T7ZA 4FL9A 3HBTA 4BRHA 1QVFM 4PL8A 5BRDA 2D0PA 3AGKA 4YDUC 3WUHA 3PIOL 2RHKA 1K8KB 5AZIB 4KH5A 3K9JA 2HBKA 4FSVA 3VEOA 3WXJA 3DLLL 3GBTA 3VGMA 3A5MC 2OTJN 4MDBA 1QZ6A 5M1QA 2HBJA 4A59A 5AQHA 2E88A 4K41A 1T3VA 4BR2A 3J7ZO 3R9PA 5AQXA 3MDQA 3DXMA 2HF4A 4H5VA 4NLCA 3CI5A 3WT0A 4BRPA 1BUPA 4U67L 3CCUN 4IZ9A 1K73O 3O9UA 4PKGA 1KC8O 5BPMA 1M90O 4IOCL 3O9QA 2HOEA 4FPAA 3NMUA 2HBMA 2P9LA 3B8AX 4ILHA 1KAXA 4BRKA 1K9MO 4MO5A 1OKJA 1BOTO 2A5XA 3R1XA 4BRCA 5AQRA 1NGGA 2NRRA 3I55N 4BG8A 3OA9A 3U8XA 3ID6A 1NLVA 4FOEA 3KHYA 4FPBA 4IXCA 2YJEA 5B8HA 4IOAL 2YX6A 1YJNN 5TKWA 3A5OC 4FWRA 4BR0A 1NGEA 3CCSN 3VEZA 2QWNA 5AQKA 3GL1A 2D0OA 4MO4A 3O8MA 2HBLA 4BRIA 2QWQA 1GLCG 1QQNA 1V4TA 3D2FB 4IFEA 4HWIA 4OPAA 4JKCA 3N4PA 4BR7A 5BN8A 2E2QA 1CZAN 2AP1A 3SK3A 3VEYA 4FWKA 3R8EA 2CH6A 4A62A 3CJAA 1U6ZA 2GEMA 2V7ZA 5AQWA 1BG3A 1JCEA 4IWVA 3H3OB 4BC5A 2JWLA 3MN6A 5EOYA 4BECA 1DT9A 3S41A 5GAHP 4GY2B 3ZEUB 4C23A 4PKIA 5GINA 5H1SQ 2GELA 2F9TA 2W41A 1RFQA 3FZLA 3UKRB 4RWTA 4JN4A 2QWLA 1XUPO 1YITN 3VF4A 3GDQA 4BGAA 1YXQA 3DXKB 4GV9A 4CZIA 3SAGA 1VAZA 3L4IA 3C6AA 2E2NA 1K8KA 4H5NA 4H0YB 3F2KA 4B1ZA 3VEWA 5CHIA 5M1FA 4YOWA 3ID8A 5C0YA 4O8UA 4ILJA 3NVMA 1VQ6N 4FWPA 3CHWA 2I7NA 1NWKA 4CD1A 2QWOA 3LL3A 4H0PA 1YUWA 2P9PB 2WUSA 1KD1O 2GTDA 4MDAA 2V51B 4EAHD 1NGDA 3IUCA 4JKAA 4JKBA 3TSUA 4A5AA 4IO8A 3ENHA 1YI2N 2IVOA 4AM6A 4H0OA 1VQLN 1O13A 4EHTA 5M1OA 1VQ7N 1NGHA 2W40A 5DM6L 3DJCA 5BPLA 2CGKA 1W97L 2WC9A 1NBWA 3VETA 4DQ8A 3H46O 3H6EA 3Q7BA 1TYQA 2GX9A 5JLHA 3CQXA 3D7EO 4O8KA 1E4GT 3WXKA 1GLLO 3MX5A 2QA4N 5LJWA 5C12A 3O9SA 4BRQA 4QS8A 2ZGZA 4WQ4A 4FWOA 1ESVA 1WOQA 3EE8A 3CC7N 4K43A 2ZWHA 2KHOA 3OHRA 3M1FA 2WFBA 3E9LA 4H5TA 1LCUA 3CCRN 3IDHA 5JVHL 3CQYA 1Q82O 3WXMB 3SBTA 3D2FA 4BE7B 3CIPA 3QB0A 4EFHA 3RVCA 1QQOA 1HKGA 3R3LA 4MLEA 3VMFB 4BQLA 4DCHA 3HZ6A 4JD2A 3QDKA 2ASMA 3WEEB 1ATSA 3HI0A 4CZMA 3NVKA 1Z05A 3IMXA 4PKHA 1K8AO 4KH4A 5C15A 5LJVA 3ENBA 3RSEB 5AQNA 3VESA 3EZWA 5BRHA 4BRDA 4BY9C 4BR9A 2ZJQL 2AA4A 5AQOA 1ZC6A 2QXLA 5AQSA 1X3NA 3M6GA 3O9TA 2P9KB 3VERA 3VTHA 3AARA 4H0TB 3O4WA 3FZHA 2Q36A 3ZEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JXU A;  3EO3 A;  3CJC A;  3DWL A;  4NO7 A;  3UKR A;  4CZE A;  1ZBS A;  4DB3 A;  1R59 O;  5AZJ B;  2F9W A;  2P9N B;  3L0Q A;  4JAX A;  5JIC A;  3DXK A;  4F9O A;  4HTL A;  1ATN A;  3LDQ A;  5FPD A;  3VPZ A;  5AQZ A;  1D4X A;  4MLH A;  3LDL A;  3LM2 A;  3O1W A;  4WQ5 A;  2UYT A;  1E4F T;  1BU6 O;  1GLB G;  4M7X A;  1TYQ B;  3MN5 A;  4I6M B;  1XC3 A;  4L3Q A;  3QML A;  2V52 B;  2ASO A;  4BC2 A;  3C7N B;  5CE3 A;  3I33 A;  3EL2 A;  5AQQ A;  3LDP A;  1BO5 O;  4H0X B;  2P9P A;  2E1Z A;  1HLU A;  4EIA A;  2PBD A;  3L6Q A;  2ITM A;  1TUY A;  3H1Q A;  3O6W A;  4A2B A;  3J8A A;  2GWJ A;  1T44 A;  1NGA A;  2P9S B;  3AY9 A;  4JD2 B;  4B1V A;  4EHU A;  2VCP A;  3CJ1 A;  1MWK A;  2NRH A;  3GE1 A;  4DHY A;  1HPM A;  3KVG A;  4KBO A;  1NGF A;  1YVN A;  5BPN A;  3ATV A;  3ZET B;  5EX5 A;  1TUU A;  2Q97 A;  1WUA A;  3UB5 A;  2J4R A;  3LDN A;  3D2E A;  3JS6 A;  5ADX A;  4RCH A;  5JMV A;  5KPR A;  5AQU A;  1HUX A;  3EKU A;  5AQM A;  3WEE A;  5ELZ A;  2GWK A;  3UKU B;  3ULE B;  4BRG A;  2CGL A;  1Z6R A;  1DGK N;  3C0B A;  2E2P A;  3M3Z A;  3RSE A;  3VGK A;  4BRA A;  4EAH D;  1P8Z A;  5AFU A;  2BUP A;  4O5F A;  3MN7 A;  5EVZ A;  2P9K A;  3ZX3 A;  4H03 B;  3A8Y A;  1XQS C;  3QFP A;  3A0I X;  4BC4 A;  3O80 A;  4JNE A;  5AZJ A;  2P9N A;  1EQY A;  5F0X A;  3U9Z A;  4K25 A;  5KPZ A;  4CZJ A;  1HKC A;  2I7P A;  3BF3 A;  1RDW X;  3SMS A;  4BRO A;  2A41 A;  3W3D A;  3FZM A;  3TU5 A;  3BP8 A;  2VWB A;  4BG9 A;  4I6M A;  4LC9 B;  5FPM A;  1QHA A;  2IVP A;  2HF3 A;  3C7N A;  4XEI A;  4BVO A;  3GG4 A;  5AQI A;  3KZB A;  1X9J A;  3CER A;  3HM8 A;  2H3G X;  1BWF O;  4BRE A;  4J8F A;  5E26 A;  2YJF A;  1GLD G;  2FLO A;  2QWR A;  2NLX A;  2QWM A;  1C0F A;  1HKB A;  1SAZ A;  2YCH A;  3O1B A;  3D2E B;  4M63 C;  4WQ4 C;  3U4L A;  4ISG A;  5BRF A;  1IG8 A;  3CJ7 A;  3FR0 A;  2IVN A;  5AQT A;  3FZK A;  5JLF A;  2P9S A;  4BRL A;  4CBX A;  1NMD A;  4RTF D;  3WXL A;  1MA9 B;  3SMP A;  5EY4 A;  4CBU A;  3VF6 A;  3LM9 A;  3SLC A;  1IJJ A;  1Q18 A;  2IIR A;  4IJA A;  3HSC A;  4B1U B;  2E8A A;  5BRE A;  3ZET A;  5BN9 A;  4QS9 A;  2A3Z A;  4B1W B;  4Y0W A;  3GOI A;  2DPN A;  1T6C A;  5F2R A;  3TPQ A;  1MDU B;  3BF1 A;  4YDU A;  4FWS A;  4FWN A;  2CH5 A;  2OAN A;  2D4W A;  3CJB A;  4CZH A;  2YHY A;  2A42 A;  2P9I B;  3F9M A;  3VEV A;  3P4I A;  3UKU A;  3O5B A;  3ULE A;  3CET A;  3FLC O;  4PL7 A;  2FF3 B;  3WQT A;  1JCF A;  1DKG D;  2Q31 A;  3QIC A;  3H1V X;  2A40 A;  3UE5 A;  4WQ5 C;  4BRM A;  4CZK A;  4CJ7 A;  1G99 A;  1BA1 A;  2E1Y A;  1BDG A;  1GLF O;  2P9U A;  4BRN A;  2QWP A;  2ZGY A;  2HMP A;  4FWQ A;  2QW9 A;  2BTF A;  2ASP A;  4CZF A;  3QBX A;  4A2A A;  1NGB A;  4JHD B;  5AQP A;  3BUZ B;  5AQF A;  2NZT A;  1SQK A;  4BC3 A;  3MMV A;  4WYB A;  3G25 A;  5AQV A;  1U2V B;  4BVP A;  4H5R A;  4CI6 A;  5TKY A;  2YHX A;  3BEX A;  1NGC A;  1LOT B;  4A61 A;  1J6Z A;  1X3M A;  2ZF5 O;  1KAY A;  5BR9 A;  3CJ9 A;  2GUP A;  2E2O A;  3SJH A;  4CZG A;  2PAV A;  1Y64 A;  1DEJ A;  3EKS A;  3MCP A;  5AQY A;  3W0L A;  3WQU A;  3FGU A;  5LY3 A;  3LDO A;  3QBW A;  5FPN A;  2Q2R A;  3A5L C;  4IJN A;  1KAZ A;  4CD3 A;  2Q0R A;  5AQG A;  4K42 A;  2FSJ A;  4XH5 A;  4B1X B;  4FO0 A;  4ISE A;  3FFK B;  5EXW A;  4B9Q A;  1NGJ A;  1MWM A;  4BQZ A;  3VGL A;  4FWL A;  3AAP A;  1H1V A;  3H45 C;  3ZX0 A;  5F1X A;  3FE1 A;  3ATU A;  5FPE A;  4B1Y B;  1KXP A;  3EN9 A;  3DXM B;  2P9U B;  2P9I A;  2CGJ A;  5KQ8 A;  3ENO A;  4M7Y A;  4ISF A;  2P9L B;  2D1K A;  5AZI A;  1ATR A;  4QS7 A;  1JCG A;  3H3N O;  4CZL A;  1HX1 A;  4BR4 A;  3R6M A;  4BGB A;  5AR0 A;  2EWS A;  1NGI A;  1QQM A;  1V4S A;  1YAG A;  4GNI A;  4FOI A;  4H5W A;  1HJO A;  4BR5 A;  1S22 A;  4H0V B;  4XH1 A;  5E84 A;  1GLJ O;  3IFR A;  4XH4 A;  3VEN A;  5KPT A;  5ADX H;  4BRF A;  2E20 A;  2FSN A;  2QM1 A;  5AQJ A;  3VEX A;  2FF6 A;  2FSK A;  3HTV A;  3QFU A;  4JHD A;  2Q1N A;  4CBW A;  4Z94 A;  1BA0 A;  3VOV A;  3AAQ A;  1U2V A;  1S3X A;  1QZ5 A;  2A6A A;  3O08 A;  2FXU A;  4NB4 A;  5AFU H;  4E1J A;  5AQL A;  2VYP A;  3DAW A;  3FZF A;  3I8B A;  3U9D A;  1ZXO A;  1C0G A;  3A5N C;  3ZX2 A;  4FWM A;  1GLA G;  1GLE G;  5KQD A;  1T6D A;  4AM7 A;  3VF2 A;  2Q0U A;  2YHW A;  1RGI A;  2YI1 A;  5I9E B;  1SZ2 A;  1NM1 A;  3MK6 A;  2V7Y A;  3MN9 A;  3WXI A;  4FL9 A;  3HBT A;  4BRH A;  4PL8 A;  5BRD A;  2D0P A;  4YDU C;  3WUH A;  1K8K B;  5AZI B;  3WXJ A;  3VEO A;  4FSV A;  3GBT A;  3VGM A;  3A5M C;  1QZ6 A;  5AQH A;  2E88 A;  4K41 A;  4BR2 A;  3R9P A;  5AQX A;  3MDQ A;  3DXM A;  2HF4 A;  4H5V A;  4BRP A;  3CI5 A;  3WT0 A;  1BUP A;  4IZ9 A;  4PKG A;  5BPM A;  2HOE A;  4FPA A;  2P9L A;  3B8A X;  1KAX A;  4BRK A;  4MO5 A;  1OKJ A;  1BOT O;  2A5X A;  4BRC A;  5AQR A;  1NGG A;  4BG8 A;  3U8X A;  1NLV A;  4FOE A;  3KHY A;  4FPB A;  4IXC A;  2YJE A;  5B8H A;  3A5O C;  4FWR A;  4BR0 A;  1NGE A;  3VEZ A;  2QWN A;  5AQK A;  3GL1 A;  2D0O A;  4MO4 A;  3O8M A;  4BRI A;  2QWQ A;  1GLC G;  1QQN A;  1V4T A;  3D2F B;  4HWI A;  4BR7 A;  5BN8 A;  2E2Q A;  1CZA N;  2AP1 A;  3SK3 A;  3VEY A;  4FWK A;  3R8E A;  2CH6 A;  4A62 A;  3CJA A;  1U6Z A;  2GEM A;  2V7Z A;  5AQW A;  1BG3 A;  1JCE A;  4IWV A;  3H3O B;  4BC5 A;  3MN6 A;  5EOY A;  3S41 A;  4GY2 B;  3ZEU B;  4C23 A;  4PKI A;  2GEL A;  2F9T A;  2W41 A;  1RFQ A;  3FZL A;  3UKR B;  4RWT A;  4JN4 A;  2QWL A;  1XUP O;  3VF4 A;  3GDQ A;  4BGA A;  1YXQ A;  3DXK B;  4CZI A;  3L4I A;  2E2N A;  1K8K A;  4H5N A;  4H0Y B;  4B1Z A;  3VEW A;  3ID8 A;  4FWP A;  3CHW A;  2I7N A;  1NWK A;  4CD1 A;  2QWO A;  3LL3 A;  4H0P A;  1YUW A;  2P9P B;  2WUS A;  2GTD A;  2V51 B;  1NGD A;  3IUC A;  4IO8 A;  3ENH A;  2IVO A;  4AM6 A;  4H0O A;  4EHT A;  1NGH A;  2W40 A;  3DJC A;  5BPL A;  2CGK A;  1NBW A;  3VET A;  4DQ8 A;  3H46 O;  3H6E A;  1TYQ A;  5JLH A;  3CQX A;  3D7E O;  4O8K A;  1E4G T;  3WXK A;  1GLL O;  5LJW A;  4BRQ A;  4QS8 A;  2ZGZ A;  4WQ4 A;  4FWO A;  1ESV A;  1WOQ A;  4K43 A;  2ZWH A;  2KHO A;  3OHR A;  3M1F A;  4H5T A;  1LCU A;  3IDH A;  3CQY A;  3D2F A;  3CIP A;  3QB0 A;  4EFH A;  1QQO A;  1HKG A;  4BQL A;  4MLE A;  4DCH A;  3HZ6 A;  4JD2 A;  3QDK A;  2ASM A;  3WEE B;  1ATS A;  3HI0 A;  4CZM A;  1Z05 A;  3IMX A;  4PKH A;  5LJV A;  3RSE B;  5AQN A;  3VES A;  3EZW A;  5BRH A;  4BRD A;  4BR9 A;  2AA4 A;  5AQO A;  1ZC6 A;  2QXL A;  5AQS A;  1X3N A;  3M6G A;  3VER A;  2P9K B;  3AAR A;  4H0T B;  3O4W A;  3FZH A;  2Q36 A;  3ZEU A; 
#chains in the Genus database with same CATH topology
 3BY5 A;  1Q86 O;  3JXU A;  2KLA A;  3DWL A;  2WON A;  4FLU A;  2F9W A;  4OPK A;  2P9N B;  3ZSW A;  1ATN A;  2R7Y A;  3LDQ A;  3TTC A;  1YTU A;  1C0U A;  3LDL A;  4AHR A;  3KKR A;  1BU6 O;  1C1A A;  1D9F A;  4L3Q A;  4A57 A;  4CHN A;  4CIF A;  1EWR A;  4CER A;  4DLE A;  2ASO A;  4FJ8 A;  2VG7 A;  4C8O A;  2P9P A;  3AVF A;  3CD6 N;  1EO1 A;  4CF2 A;  3L6Q A;  2ITM A;  4A2B A;  4IEI A;  3VA0 A;  4C1N I;  4JLH A;  1ZBI A;  3VQA A;  4CJT A;  4JI6 K;  3AO2 A;  4CHO A;  3WNH A;  1IKV A;  3GE1 A;  3P83 D;  3CPE A;  4KBO A;  4BWJ A;  1TKD A;  1YVN A;  4GKJ K;  5BPN A;  3ATV A;  2Q97 A;  3UB5 A;  4WF9 L;  1VK0 A;  3D2E A;  4CK1 A;  3VQC A;  4DSF A;  4KRF A;  4JI3 K;  3WNG A;  3OS1 A;  3MWP A;  3VQ4 A;  1JLA A;  2BDP A;  4BRA A;  5AFU A;  2BUP A;  2IAJ A;  1LWE A;  4LF6 K;  4H03 B;  2Q3S A;  3QFP A;  4DTR A;  3KKS A;  5M1P A;  4GV3 A;  3O80 A;  3HVR A;  1NK0 A;  5M1N A;  3I56 N;  5AZJ A;  3CCV N;  4B9N A;  4A5B A;  3HPG A;  5KPZ A;  4CZJ A;  4CJE A;  4CHQ A;  3T1Y K;  3SMS A;  3SCX A;  2A41 A;  3W3D A;  3O4N A;  4I6M A;  4LC9 B;  3PY8 A;  4DV1 K;  5FPM A;  1QHA A;  2IVP A;  3C7N A;  2OPR A;  4XEI A;  3GG4 A;  3KZB A;  5E41 A;  1TK5 A;  5JS2 A;  4J2E A;  5E26 A;  1GLD G;  2QWR A;  1NKE A;  1RBV A;  1SAZ A;  4XIU A;  4ISG A;  4DU3 A;  4KAZ A;  1IG8 A;  4DR1 K;  1LWC A;  3FZK A;  1XC9 A;  5JLF A;  4BRL A;  1NMD A;  3ZT0 A;  3O3H A;  3SAF A;  2GBZ A;  3VF6 A;  4CED A;  1IJJ A;  3SUP A;  4B1U B;  4IJA A;  4Q0B A;  3ZET A;  4QS9 A;  4DMN A;  4HUG A;  4Y0W A;  4OGC A;  1NG9 A;  4JI4 K;  1QE1 A;  3DLH A;  4V19 S;  2BH1 A;  3TPQ A;  2VGN A;  3BF1 A;  1TAU A;  5LMU K;  3CJB A;  4CZH A;  1U45 A;  3UKU A;  3HRG A;  3EEQ A;  4E1M A;  2G8U A;  3LAN A;  2FBX A;  3QEI A;  3CME N;  5JVG L;  2A40 A;  3DM2 A;  1TGO A;  3KWI A;  4CZK A;  3VA3 A;  4RG8 A;  3V1O A;  4PWD A;  2E1Y A;  1BDG A;  4IG3 A;  4DKW A;  1EP4 A;  2C1I A;  4YOY A;  3DYA A;  3K0S A;  3M5R A;  3PX6 A;  2NRX A;  2VGM A;  4CZF A;  4A2A A;  4JHD B;  1GOC A;  3F5T A;  2HHI A;  1BCO A;  3PIP L;  1RDB A;  4R5P A;  3G25 A;  4BDZ A;  4H5R A;  4JK9 A;  5C10 A;  3HOT A;  1NGC A;  4B9U A;  3LPU A;  1X3M A;  1J6Z A;  5BR9 A;  1X9S A;  3C94 A;  2E2O A;  4CZG A;  3MCP A;  2QEX N;  3W0L A;  3WQU A;  5LY3 A;  2QTD A;  1KSP A;  1ILY A;  2ZM6 K;  4M41 A;  4CGF A;  4JI0 K;  3DLE A;  4CD3 A;  1RT5 A;  1C6V A;  4IO9 L;  2OYQ A;  4FZZ A;  4ISE A;  4BWM A;  4FWL A;  3HOS A;  2PY5 A;  1NK5 A;  3ZX0 A;  1Z25 A;  3FE1 A;  4FLY A;  1SKR A;  3EN9 A;  3T3F A;  2P9U B;  1YVU A;  3M8R A;  4Y1C A;  3AA4 A;  4WCE L;  2AJQ A;  4DQR A;  3SPY A;  1RT7 A;  4YY3 K;  4BDP A;  2QKB A;  1KVA A;  4CZL A;  1HX1 A;  1NGI A;  1BI4 A;  1YAG A;  2F96 A;  1J53 A;  3L2W A;  4BR5 A;  2YNG A;  1S22 A;  4XH1 A;  5E84 A;  2HHT A;  2ZJP L;  1YHQ N;  2HVI A;  3P31 A;  2G8V A;  3VEX A;  2FF6 A;  1HYV A;  3T69 A;  2EHG A;  1VSL A;  4HUE A;  1S1T A;  2Q1N A;  4CGJ A;  1N34 K;  1RDU A;  2A6A A;  1VQM N;  3TAB A;  3DAW A;  3I8B A;  1ZXO A;  4DTP A;  3OYF A;  4FWM A;  1XHX A;  1GLE G;  4C8L A;  3K5M A;  3VF2 A;  3I0R A;  5FRO A;  4DFM A;  4NYF A;  5CY4 A;  4FJG A;  3WXI A;  5GIP A;  2G8W A;  4PL8 A;  3DI6 A;  3WUH A;  1VHX A;  4KHY A;  3OYK A;  1IKY A;  5AZI B;  4FSV A;  3GBT A;  5FLX O;  3CQ8 A;  4ZTF A;  3VQQ A;  4DQP A;  5AQH A;  2E88 A;  4NCA A;  4M3Y A;  2YHB A;  2ITG A;  4KTZ A;  3U3Y A;  3DXM A;  2HF4 A;  4H5V A;  1K73 O;  1UOC A;  4DTO A;  1KC8 O;  3PSF A;  1M90 O;  4IOC L;  2HOE A;  2UUA K;  3UIQ A;  1FW6 A;  1RBR A;  4BRK A;  1K9M O;  2E6L A;  3E01 A;  4DTJ A;  3R1X A;  1TL3 A;  5AQR A;  3MEE A;  4JRQ A;  1ASU A;  2NRR A;  3PO5 A;  5FRN A;  3OA9 A;  3ID6 A;  3QIP A;  4DR7 K;  4FPB A;  4IXC A;  5FRM A;  3ZLJ A;  2F8T A;  4IOA L;  1J54 A;  2YX6 A;  1YJN N;  3MED A;  1NNE A;  1NGE A;  2O4I A;  2O8E A;  2VG6 A;  1HR0 K;  2D0O A;  3O8M A;  4FXD A;  4BRI A;  5A2Q O;  4OPA A;  2KQ2 A;  3QIN A;  5BN8 A;  4CEF A;  3J81 O;  4YFU A;  4CJS A;  3SK3 A;  4FWK A;  5J2P A;  2GEM A;  4CHZ A;  4Z4E A;  4N76 A;  4BEC A;  2O8C A;  2HVH A;  2ZQB A;  1HPZ A;  1JLB A;  4C23 A;  1ASW A;  2F9T A;  3UKR B;  1RFQ A;  1NK8 A;  3DLK A;  1YIT N;  3VF4 A;  4IFY A;  1DTT A;  4E7K A;  1TKX A;  3SAG A;  3S3N A;  4Z4C A;  3OYN A;  2IOC A;  4DU4 A;  5J2Q A;  4HCB A;  1K6Y A;  4CEC A;  5CHI A;  4YOW A;  1S1V A;  4O8U A;  3OS2 A;  2HMI A;  5C0Y A;  1VQ6 N;  4X66 K;  4FWP A;  1EWQ A;  4Q5V A;  1LAV A;  3B6P A;  1YUW A;  4A5A A;  3AO1 A;  4EZ9 A;  4KI4 A;  1VQL N;  3A2F A;  1VQ7 N;  2W40 A;  1W97 L;  4DQ8 A;  4CK3 A;  4KHU A;  3V9X A;  2GX9 A;  3CQX A;  3D7E O;  3DRR A;  1GLL O;  3QEP A;  5T7B A;  5C12 A;  1TKZ A;  1B9F A;  4QS8 A;  4PY5 A;  4WQ4 A;  4FWO A;  2XY6 A;  1WSJ A;  1VSD A;  2WFB A;  1GOA A;  5J2M A;  1LCU A;  3CCR N;  2YKM A;  3AVM A;  4DFK A;  3CIP A;  1BIU A;  3RVC A;  4DCH A;  2ZD1 A;  3QDK A;  4CFB A;  1IKW A;  2ASM A;  1ATS A;  3NVK A;  4KFB A;  1Z05 A;  3IMX A;  4W5Q A;  4BY9 C;  4BRD A;  3K5N A;  1L5U A;  4DSE A;  2P1J A;  4CF0 A;  2W6K A;  2P9K B;  4DQI A;  4IO8 A;  3O4W A;  1TL1 A;  3ZEU A;  3EO3 A;  3PX4 A;  3CJC A;  3TSQ A;  4CJP A;  4DB3 A;  4CJF A;  4JAX A;  1SV5 A;  2IC3 A;  3DXK A;  4I2P A;  4F9O A;  4JKG B;  4MLH A;  4E3S A;  2WBN A;  3LP3 A;  4Z4F A;  2X78 A;  4O44 A;  4W5N A;  4AHV A;  1XC3 A;  4I9Q A;  1SL1 A;  3QML A;  2BE2 A;  5AQQ A;  1HNI A;  3LDP A;  3FFI A;  3TSP A;  3PUF A;  1TUY A;  3C95 A;  3TR8 A;  4N56 A;  3J8A A;  3ULD A;  4KI6 A;  1RT1 A;  4JK8 A;  3QEX A;  1W2B M;  4JI2 K;  1CLQ A;  3TAN A;  2O8F B;  4NLB A;  2P9S B;  4JI1 K;  3THY A;  1WSF A;  4JD2 B;  3OYA A;  4B1V A;  3VQD A;  4EHU A;  5C42 A;  3QET A;  1KLM A;  4DHY A;  1YIJ N;  3TTD A;  1NGF A;  3SQ1 A;  4FCY A;  2RF2 A;  1TUU A;  3ZCM A;  4JI7 K;  2J4R A;  4LH4 A;  2C1G A;  4ILG B;  3CCQ N;  4OO1 J;  1VSF A;  2X6N A;  2HHH K;  4Y1D A;  1VSI A;  5AQM A;  4NXN K;  3QNN A;  3ULE B;  4BRG A;  1J9A A;  2CGL A;  4AF1 A;  1L3T A;  3MXJ A;  4IFV A;  1ZBH A;  4O5F A;  3NH0 A;  5EVZ A;  3ZX3 A;  3OYJ A;  2YNF A;  3PV8 A;  4M3U A;  3ASM A;  1C0M A;  3OYG A;  4OPH A;  1LW2 A;  2VQE K;  5F0X A;  4DV0 K;  5HL7 L;  4ID1 A;  3U9Z A;  1NK6 A;  1EX4 A;  2HHX A;  1SUQ A;  3CM5 A;  3KK7 A;  1S9E A;  2I7P A;  4JI5 K;  3BF3 A;  3EE9 A;  4FVM A;  3BP8 A;  4LSL A;  3NCI A;  1VQK N;  4AHS A;  2EX3 A;  3ZSZ A;  1NJI O;  4DTS A;  3BZC A;  4YOR A;  2H3G X;  2RKI A;  1BWF O;  4BRE A;  1I94 K;  2Z1G A;  2FLO A;  2QWM A;  4M63 C;  2NLX A;  4DG1 A;  1C0F A;  1UA1 A;  4WQ4 C;  4B08 A;  5BRF A;  3RTV A;  1KVB A;  4C1N K;  3OYH A;  5DMR A;  2G8F A;  3SMP A;  4FVU A;  3VQ8 A;  3EY1 A;  2E8A A;  5BN9 A;  2A3Z A;  4B1W B;  4B3S K;  1N33 K;  4E7J A;  3GOI A;  2F4V K;  2P5G A;  2DPN A;  4B3O A;  5C2D A;  4FWS A;  3THW B;  1SKW A;  4W5O A;  2YHY A;  2A42 A;  4LFA K;  2P9I B;  3F9M A;  3VEV A;  3P4I A;  4DSJ A;  4G1Q A;  4C8K A;  4O0I A;  4PL7 A;  4OKK A;  1DKG D;  1VQN N;  3ZT1 A;  3JYT A;  1RTJ A;  3UE5 A;  4KH6 A;  4CJ7 A;  2KKZ A;  3IRX A;  1ITG A;  3SI6 A;  1GLF O;  2P9U A;  2ZGY A;  4FWQ A;  4KV8 A;  2QW9 A;  2D5R A;  3ALY A;  4YOX A;  2BTF A;  3PX0 A;  2ASP A;  2NRW A;  1HMV A;  3P38 A;  4CJ5 A;  5AQP A;  4Z4G A;  3BUZ B;  1QS4 A;  1YF5 L;  5AQF A;  2KFN A;  2B4J A;  4BC3 A;  1U2V B;  4BVP A;  4CI6 A;  2YHX A;  3SAH A;  3BEX A;  4CHP A;  3CPW M;  3O4Q A;  5JS1 A;  3OBW A;  3SUO A;  4A61 A;  1KAY A;  1HJR A;  4FJM A;  2OPS A;  3AVN A;  4W5T A;  2W6L A;  1UA0 A;  2PAV A;  1DEJ A;  3EKS A;  1M1K O;  5AQY A;  1JLF A;  4YOV A;  1ZBU A;  1VQ8 N;  4BE2 A;  2Q2R A;  4B1X B;  4WFB L;  3CFR A;  1IKX A;  2F7T A;  3PO4 A;  1LAW A;  1D5A A;  5EXW A;  1FXX A;  4NCB A;  4JKE A;  4BQZ A;  4QAG A;  3VGL A;  3H45 C;  3HVT A;  4FJ7 A;  3P1G A;  3V9W A;  4DR6 K;  4DWI A;  2HHV A;  1WNS A;  1S72 N;  2B6A A;  3LP2 A;  4JYA K;  5KQ8 A;  4N5S A;  2P9L B;  3IG1 A;  4CEE A;  5AZI A;  2Y1I A;  3RMC A;  1JCG A;  1Z26 A;  1HQU A;  4B3M K;  3H3N O;  4YOU A;  3R6M A;  3T19 A;  3C65 A;  3HT3 A;  4CGG A;  4CK2 A;  5J1E A;  1HJO A;  2LSN A;  1Q7Y O;  3CYM A;  4JV5 K;  5ADX H;  3LZI A;  2E20 A;  5AQJ A;  3KK3 A;  2FSK A;  2XY7 A;  2Z1H A;  3QFU A;  4U7B A;  3LWM A;  2O8D B;  1VSE A;  3AVI A;  4CJU A;  1S3X A;  1S5J A;  2FXU A;  4NB4 A;  2VYP A;  3FZF A;  1YJW N;  2PYL A;  3A5N C;  5CR4 A;  3TAG A;  4CJW A;  4GVM A;  2HND A;  1T6D A;  4AM7 A;  1CXQ A;  2YHW A;  1RDA A;  1RGI A;  2YI1 A;  5I9E B;  1SZ2 A;  1NM1 A;  4CEA A;  3WNF A;  3BGR A;  5HRN A;  4HTU A;  4FL9 A;  3HBT A;  4LY7 A;  3AA3 A;  3D45 A;  4DLG A;  1U48 A;  2VWJ A;  3VQE A;  3NAE A;  3DOK A;  2PZS A;  3WXJ A;  4KH5 A;  3DLL L;  1S6P A;  3F9K A;  3OYI A;  2HBJ A;  3HPO A;  4K41 A;  5KRT A;  3OS0 A;  3LAK A;  3NGY A;  3J7Z O;  3CI5 A;  3CCU N;  1RTI A;  3O9U A;  4PUO A;  3NH2 A;  1KAX A;  1NK4 A;  4MO5 A;  1OKJ A;  2A5X A;  4FLW A;  4BRC A;  2YHA A;  1HNX K;  4LFB K;  1T03 A;  3VQ7 A;  4FOE A;  3KHY A;  1BGX T;  3SV3 A;  5B8H A;  3SQ2 A;  5TKW A;  5HBM A;  3CCS N;  3ITH A;  2O8B A;  3VEZ A;  3SJJ A;  4E89 A;  4MO4 A;  4ELU A;  3S3M A;  2QWQ A;  1GLC G;  1QQN A;  3OJS A;  2KZM A;  3N4P A;  4ELV A;  1CZA N;  3O3G A;  3R8E A;  1KCF A;  3AA2 A;  1NJY A;  2V7Z A;  4IWV A;  4BC5 A;  4K0K K;  3TAR A;  1O1W A;  1DT9 A;  4AHU A;  3S41 A;  3THX A;  2OPQ A;  1N36 K;  4PKI A;  1KTQ A;  2W41 A;  3OY9 A;  4JN4 A;  2QWL A;  3J80 O;  4DUY K;  3GDQ A;  2E4L A;  1YXQ A;  4GV9 A;  4OLB A;  5K14 A;  3C6A A;  1K8K A;  1WAF A;  4H0Y B;  1BHL A;  3V6D A;  4B1Z A;  4DV3 K;  5M1F A;  3ID8 A;  2YV0 X;  3HYF A;  2P9P B;  1L3S A;  4O5B A;  2GTD A;  2V51 B;  1YI2 N;  3ENH A;  3BDP A;  1EXQ A;  1O13 A;  4GMJ B;  4Z4I A;  4DSI A;  3DJC A;  3SZ2 A;  2KFZ A;  5BPL A;  1HRH A;  1NBW A;  3H6E A;  3Q7B A;  3MX5 A;  2ZGZ A;  4CFC A;  4RW4 A;  1ESV A;  4X62 K;  5HRS A;  4K43 A;  1B92 A;  1TVR A;  3E9L A;  1UWB A;  5FDL A;  3IDH A;  3CQY A;  5CZ1 A;  5CYM A;  3D2F A;  1XNR K;  1QHT A;  4JD2 A;  3TAP A;  3IS9 A;  3HI0 A;  4CZM A;  3VQ5 A;  4KH4 A;  3ZSY A;  3ENB A;  5LJV A;  1ZBF A;  4M3Z A;  3VES A;  3EZW A;  5BRH A;  4Z4H A;  2ZJQ L;  2QXL A;  3O9T A;  3AAR A;  5HRO A;  4FLX A;  4NYN A;  4PA1 A;  3DLR A;  3AVK A;  5HRP A;  5AZJ B;  4IEE A;  3S5T A;  4CFA A;  1W0H A;  5JIC A;  1VRT A;  2B5J A;  1WB9 A;  1WBD A;  4HTL A;  3CCL N;  1TK8 A;  3CXC M;  1NJW A;  1IBL K;  5FPD A;  3S9H A;  5HRR A;  2KTQ A;  3LM2 A;  2FC0 A;  4WQ5 A;  2UYT A;  3V1R A;  1GLB G;  4M7X A;  1TYQ B;  3MN5 A;  4I6M B;  1XMO K;  2V52 B;  2VQF K;  4BC2 A;  3RMD A;  3C7N B;  3I8D A;  3I33 A;  4H0X B;  4CF9 A;  1T8E A;  2E1Z A;  1VSJ A;  4EIA A;  2PBD A;  3SBG A;  3KD5 E;  4HHT A;  3H1Q A;  3O6W A;  1J5E K;  3NBP A;  1S6Q A;  3IKM A;  3E1Y A;  4AIL C;  1T44 A;  1SL2 A;  4FJ5 A;  3HJF A;  3NE6 A;  1NGA A;  4HVJ A;  4DF8 A;  1X9W A;  2NRH A;  3KVG A;  1EET A;  1RT2 A;  3SV4 A;  4GKK K;  1FKP A;  4J2D A;  3ZET B;  5EX5 A;  1NJX A;  4UY8 O;  1WUA A;  3HXM A;  3JS6 A;  5ADX A;  4M3X A;  4AHC A;  4RCH A;  4FK4 A;  4DR4 K;  4FM2 A;  1RT6 A;  2KZZ A;  5AQU A;  2NNW A;  1HUX A;  5GIO A;  3EKU A;  3WEE A;  2GWK A;  3UKU B;  3EZ5 A;  1Z6R A;  1DGK N;  3C0B A;  3M3Z A;  3RSE A;  3VGK A;  4EAH D;  1U47 A;  4FJJ A;  3A8Y A;  3Q7C A;  1XQS C;  3J7A P;  2RE2 A;  4E0D A;  4BC4 A;  1JXB A;  4JKH A;  2P9N A;  1NK9 A;  3P39 A;  4E7H A;  1QVG M;  3LZJ A;  4DSK A;  1HNW K;  1HKC A;  4E7L A;  4YNQ A;  1RDW X;  4DS4 A;  3VTI A;  3FZM A;  3TU5 A;  2VWB A;  4BG9 A;  4E19 A;  3O3F A;  4BVO A;  3D0P A;  4K8Z A;  2RN2 A;  5AQI A;  2OPP A;  4JS4 A;  3CER A;  4GV6 A;  1R0A A;  5KGW A;  4FLT A;  1KQS M;  1I39 A;  1X1P A;  1OH5 A;  2YJF A;  3O1B A;  2YCH A;  1N8R O;  4O4G A;  2GV9 A;  4KTQ A;  3JSM A;  3QEW A;  2A1R A;  2IVN A;  1LW0 A;  4BE1 A;  1RCH A;  2FBT A;  2VWK A;  1VSM A;  1OH6 A;  3OBY A;  4CBX A;  4RTF D;  3WXL A;  3OYL A;  1X9M A;  1MA9 B;  4I9L A;  4FJ9 A;  3ZSQ A;  1UAX A;  3SLC A;  3L4Q A;  1Q18 A;  2IIR A;  3HSC A;  1QQC A;  3V9Z A;  1Q81 O;  4RW9 A;  3CC2 N;  1T6C A;  2ETJ A;  3CMA N;  4N47 A;  1CXU A;  4YDU A;  3TAM A;  2Z1J A;  5C25 A;  4H8K A;  2UXB K;  1RTH A;  3O5B A;  4OLA A;  4NCG A;  3CET A;  3FLC O;  2FF3 B;  4FK0 A;  1GOB A;  2ZJR L;  2QKK A;  3HL8 A;  4I2Q A;  3QIC A;  1Q8I A;  3H1V X;  3C6T A;  3DLB A;  4WQ5 C;  4BRM A;  4HUF A;  5AJ3 K;  4DR5 K;  3ZT2 A;  3OJU A;  3AGR A;  4BRN A;  2QWP A;  2HMP A;  3RRH A;  3HP6 A;  4UQG A;  3NGZ A;  4LF9 K;  4CES A;  4BEB A;  3U6F A;  3E9O A;  1NGB A;  1IV0 A;  3RR7 A;  2UXC K;  3OYE A;  4C8M A;  3CF5 L;  2HHW A;  2NZT A;  3V4I A;  1KFD A;  3K2P A;  4IKF A;  4DF4 A;  2QXF A;  5TKY A;  2DFE A;  4M3W A;  3ZT4 A;  4OVL A;  5C2F A;  1C1C A;  3HO1 A;  2ZF5 O;  3CYG A;  4JK7 A;  1S9G A;  5KRS A;  3KWG A;  2HHU A;  5SZT A;  4ZHR A;  3CC4 N;  1Y64 A;  4LF4 K;  5HOO A;  1T7P A;  3NF7 A;  4B9L A;  4JS5 A;  3FGU A;  5I42 A;  3NF9 A;  2O8D A;  3OYC A;  3C6H A;  3A5L C;  4IJN A;  1KAZ A;  2Q0R A;  3AV9 A;  2FSJ A;  4XH5 A;  3ZSX A;  4FO0 A;  3DOL A;  3M8S A;  1NU0 A;  3QLH A;  1BCM A;  1MWM A;  4CEO A;  1D9D A;  5GAD P;  3AAP A;  4R79 A;  3G10 A;  4CE9 A;  2OCE A;  4FJN A;  3N4Q A;  2IDO A;  4B9S A;  5FPE A;  1XWL A;  1KXP A;  3DRP A;  3DXM B;  3SYZ A;  1JJ2 M;  2CGJ A;  3ENO A;  4M7Y A;  4ISF A;  5IWA K;  2D1K A;  4WFN L;  4JKF A;  1RBT A;  3MEG A;  3V9S A;  4BR4 A;  4BGB A;  3TAF A;  2UUC K;  4F8R A;  3LAM A;  5HP1 A;  1YJ9 N;  4H5W A;  3KJV A;  4H0V B;  1GLJ O;  3LP1 A;  5C24 A;  3IFR A;  5KPT A;  4BRF A;  4WFA L;  3NF8 A;  2IGI A;  4IDH A;  2FSN A;  2QM1 A;  3ZSO A;  3MAQ A;  2PYJ A;  3HTV A;  4JHD A;  2DFH A;  4CBW A;  1FK9 A;  1BA0 A;  3VOV A;  1WLJ A;  3AAQ A;  1QZ5 A;  3O08 A;  2VG5 A;  4B8C A;  4E1J A;  3NH1 A;  5AQL A;  4CGI A;  1RTD A;  2O8C B;  4EZ6 A;  1WSE A;  3ZX2 A;  3AVA A;  4FJI A;  1TV6 A;  2Q0U A;  1OH7 A;  2ATQ A;  1L3V A;  3MK6 A;  2V7Y A;  3T7Z A;  3QER A;  4F3T A;  3AO3 A;  2D0C A;  4FW2 A;  4H4M A;  4BRH A;  1QVF M;  1VRU A;  2XY5 A;  2D0P A;  2X6S A;  4AHT A;  3RMB A;  1QSL A;  2OZM A;  3AGK A;  4QCL A;  4YDU C;  1Q9Y A;  1WSH A;  2F8S A;  5DK5 A;  1A5V A;  3LP0 A;  3VQ6 A;  1XI1 A;  1S1W A;  4CGH A;  3A5M C;  3CFP A;  3V81 A;  2OTJ N;  1QZ6 A;  3AVH A;  3M8P A;  5M1Q A;  3SPZ A;  1XNQ K;  1T3V A;  5HLF A;  4OPJ A;  3DMJ A;  3MDQ A;  1YTA A;  4NLC A;  4BRP A;  3L2Q A;  4U67 L;  3PSI A;  5BPM A;  1U4B A;  4FPA A;  3B8A X;  4ILH A;  3OYD A;  2UUB K;  4KB0 A;  4KHP K;  4IG0 A;  1HYZ A;  1BOT O;  1TKT A;  2GUI A;  4B9T A;  1W9H A;  4KPY A;  1VSK A;  3I55 N;  4BG8 A;  4CEQ A;  4JI8 K;  1NLV A;  3HPH A;  3A5O C;  4FWR A;  1HNV A;  4DFJ A;  3RMA A;  2QWN A;  4KO0 A;  4CF8 A;  1LV5 A;  1Y97 A;  2FBV A;  2HBL A;  4IFE A;  1NJZ A;  4JKC A;  4IDK A;  4BR7 A;  4DR3 K;  4DQQ A;  4FJX A;  2E2Q A;  2AP1 A;  4OKJ A;  3AO4 A;  4FJH A;  1ASV A;  3S3O A;  3CJA A;  3KLE A;  4DFP A;  3L3U A;  5AQW A;  1JCE A;  4Z0U A;  5EOY A;  1JLE A;  1D8Y A;  4EP4 A;  3KLF A;  4GY2 B;  3ZEU B;  2XHB A;  5GIN A;  4RWT A;  1XUP O;  3KD1 E;  4BGA A;  3DXK B;  3L2R A;  3NGI A;  5I3U A;  4CZI A;  3LAL A;  1WN7 A;  4HCC A;  2E2N A;  2HNZ A;  3F2K A;  5LL6 Z;  3VEW A;  1TAQ A;  4FW1 A;  4CJL A;  3NVM A;  4DTM A;  3TAQ A;  2QWO A;  1QSS A;  1KD1 O;  4KHS A;  4MDA A;  2WTU A;  4JKB A;  4FZX C;  2IVO A;  4PQU A;  4AM6 A;  4H0O A;  4EHT A;  5M1O A;  4ZTJ A;  1RT4 A;  5DM6 L;  5CYQ A;  2CGK A;  3M8Q A;  2WC9 A;  3H46 O;  4ICL A;  1WBB A;  4B9V A;  1TYQ A;  3THY B;  1Q9X A;  1FKO A;  4DR2 K;  4O8K A;  2QA4 N;  4BRQ A;  2HHQ A;  3CC7 N;  3KLH A;  4RW7 A;  3M1F A;  1N32 K;  5JVH L;  4E1N A;  1RBS A;  1KVC A;  4BE7 B;  4FYD A;  4BE0 A;  1RNH A;  1QQO A;  4MLE A;  1IO2 A;  1JL1 A;  4PKH A;  1K8A O;  3LPT A;  5C15 A;  4F4K A;  1F21 A;  4CGD A;  4KHQ A;  5AQS A;  4WE1 A;  1X3N A;  3M6G A;  3VER A;  3VTH A;  3ZSV A;  3FZH A;  2E6M A;  3L2U A;  3K5L A;  3OW2 M;  2O4G A;  1VSH A;  4NO7 A;  3UKR A;  4CZE A;  1ZBS A;  4YOT A;  1R59 O;  4DUZ K;  3L0Q A;  2JGU A;  4JRP A;  2FBY A;  3AVJ A;  3K9K A;  4K8X A;  3VPZ A;  5AQZ A;  1D4X A;  1N6Q A;  3O1W A;  1E4F T;  3NHG A;  4OX9 K;  4O55 A;  3G4S N;  1EKE A;  3EYZ A;  1BIZ A;  5CE3 A;  1OH8 A;  3KK1 A;  3EL2 A;  4YHH K;  1W7A A;  1BO5 O;  4CW7 B;  3E9P A;  1HLU A;  2W42 A;  1YT3 A;  3QEV A;  2IS3 A;  4DS5 A;  4L8R B;  2GWJ A;  3VQ9 A;  1BIS A;  1HQE A;  1IBM K;  1VQ5 N;  4PHT X;  3F73 A;  4CFD A;  3AY9 A;  2VCP A;  3CJ1 A;  2UU9 K;  1MWK A;  1HPM A;  4CIG A;  1BL3 A;  2QI2 A;  4KHN A;  2ZE2 A;  5KGX A;  3CG7 A;  1U49 A;  5BR8 K;  4DV2 K;  4KRE A;  3KLG A;  3LDN A;  4CF1 A;  5JMV A;  4LF7 K;  2E5L K;  3L3V A;  3QO9 A;  5KPR A;  3RWU A;  5ELZ A;  4RW6 A;  1S1U A;  3QES A;  3L8B A;  2UXD K;  1NOZ A;  2E2P A;  3O9R A;  5GAE P;  3NDK A;  1P8Z A;  4J2A A;  1CZ9 A;  3IAY A;  3MN7 A;  2P9K A;  3LDS A;  1JKH A;  3HST B;  2HHS A;  4IOX A;  3B6O A;  1OVY A;  1SS6 A;  3A0I X;  4BAC A;  2OZS A;  1NK7 A;  4JNE A;  5SWM A;  2YNH A;  2QK9 A;  1EQY A;  4TSX A;  3HM9 A;  4K25 A;  1JL2 A;  3CCJ N;  5D3G A;  4JKG A;  4G9Z A;  4BRO A;  2XO7 A;  1QTM A;  3SNN A;  3OYM A;  4X64 K;  1IH7 A;  4CJK A;  2HF3 A;  3BZK A;  1CZB A;  1WSI A;  4QOZ B;  1X9J A;  1U04 A;  3HM8 A;  4GW6 A;  4J8F A;  3SUN A;  4M45 A;  3U4L A;  1HKB A;  3D2E B;  3CJ7 A;  3FR0 A;  3VQB A;  2Y1J A;  5AQT A;  3ZYY X;  2O8F A;  3JAM O;  2P9S A;  4CBU A;  5EY4 A;  4EP5 A;  1JLQ A;  2HST A;  3LM9 A;  5GAG P;  5BRE A;  1VQP N;  2NRZ A;  2RPI A;  3TAE A;  3U3G A;  5F2R A;  5KI6 A;  1MDU B;  1P90 A;  4CEB A;  4FWN A;  2CH5 A;  3G71 N;  2OAN A;  2D4W A;  1C1B A;  3ZSR A;  4ELT A;  1ZBL A;  3ULE A;  4RW8 A;  3G6E N;  1HNZ K;  4XJX A;  3CCE N;  3MX2 A;  3WQT A;  1JCF A;  2BAN A;  2Q31 A;  5J2N A;  3DRS A;  2NRT A;  1VQ4 N;  3AA5 X;  4E72 A;  3AVL A;  1G99 A;  4O0J A;  1KFS A;  1BA1 A;  4LF8 K;  3CCM N;  2P51 A;  1E3M A;  4DV7 K;  3MWT A;  3I0S A;  3PLA A;  1MU2 A;  1SL0 A;  2JWK A;  3QBX A;  3E66 A;  2OTL N;  3C6U A;  4B8A B;  4DV6 K;  1SQK A;  3MMV A;  4WYB A;  3KTQ A;  5AQV A;  3MCA B;  1NKB A;  2BGG A;  1LOT B;  1L3U A;  1VQO N;  1DTQ A;  3HK2 A;  3CJ9 A;  2GUP A;  3NFA A;  3SJH A;  4DTX A;  2G8I A;  1XMQ K;  2X74 A;  1RBU A;  2WOM A;  3LDO A;  3QBW A;  3AVB A;  5FPN A;  5M1K A;  5AQG A;  4K42 A;  4DU1 A;  4CJQ A;  4F3O A;  2PFU A;  3DLG A;  4LD0 A;  3LWL A;  5MLC Q;  3FFK B;  2G8K A;  4B9Q A;  1NGJ A;  5DM7 L;  4MQ3 A;  3ISN C;  1H1V A;  1DLO A;  1JXE A;  4DQS A;  3RRG A;  3KLI A;  5F1X A;  4FM1 A;  3SQ0 A;  3ATU A;  4B1Y B;  4GVE A;  4C8N A;  3THW A;  4OGE A;  2W00 A;  2P9I A;  4J2B A;  1IBK K;  4LH5 A;  4NXM K;  1TK0 A;  4JKD A;  3K5O A;  1A5W A;  1ATR A;  4QS7 A;  1WSG A;  5AR0 A;  1T05 A;  2EWS A;  1QQM A;  1V4S A;  4CJV A;  4GNI A;  3D6R A;  4FOI A;  4N41 A;  2NRV A;  1RDD A;  3THV A;  3CM6 A;  1HYS A;  3VEN A;  4XH4 A;  1RT3 A;  2O8B B;  5CZ2 A;  2JLE A;  4CCH A;  3L2V A;  1VQ9 N;  5LMN K;  2G8H A;  4Z94 A;  3TWH A;  1U2V A;  1LWF A;  4FLZ A;  5AFU H;  1N5Y A;  2KW4 A;  4M3R A;  4X65 K;  3TTF A;  4DV4 K;  4JEP A;  3U9D A;  4FJK A;  2HB5 A;  1C0G A;  3CFO A;  4FZY A;  1JLC A;  2NUB A;  2XY8 A;  3VN5 A;  4B9M A;  4DSL A;  3THX B;  1GLA G;  5KQD A;  1JLG A;  3P5J A;  3WNE A;  4B3T K;  3KK2 A;  1KRP A;  3MN9 A;  4KB1 A;  3H08 A;  4FJL A;  4CHY A;  5BRD A;  3RR8 A;  3PIO L;  2RHK A;  1K8K B;  3K9J A;  2HBK A;  3VEO A;  4W5R A;  3VGM A;  3QIO A;  3MXM A;  4FM0 A;  4OKE A;  4I7F A;  4DTU A;  1BI4 B;  4M3T A;  4MDB A;  4A59 A;  4KTW A;  5KTQ A;  4BR2 A;  3R9P A;  5AQX A;  3OTO K;  4KKO A;  2DY4 A;  2P5O A;  3WT0 A;  1BUP A;  4IZ9 A;  4BDY A;  4KHW A;  4PKG A;  3MEC A;  2YNI A;  3O9Q A;  1KLN A;  3NMU A;  2HBM A;  2P9L A;  1WAJ A;  1OVQ A;  3KIO A;  3TI0 A;  1NGG A;  1FJG K;  3U8X A;  4LF5 K;  2YJE A;  3SQ4 A;  4BR0 A;  1NKC A;  5AQK A;  1BQN A;  4CJ4 A;  3GL1 A;  4AH9 A;  1V4T A;  3D2F B;  4HWI A;  2DFF A;  1IG9 A;  1RDC A;  3VEY A;  4E7I A;  3K59 A;  1REV A;  2CH6 A;  4A62 A;  3AVC A;  1XHZ A;  3K58 A;  1U6Z A;  1BG3 A;  3H3O B;  4FK2 A;  2JWL A;  3MN6 A;  4MFB A;  5GAH P;  3AO5 A;  5H1S Q;  1S1X A;  1NOY A;  2GEL A;  3FZL A;  4OJR A;  2YKN A;  4F2R A;  4CIE A;  1VAZ A;  3L4I A;  4AQY K;  1SKS A;  4H5N A;  3VQP A;  3HP9 A;  3OYB A;  1ZYQ A;  1C0T A;  4ILJ A;  3V1Q A;  3QNO A;  3CHW A;  2I7N A;  2D0B A;  1NWK A;  2I5J A;  4CD1 A;  3LL3 A;  4H0P A;  2WUS A;  3MXI A;  1A5X A;  1NGD A;  3IUC A;  1G15 A;  4JKA A;  3TSU A;  3ZT3 A;  2OA8 A;  4M42 A;  3T1A A;  3AVG A;  2D0A A;  2O8E B;  4F2S A;  1NGH A;  5IT9 O;  4CEZ A;  4IBN A;  3SUQ A;  4CJ3 A;  3VET A;  2HW3 A;  3OVN A;  1RIL A;  5JLH A;  2A1S A;  2Z1I A;  1E4G T;  3WXK A;  3G0Z A;  5EU7 A;  5LJW A;  3O9S A;  4CJR A;  2XRI A;  3V9U A;  1WOQ A;  1B9D A;  3NF6 A;  3EE8 A;  5JEN A;  2ZWH A;  2KHO A;  3OHR A;  4DTN A;  2HNY A;  4H5T A;  4H4O A;  2DTU A;  1Q82 O;  3WXM B;  3J7Y P;  3SBT A;  3QB0 A;  4EFH A;  3R3L A;  1HKG A;  3VMF B;  4BQL A;  1QSY A;  3HZ6 A;  4LFC K;  3WEE B;  1J5O A;  1I3A A;  4B3R K;  1BQM A;  4ID5 A;  3RSE B;  3T1H K;  5AQN A;  4BR9 A;  2AA4 A;  5AQO A;  1ZC6 A;  4FLV A;  4CVN E;  4DV5 K;  4LSN A;  4H0T B;  3K57 A;  2Q36 A;  1NMN A; 
#chains in the Genus database with same CATH homology
 1Q86 O;  3OW2 M;  3JXU A;  3EO3 A;  2KLA A;  3CJC A;  3DWL A;  4NO7 A;  3TSQ A;  3UKR A;  1ZBS A;  4YOT A;  4CZE A;  1R59 O;  4DB3 A;  5AZJ B;  2F9W A;  4IEE A;  2P9N B;  3L0Q A;  4JAX A;  5JIC A;  3DXK A;  4F9O A;  4HTL A;  1ATN A;  3CCL N;  3LDQ A;  3K9K A;  3CXC M;  5FPD A;  3VPZ A;  5AQZ A;  1D4X A;  4JKG B;  3TTC A;  4MLH A;  3LDL A;  3LM2 A;  3O1W A;  4WQ5 A;  2WBN A;  2UYT A;  1E4F T;  1BU6 O;  1GLB G;  4M7X A;  1TYQ B;  3MN5 A;  4I6M B;  1XC3 A;  4L3Q A;  4A57 A;  3G4S N;  3QML A;  2V52 B;  2ASO A;  4BC2 A;  3C7N B;  5CE3 A;  3I33 A;  3EL2 A;  5AQQ A;  3LDP A;  1BO5 O;  4H0X B;  2P9P A;  2E1Z A;  3E9P A;  1HLU A;  3CD6 N;  1EO1 A;  3TSP A;  4EIA A;  2PBD A;  3SBG A;  3L6Q A;  2ITM A;  1TUY A;  3H1Q A;  3O6W A;  4A2B A;  3J8A A;  4IEI A;  2GWJ A;  3IKM A;  3E1Y A;  4C1N I;  4JK8 A;  1T44 A;  1W2B M;  1VQ5 N;  4PHT X;  1NGA A;  4NLB A;  2P9S B;  3AY9 A;  4JD2 B;  4B1V A;  4EHU A;  2VCP A;  3CJ1 A;  1MWK A;  2NRH A;  3GE1 A;  4DHY A;  1HPM A;  3CPE A;  3KVG A;  4KBO A;  3TTD A;  1NGF A;  1YIJ N;  1YVN A;  5BPN A;  2QI2 A;  3ATV A;  3ZET B;  5EX5 A;  4UY8 O;  1TUU A;  2Q97 A;  1WUA A;  3UB5 A;  4WF9 L;  2J4R A;  3LDN A;  3D2E A;  3JS6 A;  5ADX A;  4RCH A;  5JMV A;  2C1G A;  4ILG B;  3CCQ N;  4OO1 J;  5KPR A;  5AQU A;  2NNW A;  1HUX A;  5GIO A;  3EKU A;  5AQM A;  3MWP A;  3WEE A;  5ELZ A;  2GWK A;  3UKU B;  3ULE B;  4BRG A;  2CGL A;  1Z6R A;  1DGK N;  3C0B A;  2E2P A;  3M3Z A;  3RSE A;  3VGK A;  3O9R A;  4AF1 A;  4BRA A;  1P8Z A;  5GAE P;  5AFU A;  2BUP A;  4O5F A;  3MN7 A;  5EVZ A;  2P9K A;  3ZX3 A;  4H03 B;  3A8Y A;  3Q7C A;  1XQS C;  3QFP A;  4IOX A;  1OVY A;  4OPH A;  1SS6 A;  3A0I X;  2RE2 A;  5M1P A;  4BC4 A;  4GV3 A;  3O80 A;  5M1N A;  4JNE A;  5AZJ A;  3I56 N;  3CCV N;  4JKH A;  2P9N A;  1EQY A;  5F0X A;  3P39 A;  5HL7 L;  3U9Z A;  4A5B A;  1QVG M;  4K25 A;  5KPZ A;  4CZJ A;  3CCJ N;  1HKC A;  3KK7 A;  2I7P A;  4JKG A;  3BF3 A;  1RDW X;  3EE9 A;  3SMS A;  4BRO A;  3VTI A;  4G9Z A;  2A41 A;  3W3D A;  3FZM A;  3TU5 A;  3BP8 A;  2VWB A;  4BG9 A;  4I6M A;  4LC9 B;  1VQK N;  5FPM A;  1QHA A;  2IVP A;  2HF3 A;  3C7N A;  4XEI A;  4BVO A;  3GG4 A;  1NJI O;  5AQI A;  3KZB A;  4YOR A;  1X9J A;  3CER A;  4GV6 A;  3HM8 A;  2H3G X;  1BWF O;  4BRE A;  1KQS M;  4J8F A;  5E26 A;  2YJF A;  1GLD G;  2FLO A;  2QWR A;  2NLX A;  2YCH A;  1C0F A;  1HKB A;  1SAZ A;  2QWM A;  3O1B A;  3D2E B;  4M63 C;  4WQ4 C;  3U4L A;  4ISG A;  5BRF A;  1N8R O;  1IG8 A;  3CJ7 A;  3FR0 A;  2IVN A;  5AQT A;  3ZYY X;  3FZK A;  4C1N K;  5JLF A;  2P9S A;  3OBY A;  4BRL A;  1NMD A;  4CBX A;  4RTF D;  3WXL A;  1MA9 B;  3SMP A;  5EY4 A;  4CBU A;  3SAF A;  4FVU A;  3VF6 A;  2HST A;  3LM9 A;  3SLC A;  1IJJ A;  3L4Q A;  5GAG P;  1Q18 A;  2IIR A;  4IJA A;  3HSC A;  4B1U B;  2E8A A;  5BRE A;  3ZET A;  1VQP N;  5BN9 A;  4QS9 A;  2NRZ A;  1Q81 O;  2A3Z A;  4B1W B;  4Y0W A;  3GOI A;  3CC2 N;  2BH1 A;  2DPN A;  1T6C A;  3CMA N;  5F2R A;  3TPQ A;  2VGN A;  1MDU B;  1P90 A;  3BF1 A;  4YDU A;  5C2D A;  4FWS A;  4FWN A;  2CH5 A;  3G71 N;  2OAN A;  2D4W A;  3CJB A;  4CZH A;  2YHY A;  2A42 A;  2P9I B;  3F9M A;  3VEV A;  3P4I A;  3UKU A;  3O5B A;  3ULE A;  3CET A;  3FLC O;  3G6E N;  3HRG A;  4PL7 A;  4XJX A;  2FF3 B;  3CCE N;  3MX2 A;  2ZJR L;  3WQT A;  3CME N;  1JCF A;  1DKG D;  5JVG L;  2Q31 A;  3QIC A;  3H1V X;  1VQN N;  2A40 A;  2NRT A;  3UE5 A;  4WQ5 C;  4BRM A;  1VQ4 N;  4KH6 A;  3KWI A;  4CZK A;  4CJ7 A;  2KKZ A;  1G99 A;  1BA1 A;  3CCM N;  2E1Y A;  1BDG A;  3AGR A;  1GLF O;  2P9U A;  4BRN A;  2QWP A;  2ZGY A;  2HMP A;  4FWQ A;  4DKW A;  2C1I A;  2QW9 A;  4YOY A;  4YOX A;  3M5R A;  2BTF A;  3MWT A;  2ASP A;  4BEB A;  2NRX A;  2NRW A;  2VGM A;  3P38 A;  4CZF A;  3PLA A;  2JWK A;  3QBX A;  3E9O A;  1NGB A;  4A2A A;  4JHD B;  3E66 A;  5AQP A;  2OTL N;  3BUZ B;  3F5T A;  1YF5 L;  5AQF A;  3CF5 L;  2NZT A;  3PIP L;  1SQK A;  4BC3 A;  3MMV A;  4WYB A;  3G25 A;  5AQV A;  1U2V B;  3MCA B;  4BVP A;  4H5R A;  4CI6 A;  4JK9 A;  5TKY A;  5C10 A;  2YHX A;  3SAH A;  3BEX A;  3CPW M;  3HOT A;  1NGC A;  3OBW A;  1LOT B;  4A61 A;  5C2F A;  1J6Z A;  1X3M A;  2ZF5 O;  1KAY A;  1VQO N;  4JK7 A;  5BR9 A;  3CJ9 A;  3KWG A;  2GUP A;  2E2O A;  3SJH A;  4CZG A;  2PAV A;  3CC4 N;  1Y64 A;  1DEJ A;  3EKS A;  3MCP A;  5HOO A;  1M1K O;  5AQY A;  2QEX N;  3W0L A;  3WQU A;  4YOV A;  3FGU A;  5LY3 A;  3LDO A;  2QTD A;  1VQ8 N;  1ILY A;  3QBW A;  5FPN A;  3C6H A;  2Q2R A;  3A5L C;  4IJN A;  1KAZ A;  4CD3 A;  2Q0R A;  5M1K A;  5AQG A;  4K42 A;  2FSJ A;  4XH5 A;  4IO9 L;  2PFU A;  4B1X B;  4FO0 A;  4WFB L;  4ISE A;  5MLC Q;  2F7T A;  3FFK B;  5EXW A;  4B9Q A;  1NGJ A;  1MWM A;  5DM7 L;  5GAD P;  4JKE A;  4BQZ A;  3VGL A;  4FWL A;  3AAP A;  1H1V A;  3H45 C;  4R79 A;  3HOS A;  3ZX0 A;  5F1X A;  3FE1 A;  3N4Q A;  3ATU A;  5FPE A;  4B1Y B;  4GVE A;  1KXP A;  3EN9 A;  1S72 N;  3DXM B;  2P9U B;  2W00 A;  2P9I A;  1JJ2 M;  2CGJ A;  4WCE L;  5KQ8 A;  3ENO A;  4M7Y A;  4ISF A;  4JKD A;  2P9L B;  2D1K A;  5AZI A;  1ATR A;  4QS7 A;  1JCG A;  4WFN L;  3H3N O;  4JKF A;  4YOU A;  4CZL A;  1HX1 A;  4BR4 A;  3R6M A;  4BGB A;  5AR0 A;  3C65 A;  2EWS A;  1NGI A;  1QQM A;  1V4S A;  1YAG A;  4GNI A;  1YJ9 N;  3D6R A;  4FOI A;  2NRV A;  4H5W A;  1HJO A;  4BR5 A;  1Q7Y O;  1S22 A;  4H0V B;  4XH1 A;  5E84 A;  1GLJ O;  2ZJP L;  1YHQ N;  3IFR A;  4XH4 A;  3VEN A;  5KPT A;  5ADX H;  4BRF A;  3P31 A;  4WFA L;  4IDH A;  2E20 A;  2FSN A;  2QM1 A;  5AQJ A;  3VEX A;  2FF6 A;  2FSK A;  3T69 A;  1VQ9 N;  3HTV A;  3QFU A;  4JHD A;  4U7B A;  2Q1N A;  4CBW A;  4Z94 A;  1BA0 A;  3VOV A;  3AAQ A;  1U2V A;  1RDU A;  1QZ5 A;  1S3X A;  2A6A A;  3O08 A;  2FXU A;  4NB4 A;  5AFU H;  4E1J A;  1VQM N;  5AQL A;  2VYP A;  3DAW A;  3FZF A;  3TTF A;  1YJW N;  3I8B A;  4JEP A;  3U9D A;  1ZXO A;  1C0G A;  3A5N C;  5CR4 A;  3ZX2 A;  4FWM A;  1GLA G;  1GLE G;  5KQD A;  1T6D A;  4AM7 A;  3VF2 A;  2Q0U A;  2YHW A;  1RGI A;  2YI1 A;  5I9E B;  1SZ2 A;  1NM1 A;  3MK6 A;  2V7Y A;  3MN9 A;  3WXI A;  5GIP A;  3T7Z A;  4FL9 A;  3HBT A;  4BRH A;  1QVF M;  4PL8 A;  5BRD A;  2D0P A;  3AGK A;  4YDU C;  3WUH A;  3PIO L;  2RHK A;  1K8K B;  5AZI B;  4KH5 A;  3K9J A;  2HBK A;  4FSV A;  3VEO A;  3WXJ A;  3DLL L;  3GBT A;  3VGM A;  3A5M C;  2OTJ N;  4MDB A;  1QZ6 A;  5M1Q A;  2HBJ A;  4A59 A;  5AQH A;  2E88 A;  4K41 A;  1T3V A;  4BR2 A;  3J7Z O;  3R9P A;  5AQX A;  3MDQ A;  3DXM A;  2HF4 A;  4H5V A;  4NLC A;  3CI5 A;  3WT0 A;  4BRP A;  1BUP A;  4U67 L;  3CCU N;  4IZ9 A;  1K73 O;  3O9U A;  4PKG A;  1KC8 O;  5BPM A;  1M90 O;  4IOC L;  3O9Q A;  2HOE A;  4FPA A;  3NMU A;  2HBM A;  2P9L A;  3B8A X;  4ILH A;  1KAX A;  4BRK A;  1K9M O;  4MO5 A;  1OKJ A;  1BOT O;  2A5X A;  3R1X A;  4BRC A;  5AQR A;  1NGG A;  2NRR A;  3I55 N;  4BG8 A;  3OA9 A;  3U8X A;  3ID6 A;  1NLV A;  4FOE A;  3KHY A;  4FPB A;  4IXC A;  2YJE A;  5B8H A;  4IOA L;  2YX6 A;  1YJN N;  5TKW A;  3A5O C;  4FWR A;  4BR0 A;  1NGE A;  3CCS N;  3VEZ A;  2QWN A;  5AQK A;  3GL1 A;  2D0O A;  4MO4 A;  3O8M A;  2HBL A;  4BRI A;  2QWQ A;  1GLC G;  1QQN A;  1V4T A;  3D2F B;  4IFE A;  4HWI A;  4OPA A;  4JKC A;  3N4P A;  4BR7 A;  5BN8 A;  2E2Q A;  1CZA N;  2AP1 A;  3SK3 A;  3VEY A;  4FWK A;  3R8E A;  2CH6 A;  4A62 A;  3CJA A;  1U6Z A;  2GEM A;  2V7Z A;  5AQW A;  1BG3 A;  1JCE A;  4IWV A;  3H3O B;  4BC5 A;  2JWL A;  3MN6 A;  5EOY A;  4BEC A;  1DT9 A;  3S41 A;  5GAH P;  4GY2 B;  3ZEU B;  4C23 A;  4PKI A;  5GIN A;  5H1S Q;  2GEL A;  2F9T A;  2W41 A;  1RFQ A;  3FZL A;  3UKR B;  4RWT A;  4JN4 A;  2QWL A;  1XUP O;  1YIT N;  3VF4 A;  3GDQ A;  4BGA A;  1YXQ A;  3DXK B;  4GV9 A;  4CZI A;  3SAG A;  1VAZ A;  3L4I A;  3C6A A;  2E2N A;  1K8K A;  4H5N A;  4H0Y B;  3F2K A;  4B1Z A;  3VEW A;  5CHI A;  5M1F A;  4YOW A;  3ID8 A;  5C0Y A;  4O8U A;  4ILJ A;  3NVM A;  1VQ6 N;  4FWP A;  3CHW A;  2I7N A;  1NWK A;  4CD1 A;  2QWO A;  3LL3 A;  4H0P A;  1YUW A;  2P9P B;  2WUS A;  1KD1 O;  2GTD A;  4MDA A;  2V51 B;  4EAH D;  1NGD A;  3IUC A;  4JKA A;  4JKB A;  3TSU A;  4A5A A;  4IO8 A;  3ENH A;  1YI2 N;  2IVO A;  4AM6 A;  4H0O A;  1VQL N;  1O13 A;  4EHT A;  5M1O A;  1VQ7 N;  1NGH A;  2W40 A;  5DM6 L;  3DJC A;  5BPL A;  2CGK A;  1W97 L;  2WC9 A;  1NBW A;  3VET A;  4DQ8 A;  3H46 O;  3H6E A;  3Q7B A;  1TYQ A;  2GX9 A;  5JLH A;  3CQX A;  3D7E O;  4O8K A;  1E4G T;  3WXK A;  1GLL O;  3MX5 A;  2QA4 N;  5LJW A;  5C12 A;  3O9S A;  4BRQ A;  4QS8 A;  2ZGZ A;  4WQ4 A;  4FWO A;  1ESV A;  1WOQ A;  3EE8 A;  3CC7 N;  4K43 A;  2ZWH A;  2KHO A;  3OHR A;  3M1F A;  2WFB A;  3E9L A;  4H5T A;  1LCU A;  3CCR N;  3IDH A;  5JVH L;  3CQY A;  1Q82 O;  3WXM B;  3SBT A;  3D2F A;  4BE7 B;  3CIP A;  3QB0 A;  4EFH A;  3RVC A;  1QQO A;  1HKG A;  3R3L A;  4MLE A;  3VMF B;  4BQL A;  4DCH A;  3HZ6 A;  4JD2 A;  3QDK A;  2ASM A;  3WEE B;  1ATS A;  3HI0 A;  4CZM A;  3NVK A;  1Z05 A;  3IMX A;  4PKH A;  1K8A O;  4KH4 A;  5C15 A;  5LJV A;  3ENB A;  3RSE B;  5AQN A;  3VES A;  3EZW A;  5BRH A;  4BRD A;  4BY9 C;  4BR9 A;  2ZJQ L;  2AA4 A;  5AQO A;  1ZC6 A;  2QXL A;  5AQS A;  1X3N A;  3M6G A;  3O9T A;  2P9K B;  3VER A;  3VTH A;  3AAR A;  4H0T B;  3O4W A;  3FZH A;  2Q36 A;  3ZEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...