3CHWA

Complex of dictyostelium discoideum actin with profilin and the last poly-pro of human vasp
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
371
structure length
360
Chain Sequence
VQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHDSYVGDEAQSKRGILTLKYPIEGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEAEMQTAASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modulation of actin structure and function by phosphorylation of Tyr-53 and profilin binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Major actin
total genus 117
structure length 360
sequence length 371
ec nomenclature
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3chwA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3chwA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3chwA03
2ZGYA 1ATNA 3GG4A 3CETA 2J4RA 5ELZA 4PL8A 3U4LA 4BVPA 1Z05A 5I9EB 4WQ5C 2HMPA 1NGCA 4PKGA 4XEIA 1YAGA 3MK6A 3CJAA 5AQQA 1HJOA 1R59O 4A61A 5AQVA 2CGKA 3D7EO 3WQTA 1K8KB 3DWLA 3CJCA 3EO3A 3VEOA 1HKGA 3HI0A 1KAYA 4BRMA 4H03B 4MLEA 1X3NA 3UB5A 1NGJA 4MO4A 1WOQA 4XH4A 4CD3A 3BF1A 2VWBA 2Q97A 3FFKB 4FWSA 3VF4A 3O1BA 2EWSA 4FWNA 1NGGA 2P9PB 4JHDA 2PBDA 3HTVA 3A5MC 1ESVA 1BO5O 4H0YB 4FOEA 4CZFA 4FWRA 1ATRA 5AFUA 2P9KA 2E1YA 1GLDG 5KPZA 3WXIA 2E8AA 4QS7A 5JICA 2GWKA 3D2FA 3FE1A 2FSKA 2YHWA 4BC2A 4FL9A 3R9PA 1NGDA 1Y64A 2ZWHA 4B1UB 3CJ1A 3EZWA 3GDQA 4HWIA 3O6WA 3VEWA 4B9QA 5AQOA 5KPRA 4PKIA 4H0XB 1NGFA 4A62A 2HF3A 3UE5A 5AQJA 5CE3A 3GBTA 2E2OA 3LDQA 4FWOA 1YUWA 1V4TA 4KBOA 5JMVA 2ASMA 5FPEA 2F9TA 1QZ5A 2H3GX 2E2PA 5BN8A 1EQYA 4AM7A 5BRDA 3TPQA 1TYQA 1NBWA 2QWLA 1ATSA 2NLXA 1HKCA 4BRFA 2A3ZA 1QZ6A 3L0QA 3H3OB 3VEXA 4BC4A 3O5BA 4H0TB 3VPZA 1GLCG 4CI6A 2AA4A 5E84A 2A40A 1NMDA 4O8KA 4EIAA 4BVOA 3C7NB 3ATUA 5F2RA 4GNIA 3VGMA 2P9SA 3JS6A 5AQFA 3UKUA 3QDKA 3R8EA 3W0LA 2YJFA 1V4SA 2QWPA 1U2VB 3M1FA 3O08A 1ZXOA 3FLCO 4YDUA 5AQSA 5AQIA 2W41A 1S22A 4BRIA 2YI1A 2BTFA 3JXUA 1X9JA 1KXPA 5AQKA 3HM8A 3LL3A 3VEVA 3EKSA 3ATVA 1DKGD 4B1XB 1NGHA 4BQLA 5KQ8A 1D4XA 2OANA 3DXMB 5AQMA 1XQSC 5FPMA 2D0PA 2IVNA 3A5OC 3DXKA 1LCUA 3H45C 2WUSA 2FF6A 3EL2A 3KVGA 3EKUA 4HTLA 5EXWA 3SMPA 2P9PA 4FPAA 3WEEA 2I7PA 3MN7A 2BUPA 3D2EA 5BRHA 1G99A 4K42A 3S41A 2D1KA 4A2BA 1X3MA 3ULEB 4CZGA 4H5VA 3QB0A 3QBWA 1P8ZA 4CZKA 4JN4A 5AQZA 5BN9A 3H1VX 4M63C 3RSEA 3M3ZA 4CD1A 3VERA 5BR9A 5LJWA 3LDOA 4BRPA 3ZX0A 5BRFA 4CZHA 1GLEG 5LJVA 4O5FA 2P9NB 3J8AA 3CERA 4BQZA 1Q18A 3GOIA 4H5NA 1MA9B 4JD2B 3H3NO 2ZGZA 3HZ6A 4EHTA 2E2NA 1LOTB 1S3XA 4CZIA 5EY4A 3IFRA 4K41A 3VEYA 3BF3A 4AM6A 4FWLA 1C0GA 2ASPA 4CZJA 3VGKA 3BEXA 3ZETA 3H1QA 1JCEA 3A5NC 3WUHA 3IDHA 5BPMA 1T44A 3F9MA 4BR5A 2D4WA 2AP1A 3GE1A 3C7NA 3LDPA 3WQUA 3CHWA 3ZEUA 2Q0UA 2IVPA 1NGEA 3QFPA 5F0XA 3UKRB 3VGLA 4IO8A 2NZTA 3FZFA 3I8BA 4BROA 3A0IX 4BR9A 4FOIA 5KPTA 4FWKA 4H0VB 4BC5A 5AQRA 4EFHA 2QWMA 3CJ9A 3VOVA 1GLFO 3L4IA 4FPBA 2ZF5O 4IWVA 2GTDA 3CI5A 4BRGA 4B1WB 1QHAA 4IXCA 1SQKA 3LM9A 5BREA 2GELA 4IJAA 4M7YA 3TU5A 2GUPA 5AQHA 1MWMA 3KHYA 2FSJA 1J6ZA 2V51B 3AY9A 4BRNA 1DEJA 1K8KA 4E1JA 1IJJA 4EAHD 4BGBA 2V7YA 5EOYA 5FPDA 4JAXA 2NRHA 3EN9A 4H5TA 4XH5A 2HOEA 2P9IB 4RWTA 5AQNA 3ULEA 3FZHA 3U9ZA 4WYBA 1KAZA 3FR0A 3A5LC 3DAWA 3MDQA 5AFUH 2PAVA 3MN5A 4FSVA 3MN9A 3RSEB 3VEZA 5EVZA 4MLHA 3VF2A 5JLHA 1RDWX 4LC9B 1T6CA 3ID8A 4CZLA 4BR4A 5AZIA 3SLCA 1Z6RA 3LDNA 2QXLA 2P9NA 1YXQA 1GLAG 5AQYA 4GY2B 3L6QA 5AZJA 1BOTO 2VYPA 5LY3A 3MMVA 5AQGA 4BRLA 3ZX2A 4CBXA 4J8FA 2E1ZA 3A8YA 2QWNA 3P4IA 4IJNA 2FSNA 1QQNA 1JCGA 2P9KB 4DCHA 4DQ8A 4BREA 5AQWA 1HPMA 5AR0A 2E2QA 3D2FB 3MN6A 4K43A 3O80A 1HX1A 4JNEA 5TKYA 1TYQB 2ASOA 3IMXA 2GEMA 2HF4A 1QQOA 2CH5A 4PKHA 4QS8A 4BRKA 4H5RA 1BG3A 3ZEUB 2E88A 4WQ4A 4F9OA 2CH6A 1MDUB 4I6MB 4CZMA 3UKRA 2V52B 2QWQA 5EX5A 3ENHA 2P9LA 1BUPA 3QICA 3VF6A 5AQTA 2Q36A 3GL1A 4DB3A 3QBXA 2QM1A 2W40A 4M7XA 1RGIA 4Y0WA 4BG9A 5JLFA 4CZEA 1U2VA 1C0FA 3OHRA 1NM1A 1SAZA 2YJEA 4CBWA 1ZC6A 4BG8A 1HKBA 2P9UB 1HUXA 4L3QA 4BC3A 4ISFA 3H6EA 1BA1A 3CJBA 5FPNA 1KAXA 4BR0A 1BDGA 4QS9A 2IVOA 2FXUA 3WXLA 3WXKA 3CQXA 4PL7A 1IG8A 1QQMA 1DGKN 1E4FT 1NGAA 1XC3A 2A42A 3BUZB 3SMSA 1CZAN 2A6AA 2P9SB 4FWMA 2YHXA 3R6MA 3WT0A 2P9IA 2QWOA 1OKJA 4Z94A 3I33A 1H1VA 4WQ4C 2A41A 2ITMA 3KZBA 1GLBG 2CGJA 1BA0A 4DHYA 3O1WA 4NO7A 5KQDA 3LM2A 1BU6O 2FF3B 5AZIB 3VESA 2Q2RA 5ADXH 3DXMA 4H0OA 3W3DA 3SJHA 2IIRA 5AZJB 5F1XA 3FZLA 4K25A 1NLVA 3DXKB 4B1ZA 3U9DA 3WXJA 2F9WA 5B8HA 2FLOA 3WEEB 2Q1NA 1SZ2A 3BP8A 4RCHA 5AQUA 3D2EB 4BGAA 3O4WA 5BPLA 2QWRA 4XH1A 4BRAA 1NGIA 4JD2A 3QFUA 2VCPA 1GLLO 2D0OA 4CBUA 1RFQA 2YHYA 3M6GA 4MO5A 1XUPO 3C0BA 4JHDB 4ISGA 5ADXA 1NGBA 1E4GT 3HSCA 3ZX3A 3G25A 4BRQA 3LDLA 3VENA 1NWKA 4FWPA 4IZ9A 4B1YB 1WUAA 3H46O 3IUCA 3U8XA 3ZETB 4I6MA 2I7NA 2DPNA 5E26A 4A2AA 3FZMA 2E20A 3CIPA 2P9LB 1TUYA 4WQ5A 1HLUA 2A5XA 4NB4A 4ISEA 1JCFA 1ZBSA 5AQLA 3CJ7A 3O8MA 4B1VA 4BRHA 3HBTA 2P9UA 4H5WA 4RTFD 3FGUA 1GLJO 3QMLA 2YCHA 2KHOA 3AAQA 3B8AX 4C23A 5AQPA 3SK3A 4BRDA 3VETA 4YDUC 3MCPA 4BR2A 3FZKA 2UYTA 4FO0A 4EHUA 2V7ZA 2QW9A 4BR7A 2Q0RA 1MWKA 4BRCA 4CJ7A 2Q31A 2GWJA 3CQYA 4H0PA 1BWFO 1TUUA 3ENOA 2CGLA 1T6DA 1U6ZA 1YVNA 3AARA 5AQXA 3DJCA 3AAPA 5BPNA 4FWQA 3UKUB
chains in the Genus database with same CATH superfamily
4C1NI 1ATNA 3GG4A 2J4RA 5ELZA 1RILA 3U4LA 4B3RK 4BVPA 4WQ5C 4E19A 5M1QA 1TAUA 1LAWA 1YAGA 3CC4N 5DM6L 2QKBA 3CJAA 3Q7CA 4PA1A 3OYLA 3AVAA 3DWLA 3EO3A 5FROA 1ZBIA 2F8TA 3BF1A 1HNVA 5J2NA 4LSNA 2Q97A 1NOZA 4O4GA 3EY1A 3CCQN 3TAFA 4HVJA 4DLEA 2EWSA 3DM2A 1T8EA 1BO5O 2PFUA 4WFAL 4FOEA 5M1NA 1HYSA 4LF7K 1RT1A 5KPZA 4Z4CA 4FJMA 3CFRA 3OJSA 3D2FA 1SKRA 2VWKA 1ZBFA 2UUBK 3DOKA 4BC2A 4FL9A 3R9PA 1Y64A 4B1UB 3AVNA 4G1QA 3O6WA 4DTNA 3VEWA 4B9QA 5AQOA 1OVQA 2HHQA 4XIUA 1NJIO 3M8SA 3MX2A 5AQJA 3C95A 3PSFA 5CE3A 3GBTA 3LDQA 1LWEA 3LP0A 5JMVA 1RBSA 2B5JA 4IFVA 1C0UA 4CGGA 5BN8A 4W5RA 3RWUA 2OA8A 1DTTA 4KHUA 1L3VA 2YX6A 1BIZA 1LWFA 1S1XA 2QWLA 1ATSA 2NLXA 4H0TB 1GLCG 4FM2A 1W9HA 4CI6A 1NMDA 3L2VA 5F2RA 3RMDA 4J2EA 3UKUA 3R8EA 3VQPA 3KD1E 4WFBL 3HRGA 2OPQA 4AHVA 5AQSA 4DFKA 4JKGA 4BRIA 2YI1A 2OCEA 4KHSA 4KI6A 3EKSA 3RR8A 2UXDK 1WBBA 3DRRA 3O9QA 1ITGA 3ULDA 2X78A 4IKFA 1U4BA 3BDPA 2O8FA 2KQ2A 3DXMB 5SZTA 2O8DB 5FPMA 4CEFA 3A5OC 2IVNA 4DU3A 3H45C 1LW2A 2FF6A 2F96A 5TKWA 2FBXA 4C1NK 2P9PA 4DF8A 1S6PA 2I7PA 4DTSA 4DTMA 1KLNA 1FXXA 4OO1J 3S41A 1HNWK 3HK2A 1XMOK 1A5VA 3DMJA 1P8ZA 3DRSA 5AQZA 2G8KA 2O8CB 2WOMA 3RSEA 1RT7A 4GMJB 3T1HK 4M45A 5BR9A 3TAGA 1VRUA 2FBVA 1FK9A 3VQ5A 3ZX0A 3PSIA 1VSDA 4FCYA 2PY5A 3K57A 3OW2M 1HPZA 4KH4A 3GOIA 4H5NA 4JD2B 4K8XA 3H3NO 2ZGZA 2F8SA 1VQ4N 3HZ6A 1TKDA 4FXDA 1C0MA 1YT3A 4YFUA 2YNGA 3VEYA 3BF3A 4AM6A 1KFSA 1XNQK 4FWLA 2ASPA 3VGKA 4HHTA 3DLEA 1JLCA 3ZETA 1QE1A 2XO7A 3A5NC 3IDHA 3CC2N 3F9MA 4DV6K 1XNRK 3MXIA 3GE1A 3C7NA 3LDPA 3ZEUA 3CHWA 2Q0UA 1FKPA 1NGEA 4KI4A 5IWAK 2NRXA 2NZTA 4GW6A 3G6EN 2YKMA 3FZFA 4BROA 1NKEA 4J2AA 4DTJA 4CECA 5KPTA 4FWKA 3MECA 4BC5A 3ZT2A 2QWMA 3QIOA 1VSMA 5GIOA 3D0PA 1IBKK 4C8KA 3QEIA 1TL1A 3V9UA 1IG9A 4FW1A 3V1QA 1J53A 3VTIA 4M7YA 1Q81O 4B8AB 3TU5A 2HBJA 5AQHA 2FSJA 2XHBA 1C1AA 4CEQA 3BZKA 3AY9A 1ZBUA 1DEJA 4BRNA 2NRHA 3EN9A 4H5TA 3ZSVA 4DWIA 2IS3A 3CCSN 4FLTA 1UAXA 4WYBA 4KH5A 3A5LC 3MDQA 3MN5A 4FSVA 4DSKA 3VEZA 4HTUA 4YOTA 4H4MA 3VF2A 1TGOA 2HBMA 4EZ6A 4OGEA 3VTHA 3OBYA 3C94A 3ITHA 1T05A 5AZJA 3MXMA 2HSTA 1BOTO 4BACA 4DSLA 1VSHA 2O4IA 1WSHA 3JAMO 3MMVA 4BRLA 4DQRA 3O3HA 3C6HA 5HL7L 3KLFA 3P4IA 3HYFA 1VQ8N 5E41A 1T3VA 3OYNA 3E9PA 5AQWA 3P5JA 3LZIA 3MN6A 4CEAA 4K43A 4RW6A 4KHQA 3LAMA 1VQ5N 2HHVA 1I39A 1VSEA 3EYZA 2GEMA 2A1SA 2HF4A 4BRKA 4M3YA 4MFBA 1EXQA 2HHHK 3SYZA 4WQ4A 3DLGA 4GKJK 2HHWA 4ID1A 1T7PA 3AVCA 3VF6A 5C24A 2KFNA 3B6OA 3QBXA 1J5OA 4DFPA 4M7XA 3K0SA 3CCRN 2G8HA 3M8QA 2KZMA 1C0FA 2KLAA 2WC9A 1NM1A 1SAZA 2YJEA 1SKWA 2QK9A 2YNFA 2P9UB 4BC3A 4ISFA 3H6EA 2IOCA 3NH0A 3SQ1A 1KAXA 4DU4A 4FJ5A 1VSFA 1N36K 3F9KA 4PL7A 1JXEA 4DQSA 1QQMA 3NBPA 5KI6A 3QEXA 3RRGA 3NFAA 4RG8A 2A6AA 2P9SB 3NDKA 1TK5A 2YHXA 2P9IA 3K58A 5C25A 2VWJA 3ZLJA 2QWOA 4OLAA 1OKJA 1J54A 3NVKA 1RTHA 2O8EB 2GV9A 4WQ4C 2IDOA 4M41A 3DLRA 3ZYYX 3J7ZO 4FM0A 1MU2A 1GLBG 4DV0K 4DHYA 4DMNA 3D6RA 2VQFK 3LM2A 1KFDA 2FF3B 3E9LA 2P51A 4PQUA 2O8CA 4CK1A 4H0OA 1Y97A 1YIJN 3RR7A 3DXKB 4B1ZA 3PX0A 4QAGA 2FLOA 4X65K 2D0AA 2Q1NA 4RCHA 4KHWA 1OH6A 4XH1A 4KTZA 2OTJN 4DSEA 1NGIA 3L8BA 5HP1A 4JD2A 3KD5E 4CJUA 5C2FA 3M6GA 3C0BA 1UA1A 1E4GT 4IZ9A 3VQCA 1NKBA 4BE1A 3IUCA 3U8XA 3ZETB 3K5LA 2DPNA 1GOCA 3LP1A 4M3ZA 2P9LB 3VQ6A 3P1GA 4I9LA 4MQ3A 3MCAB 4ISEA 4AHTA 1BQNA 3MEGA 3CJ7A 4FLXA 3O8MA 3S3NA 3C6AA 4H5WA 1IBLK 4PY5A 3QMLA 1RBTA 1IKXA 3SV4A 3MCPA 3OYEA 3VQ8A 2C1GA 4BR2A 4IDKA 3K9KA 4KHYA 1O13A 3CD6N 4CJ7A 4H0PA 1B9FA 1SUQA 3J80O 1U6ZA 2NNWA 4B8CA 4JK9A 1VQPN 3OYDA 1YVNA 3AARA 1X9WA 3O9SA 1W7AA 3KK7A 2ZGYA 3DLKA 4CFDA 1Z05A 5I9EB 3LAKA 1NGCA 4XEIA 1YTAA 1D5AA 2YV0X 1TKTA 1R59O 4DV2K 5AQVA 3T3FA 3VEOA 1HKGA 4FLYA 3V9SA 3KWGA 2Q3SA 1X3NA 1VQKN 1NGJA 4Q0BA 4GVMA 1N33K 4JI1K 3EE8A 3ZSZA 3FFKB 4FWSA 4LD0A 3TAMA 4DV3K 2GBZA 3O1BA 1KRPA 1CZ9A 4YOUA 2RF2A 1ESVA 3CM6A 4OKKA 4H0YB 5SWMA 2JWKA 5GADP 1ATRA 1XHZA 1BQMA 4UQGA 1GLDG 2F4VK 1WSEA 4QS7A 2NRTA 2GWKA 4JI4K 2FSKA 4DTPA 3CJ1A 4CEEA 3GDQA 4Y1CA 4CW7B 1EKEA 3HVTA 3V6DA 4PKIA 3CG7A 4Z4EA 2HF3A 3C6TA 4DS4A 1SL0A 3SBTA 2E2OA 3SCXA 4IOCL 4CJ5A 2XY5A 3TSPA 1NJWA 5IT9O 2F9TA 1EQYA 3HP6A 3LWLA 1TYQA 2WBNA 3NE6A 1VQLN 3RVCA 4BRFA 2A3ZA 2RN2A 5DK5A 5LL6Z 3VEXA 3ZSYA 4PWDA 2VGNA 3E66A 3O5BA 4FJ9A 2HBLA 3K5OA 2AA4A 3QEVA 1BISA 2A40A 2VQEK 4JKHA 4K8ZA 3ATUA 4GNIA 3QNOA 1JLEA 2P9SA 3JS6A 4DV4K 1V4SA 1U2VB 2DFFA 4JK7A 4HUEA 3AVKA 5AQIA 1S22A 1TV6A 1X9JA 3JXUA 4JI0K 1KXPA 3ZSWA 2O8EA 4DTXA 1UWBA 1HRHA 3SV3A 2HHXA 4O0IA 1RT2A 4DS5A 2Z1GA 3EZ5A 3ZSQA 2ZQBA 5KQ8A 1W97L 1TAQA 3OJUA 1XQSC 4J2DA 3DXKA 4CEOA 3SNNA 2WUSA 4IEIA 3LPTA 4R79A 2B4JA 5BRHA 1G99A 1WSIA 5J1EA 4JEPA 1RT5A 2D1KA 4IG0A 4A2BA 3MWPA 2QEXN 3O9UA 5LMNK 4KKOA 4BWJA 3AVGA 2HW3A 3M3ZA 4CD1A 3LP2A 3SAGA 3VERA 4BRPA 4ELVA 1WN7A 4W5QA 1Z26A 5LJVA 4MDBA 4NYFA 2P9NB 3V81A 3TANA 3J8AA 2EHGA 4BQZA 4CK2A 1A5XA 3OS0A 1C1CA 3VMFB 4DSFA 4CF0A 3T1YK 2E2NA 3PV8A 3O9TA 1S3XA 4CZIA 2OZSA 4FJJA 3IFRA 4K41A 3TAEA 3TAPA 2EX3A 4CZJA 4J2BA 5LMUK 3AV9A 3H1QA 3WUHA 2G8VA 3CMAN 3S3OA 4BR5A 4HCCA 1ASVA 2D4WA 1KVAA 4B9TA 1C1BA 4HUFA 4LF5K 3UKRB 4NXMK 4IO8A 4A57A 5FLXO 4DR7K 3CM5A 3I8BA 1QVGM 3A0IX 4NCBA 3OYAA 4FOIA 3G10A 2VGMA 3UIQA 3VN5A 3OBWA 1NNEA 3EEQA 4LF4K 4DR1K 1RT3A 3SQ2A 1NG9A 3QERA 2ZF5O 3P39A 3KK2A 3CI5A 1UA0A 3QLHA 1C6VA 3THYB 1NK6A 4LF8K 2O8FB 1J9AA 3LM9A 5BREA 3L3UA 2GELA 4IJAA 3S3MA 1MWMA 2W00A 4IDHA 2DTUA 1BI4A 4EAHD 4BGBA 5FPDA 2KTQA 1CXUA 4CJ4A 2GUIA 4FM1A 3WNEA 3TTDA 1ZBLA 4XH5A 2HOEA 1N5YA 3NMUA 4WCEL 3I0RA 4AHCA 3T69A 2BE2A 3FZHA 5C2DA 1QS4A 5CHIA 3V9ZA 3SJJA 4JRPA 3CCUN 1Q9YA 2G8UA 2PAVA 1Q9XA 3RSEB 3P83D 2ZE2A 5EVZA 4FJLA 1RDWX 1JLAA 3VQQA 4LC9B 1VK0A 1T6CA 3ID8A 1Z6RA 3LDNA 2QXLA 5AQYA 1JXBA 4O0JA 1LAVA 4GV9A 4F2SA 3KKSA 1N6QA 5LY3A 3O3FA 3CCMN 4FJNA 1BHLA 5M1OA 3AVMA 3HOSA 4H4OA 5M1FA 1OVYA 1VHXA 4M3TA 4JKCA 4DQ8A 2E2QA 1YJ9N 1HX1A 5TKYA 1TYQB 3IMXA 1N8RO 4NYNA 4DF4A 2CH5A 2XY8A 4H5RA 3ZEUB 5M1PA 2E88A 1FW6A 1KQSM 1U45A 2FBTA 4N47A 3JYTA 3T19A 4TSXA 1HQUA 1QTMA 5AQTA 1KVCA 2E6LA 1NU0A 1VAZA 4BG9A 4Y0WA 2UUAK 4DFMA 1B9DA 5JLFA 1U2VA 4NXNK 5FRMA 2E5LK 3ZSRA 1ZC6A 4BG8A 1HKBA 4L3QA 4LFBK 3CJBA 5FPNA 1VQMN 1BDGA 4OGCA 4QS9A 4AHRA 1YI2N 2IVOA 3WXKA 2FXUA 4W5OA 1CXQA 3J7AP 3CQXA 3CXCM 4I2QA 1SS6A 4OJRA 4C8NA 1IG8A 1DGKN 1XC3A 3DLBA 2A42A 3MX5A 2BH1A 4AHUA 4FJ7A 2VG7A 3IRXA 1IV0A 5K14A 3TI0A 3OY9A 4DKWA 4CFCA 4YY3K 4Z94A 3I33A 2FBYA 4OKEA 3AVLA 2ITMA 1FJGK 4FLZA 2CGJA 3Q7BA 5KQDA 4E7KA 4CHNA 3VESA 5ADXH 3W3DA 2IIRA 5AZJB 3FZLA 1NLVA 5GINA 3SPZA 5B8HA 1XC9A 1SZ2A 3BP8A 4CJSA 3D2EB 5AQUA 3VQ7A 2RE2A 2QWRA 4BRAA 1XMQK 4ZTFA 4CF1A 4CJ3A 1GOAA 5D3GA 4CBUA 1RFQA 3R3LA 2G8WA 3V4IA 3SQ0A 1XUPO 4FZZA 4E0DA 4JHDB 4ILHA 3ZT3A 4E7JA 1NGBA 3VQAA 3G25A 1OH5A 1L5UA 1EWRA 3KIOA 1M1KO 4CHYA 2I7NA 1YJWN 3KLIA 1QHTA 3CIPA 2UXBK 1TUYA 3AO5A 3OS1A 2XY7A 3L2WA 1ZBSA 3AVFA 5AQLA 4KB0A 4BDYA 1RDUA 2P9UA 4OPJA 4H8KA 2UXCK 3FGUA 1GLJO 3MWTA 3G71N 3V1RA 3B8AX 4C23A 3AA4A 3SK3A 3VETA 4YDUC 1NK5A 1NK0A 3D45A 1HQEA 4FO0A 4EHUA 2QW9A 4ILJA 4BR7A 2Q0RA 2OYQA 5HBMA 4IBNA 4BRCA 3CC7N 2OPSA 2Q31A 3ENOA 1X9SA 2CGLA 1NOYA 2KKZA 4Z0UA 2QI2A 3M8PA 4ZTJA 2RKIA 1JL1A 1NMNA 3CETA 5HRSA 3DI6A 3JSMA 3CFPA 1NK9A 4GKKK 4QOZB 4DR5K 2ITGA 4PHTX 1K9MO 1WSFA 3MK6A 1NJYA 3WNGA 5AQQA 1HJOA 4CJEA 3TSUA 1VSJA 1IKWA 4LSLA 1KAYA 4H03B 2BGGA 1RDAA 4JKEA 1HYZA 1CZBA 1WOQA 4XH4A 5CZ2A 3ZT4A 4B9MA 2QXFA 2HB5A 3DYAA 5KGXA 4B3TK 4BE0A 3VF4A 1TL3A 3AO1A 1S72N 4FWNA 2P1JA 3TABA 3A5MC 3WNFA 4CZFA 1VRTA 2HNZA 3OYBA 2E1YA 3WXIA 2E8AA 5JICA 5KRSA 4DV1K 2D0BA 4DG1A 4RW9A 1NGDA 2D0CA 4FJXA 1A5WA 1NK4A 4QCLA 1HYVA 4YOXA 5KPRA 2I5JA 5M1KA 4H0XB 1XHXA 1KD1O 2KFZA 4A62A 3CCVN 4IG3A 1K8AO 4KAZA 4OPKA 1Q8IA 4I2PA 4FWOA 1YUWA 4CF2A 4KBOA 5DMRA 4CJWA 2ASMA 4EP4A 1Q86O 1QVFM 3NCIA 4B9NA 3DOLA 3T1AA 3TPQA 4IFYA 4Z4HA 3OTOK 2ETJA 1QZ6A 4KTQA 3O4QA 4BC4A 2IAJA 4CEDA 3VPZA 2F7TA 1WSJA 4FW2A 1C0TA 4FVMA 5E84A 2PZSA 3OYMA 1K6YA 4JKFA 4O8KA 4B08A 4BVOA 3F2KA 3RTVA 1OH8A 3HP9A 1X1PA 5J2PA 5AQFA 3QDKA 3W0LA 3M1FA 3O08A 1U48A 2ZJRL 1ZXOA 3FLCO 4YDUA 2JGUA 1BGXT 3VEVA 5JVGL 3O3GA 4CE9A 3L4QA 3F73A 2E6MA 4B1XB 2NUBA 4W5NA 1S9EA 3AO4A 3PIPL 4DFJA 3AO2A 4CJTA 4CCHA 1D4XA 4AHSA 4FLVA 3KLHA 2OANA 4E7LA 4ILGB 5AQMA 4DQIA 2Z1HA 5C15A 1RBRA 2D0PA 4ICLA 2W42A 1LCUA 1RT6A 5C10A 5HROA 3EL2A 5EXWA 3SMPA 4E3SA 1RTJA 4BDZA 4FLUA 3D2EA 3IG1A 4OPAA 1S1TA 4K42A 4CJPA 3AVBA 4M3UA 4W5TA 3PO4A 3ULEB 2QTDA 3QBWA 4JN4A 5BN9A 4FJGA 3HJFA 1DTQA 5LJWA 3T7ZA 3CPWM 4XJXA 3V9WA 4CZHA 1U49A 1GLEG 1T03A 4O5FA 4LY7A 4CERA 3L2QA 3CERA 3NH1A 1TKXA 3NF6A 3O9RA 1MA9B 3U3YA 5JS2A 2PYJA 3ID6A 4NCGA 4DUZK 1LOTB 4CIGA 4IOXA 5EY4A 1C0GA 3TARA 2X74A 3CYGA 3CF5L 4LH4A 1JCEA 2HHUA 3QEPA 4JI8K 1W0HA 5BPMA 4M3RA 1WAFA 2AP1A 1QSLA 2RHKA 3NGZA 5HRNA 4GV6A 3IAYA 4Z4GA 3E01A 4E72A 4FK0A 3QINA 4HCBA 2YNHA 1VSKA 3CJ9A 3VOVA 1GLFO 3AGRA 1E3MA 4KTWA 2ZM6K 4M3WA 4IWVA 2GTDA 4AILC 4AF1A 3VA3A 3AVIA 3C65A 1SQKA 1ILYA 4I9QA 2HVHA 4O8UA 1JLQA 2V51B 1XI1A 1HNIA 1ZYQA 2V7YA 5EOYA 3C6UA 4JAXA 1HNZK 2AJQA 4B9SA 4KPYA 4AQYK 2WONA 3U9ZA 3KLEA 1KAZA 3FFIA 3FR0A 1KSPA 3DAWA 5AFUH 4O55A 1RBUA 2HHIA 1SL1A 1EP4A 1NJXA 2X6SA 3AVHA 4MLHA 5JLHA 1BL3A 2NRRA 5I3UA 3QNNA 3E1YA 1YF5L 4BR4A 5AZIA 3SLCA 4ELTA 2P9NA 1YXQA 4GY2B 3L6QA 4FVUA 3CYMA 2VYPA 3CMEN 4N41A 1J5EK 3ZX2A 4J8FA 1WAJA 2E1ZA 3RRHA 1QSSA 1JKHA 1ZBHA 5HLFA 1HMVA 2QWNA 2FSNA 4A59A 2P9KB 4DCHA 4BREA 3L2UA 1HPMA 5AR0A 1U04A 2QA4N 3O80A 4JNEA 4M42A 3NGYA 1W2BM 4PKHA 1QSYA 4CJFA 3SI6A 2CH6A 4I6MB 3UKRA 4CGHA 1JL2A 5J2MA 3VQBA 2QWQA 3ENHA 1BUPA 3NAEA 4DR2K 4CJLA 5EU7A 2Q36A 4CFBA 3OYKA 2W40A 2Y1JA 3LZJA 4F4KA 4CZEA 1BCOA 3OHRA 2KZZA 1S9GA 2HNDA 1HUXA 5GAEP 3THYA 4BR0A 4DTRA 1EETA 3BY5A 3ASMA 2HHSA 3F5TA 1BI4B 4FK4A 4BEBA 3K59A 5CYQA 3R6MA 3WT0A 5FDLA 4X66K 2DY4A 4X64K 2P5GA 1KLMA 3ZT0A 4OKJA 1YTUA 1H1VA 2A41A 2IGIA 1WNSA 3SUNA 3KZBA 3QETA 4WFNL 1TK8A 4FYDA 1WSGA 3ZT1A 3KJVA 1VQ9N 2UU9K 4NO7A 1BU6O 2OPRA 1D8YA 2O8BB 2Q2RA 4FZXC 3IS9A 4CIEA 5F1XA 4K25A 3WXJA 2HVIA 3NF9A 1HR0K 1KC8O 3WEEB 1KTQA 2UUCK 1JLGA 2JWLA 4IOAL 5BPLA 4UY8O 3O4WA 1S6QA 1CLQA 4YOYA 5HOOA 1RNHA 3PX4A 1GLLO 2D0OA 1Q7YO 3AA2A 2YHYA 3RMAA 1L3SA 4F2RA 3HSCA 4YNQA 4BRQA 3LDLA 1SV5A 2KW4A 3VQ9A 3H46O 1RCHA 3PIOL 3RMBA 5E26A 4A2AA 3FZMA 3A2FA 4YOVA 3NF7A 3J81O 1HLUA 2IC3A 4Q5VA 2BDPA 4LFAK 3QIPA 4CHZA 4C8MA 4NB4A 3AGKA 1UOCA 3PO5A 4B1VA 4DV5K 3OYFA 3HBTA 3G0ZA 3DRPA 2DFHA 3R1XA 4FK2A 2A1RA 1BIUA 4AH9A 5AQPA 5J2QA 3M8RA 3AA5X 2Y1IA 2V7ZA 2XRIA 4JKDA 4K0KK 1KVBA 3PUFA 2JLEA 1MWKA 2ATQA 4N5SA 4DQQA 2R7YA 5FRNA 2GWJA 3CQYA 5HRRA 1TUUA 4FZYA 1T6DA 5CYMA 2YHBA 1JLBA 4CJVA 3SQ4A 1P90A 1IKYA 3AAPA 2GX9A 5BPNA 4FWQA 1NKCA 3UKUB 4E1NA 5BR8K 1EX4A 1K73O 3THVA 4WE1A 4PL8A 1TK0A 1ASUA 4CK3A 4JKGB 2HMPA 4PKGA 4BY9C 1I94K 3K5MA 1RTDA 4CGDA 2RPIA 3B6PA 4A61A 3VQEA 2CGKA 4E7HA 4KH6A 5JVHL 3D7EO 3WQTA 4DTOA 1K8KB 3CJCA 1R0AA 4Z4IA 3HI0A 2DFEA 3MEEA 4BRMA 4MLEA 2YNIA 4BE2A 3UB5A 5AJ3K 2HMIA 4MO4A 4CD3A 3EE9A 2VWBA 2E4LA 4IFEA 2W6KA 4LFCK 4JV5K 1HNXK 4F8RA 1NGGA 2P9PB 3CCEN 4JHDA 1YVUA 2PBDA 3THXA 3HTVA 1DLOA 3KTQA 4FWRA 1RBVA 5AFUA 1SL2A 2P9KA 5T7BA 1DT9A 5CZ1A 4N76A 4MDAA 5CR4A 4CEBA 3FE1A 3U6FA 2YHWA 3I55N 3HPOA 3LALA 3HM9A 2ZWHA 3EZWA 4HWIA 4JS4A 4CF8A 1NGFA 3ZSXA 3ISNC 1L3TA 3UE5A 1NJZA 1Z25A 2WTUA 3MEDA 1V4TA 3ZSOA 4FJKA 4JYAK 3ENBA 4CHPA 5FPEA 4JRQA 2H3GX 1QZ5A 2NRWA 2E2PA 3MXJA 3CCLN 1ASWA 4KV8A 4A5BA 4AM7A 5BRDA 5C0YA 5DM7L 1Q82O 4JI3K 1NBWA 1HKCA 3OYJA 3L0QA 3H3OB 3AO3A 3TAQA 1RDDA 4CJQA 4LH5A 1JLFA 2Z1IA 4FJHA 4EIAA 1N34K 3C7NB 3HPHA 3VGMA 4OLBA 3TWHA 5I42A 2YJFA 2QWPA 3HOTA 3AVJA 4DQPA 3P38A 2W41A 3HT3A 2BTFA 4EZ9A 5AQKA 3HM8A 3LL3A 1RDCA 3P31A 4B9LA 3ATVA 4BECA 4CGFA 3HO1A 1DKGD 1G15A 3H08A 1NGHA 4N56A 3V9XA 4BQLA 2O8BA 4BWMA 1EWQA 2ZJQL 1GOBA 4CIFA 4CESA 1LW0A 3LPUA 3S5TA 3O4NA 3KVGA 3EKUA 4HTLA 3WEEA 1WBDA 4FPAA 3V1OA 3MN7A 2BUPA 3KLGA 2O4GA 4JI5K 1X3MA 2OPPA 2HHTA 4DSJA 2WFBA 4CZGA 1M90O 4H5VA 4U7BA 3QB0A 4F3TA 4CZKA 3NVMA 3WNHA 3H1VX 4KB1A 4M63C 3OVNA 5H1SQ 3CCJN 4RW7A 4KREA 1VQON 3LDOA 4A5AA 2OTLN 5BRFA 4JI2K 2HNYA 2PYLA 4DU1A 1Q18A 3I0SA 2FC0A 4YHHK 4O44A 4EHTA 5HRPA 3N4PA 4DSIA 4E7IA 3SUOA 4B3MK 4KFBA 4CGIA 4DLGA 4CJRA 3OYIA 3TTCA 3BEXA 3VQDA 4ELUA 3QEWA 4LF9K 4KRFA 4JKAA 1T44A 3LWMA 1IBMK 4JS5A 1YJNN 3I56N 4DV7K 3OYGA 4B9VA 4L8RB 2NRVA 4DTUA 3WQUA 1OH7A 2IVPA 3NHGA 4GV3A 3QFPA 5F0XA 4EP5A 3KK3A 2W6LA 3VGLA 3OYCA 1NK8A 1REVA 5GIPA 4BR9A 1VSLA 3VQ4A 4H0VB 5AQRA 4EFHA 4I7FA 4LF6K 3AA3A 3L4IA 4FPBA 3TTFA 1S5JA 1D9DA 4BRGA 1VSIA 2BANA 4B1WB 1QHAA 3THWB 3IKMA 4IXCA 2YKNA 2GUPA 1F21A 3KHYA 4NLCA 4DR3K 1J6ZA 4O5BA 3J7YP 1K8KA 4E1JA 1IJJA 4CEZA 1RT4A 3SBGA 3CFOA 2P9IB 4OVLA 5KGWA 4RWTA 4X62K 5AQNA 3ULEA 2G8FA 1S1VA 1TKZA 3KWIA 1RDBA 1FKOA 3THXB 3E9OA 3SZ2A 3MN9A 1IH7A 1EO1A 1HJRA 2X6NA 2Z1JA 2HBKA 3I8DA 4CZLA 1X9MA 4DUYK 1B92A 3HXMA 3OA9A 1WLJA 5GAGP 5GAHP 4DR4K 1GLAG 3SAHA 2OZMA 1QQCA 5CY4A 1NK7A 3M5RA 1BCMA 4ID5A 4CBXA 5AQGA 1TVRA 3MAQA 1WB9A 1VQNN 1S1WA 3A8YA 4PUOA 3TR8A 3CQ8A 4IJNA 3K5NA 4R5PA 3PY8A 1JCGA 1QQNA 2NRZA 4CJKA 4HUGA 4NLBA 3OYHA 3LP3A 4WF9L 3D2FB 3NGIA 3LDSA 1D9FA 3L3VA 3K2PA 5JS1A 2ASOA 1QQOA 4QS8A 1BG3A 4YOWA 3KK1A 4F9OA 1MDUB 4CZMA 4CFAA 2V52B 4F3OA 5EX5A 2P9LA 3QICA 1LV5A 3GL1A 4DB3A 2QM1A 4E1MA 5KTQA 1RGIA 3N4QA 3CPEA 4CHQA 3S9HA 3NH2A 4G9ZA 1LWCA 4CBWA 1VQ6N 4DR6K 3KKRA 3WXMB 1BA1A 2B6AA 4ZHRA 4JI6K 3WXLA 4JLHA 5C12A 4YORA 1E4FT 1NGAA 3BUZB 3SMSA 1CZAN 4FWMA 1KCFA 5JENA 5A2QO 1IO2A 1IKVA 4GVEA 3K9JA 2QKKA 4Y1DA 4C8LA 3HSTB 3U3GA 3VA0A 4B3SK 4C8OA 4KHPK 2ZJPL 3QESA 4B9UA 1BA0A 4RW8A 3O1WA 3LANA 4B3OA 4RW4A 5AZIB 2XY6A 4IO9L 3SPYA 3DXMA 3SUQA 3HL8A 3SJHA 1XWLA 2O8DA 3U9DA 3ZCMA 4JI7K 4CGJA 2F9WA 4M3XA 2YHAA 2VG5A 4BGAA 3PLAA 3QFUA 2VCPA 3QO9A 4MO5A 3NF8A 3SAFA 3TSQA 4ISGA 5ADXA 2C1IA 3ZX3A 3VENA 1NWKA 4FWPA 3HVRA 1U47A 4KHNA 4B1YB 1WUAA 1YITN 3BZCA 4I6MA 4U67L 2P5OA 4CF9A 2D5RA 2E20A 4CVNE 4CHOA 5MLCQ 4V19S 4OPHA 4IEEA 4WQ5A 4FJIA 4FLWA 2G8IA 3HPGA 4FJ8A 2A5XA 2VG6A 3L2RA 1RTIA 4JK8A 3BGRA 1VQ7N 1JCFA 3G4SN 1I3AA 5KRTA 3OS2A 3SUPA 3PX6A 4BRHA 4OX9K 1N32K 4RTFD 2LSNA 1SKSA 2YCHA 2KHOA 3AAQA 4BRDA 4BE7B 5C42A 3FZKA 4JKBA 2UYTA 4NCAA 3THWA 3RMCA 3ALYA 4Z4FA 1YHQN 1S1UA 1O1WA 4BDPA 1BWFO 2ZD1A 4E89A 3DLLL 5AQXA 3DJCA 3DLHA 1L3UA 1JJ2M 4KO0A
chains in the Genus database with same CATH topology
2ZGYA 4C1NI 1ATNA 3GG4A 1K73O 3CETA 2J4RA 5ELZA 4PL8A 3U4LA 4BVPA 1Z05A 5I9EB 4WQ5C 4JKGB 2HMPA 5M1QA 1NGCA 4PKGA 4XEIA 4PHTX 4BY9C 1YAGA 1K9MO 3MK6A 3CC4N 5DM6L 3CJAA 3Q7CA 5AQQA 1HJOA 1R59O 4A61A 5AQVA 3TSUA 2CGKA 4KH6A 5JVHL 3D7EO 3WQTA 1K8KB 3DWLA 3CJCA 3EO3A 3VEOA 1HKGA 3HI0A 1KAYA 4BRMA 3KWGA 4H03B 4MLEA 4JKEA 1X3NA 3UB5A 1VQKN 1NGJA 4MO4A 1WOQA 4XH4A 4CD3A 3EE8A 3BF1A 3EE9A 2VWBA 2Q97A 3FFKB 4IFEA 4FWSA 3CCQN 3VF4A 3O1BA 2EWSA 4FWNA 1S72N 1NGGA 2P9PB 3CCEN 4JHDA 2PBDA 3HTVA 3A5MC 4YOUA 1ESVA 1BO5O 2PFUA 4WFAL 4H0YB 4FOEA 4CZFA 2JWKA 4FWRA 1ATRA 5M1NA 5AFUA 5GADP 2P9KA 1DT9A 2E1YA 1GLDG 5KPZA 3WXIA 2E8AA 4QS7A 5JICA 2NRTA 2GWKA 3D2FA 4MDAA 5CR4A 3FE1A 2FSKA 2YHWA 3I55N 4BC2A 4FL9A 3R9PA 1NGDA 1Y64A 2ZWHA 4B1UB 3CJ1A 3EZWA 3GDQA 4HWIA 3O6WA 3VEWA 4B9QA 5AQOA 4YOXA 5KPRA 4PKIA 4H0XB 5M1KA 1NGFA 1KD1O 4A62A 2HF3A 1NJIO 3UE5A 3CCVN 3MX2A 5AQJA 1K8AO 5CE3A 3GBTA 3SBTA 2E2OA 3LDQA 4FWOA 1YUWA 1V4TA 4IOCL 4KBOA 3TSPA 3ENBA 5JMVA 2ASMA 5FPEA 1Q86O 1QVFM 2F9TA 1QZ5A 2H3GX 2NRWA 2E2PA 5BN8A 3CCLN 1EQYA 4A5BA 4AM7A 5BRDA 5C0YA 5DM7L 3TPQA 1TYQA 1Q82O 2WBNA 2YX6A 1NBWA 1VQLN 2QWLA 1ATSA 2NLXA 3RVCA 1HKCA 4BRFA 2A3ZA 1QZ6A 3L0QA 3H3OB 3VEXA 4BC4A 2VGNA 3E66A 3O5BA 4H0TB 3VPZA 2F7TA 2HBLA 1GLCG 4CI6A 2AA4A 5E84A 2A40A 1NMDA 4JKHA 3UKUB 4JKFA 4O8KA 4EIAA 4BVOA 3C7NB 3ATUA 3F2KA 5F2RA 4GNIA 3VGMA 2P9SA 3JS6A 5AQFA 3UKUA 3QDKA 3R8EA 3W0LA 2YJFA 1V4SA 2QWPA 1U2VB 3M1FA 3O08A 4WFBL 1ZXOA 3FLCO 3HRGA 4JK7A 3HOTA 2ZJRL 3P38A 4YDUA 5AQSA 4JKGA 2W41A 5AQIA 1S22A 4BRIA 2YI1A 2BTFA 1X9JA 3JXUA 1KXPA 5AQKA 3HM8A 3LL3A 3VEVA 5JVGL 3P31A 3EKSA 3ATVA 4BECA 1DKGD 3L4QA 3O9QA 4B1XB 1NGHA 4BQLA 5KQ8A 3PIPL 1D4XA 2OANA 1W97L 3DXMB 4ILGB 5AQMA 2ZJQL 1XQSC 5FPMA 5C15A 2D0PA 2IVNA 3A5OC 3DXKA 1LCUA 3H45C 5C10A 2WUSA 4IEIA 2FF6A 5TKWA 3EL2A 3KVGA 3EKUA 4HTLA 5EXWA 3SMPA 2P9PA 4FPAA 3WEEA 4C1NK 2I7PA 3MN7A 4R79A 2BUPA 3D2EA 4OPAA 5BRHA 1G99A 4K42A 4JEPA 3S41A 4OO1J 2D1KA 4A2BA 1X3MA 3MWPA 3ULEB 2QEXN 2WFBA 4CZGA 1M90O 3O9UA 4H5VA 4U7BA 2QTDA 3QB0A 3QBWA 1P8ZA 4CZKA 4JN4A 5AQZA 3NVMA 5BN9A 3H1VX 4M63C 3RSEA 5H1SQ 3CCJN 3M3ZA 4CD1A 3SAGA 3VERA 5BR9A 5LJWA 3T7ZA 1VQON 3LDOA 4BRPA 4A5AA 2OTLN 3ZX0A 3CPWM 4XJXA 5BRFA 4CZHA 1GLEG 5LJVA 4MDBA 4O5FA 2P9NB 3J8AA 3CERA 3OW2M 4BQZA 4KH4A 3O9RA 1Q18A 3GOIA 4H5NA 1MA9B 4JD2B 3H3NO 2ZGZA 3VMFB 1VQ4N 3HZ6A 4EHTA 3N4PA 3ID6A 2E2NA 1LOTB 3O9TA 4IOXA 1S3XA 4CZIA 5EY4A 3IFRA 4K41A 3VEYA 3BF3A 4AM6A 4FWLA 1C0GA 2ASPA 3TTCA 4CZJA 3VGKA 3BEXA 3CF5L 3ZETA 3H1QA 1JCEA 3A5NC 3WUHA 3IDHA 3CMAN 3CC2N 4JKAA 5BPMA 1T44A 3F9MA 4BR5A 2D4WA 1YJNN 3I56N 2AP1A 3GE1A 3C7NA 2NRVA 3LDPA 3WQUA 3CHWA 3ZEUA 2Q0UA 2IVPA 1NGEA 2RHKA 4GV3A 3QFPA 5F0XA 3UKRB 4GV6A 3VGLA 4IO8A 4A57A 2NRXA 2NZTA 3G6EN 3FZFA 3I8BA 5GIPA 4BROA 3A0IX 1QVGM 4BR9A 4FOIA 2VGMA 5KPTA 4FWKA 4H0VB 4BC5A 5AQRA 3OBWA 4EFHA 2QWMA 3CJ9A 3VOVA 1GLFO 3AGRA 3L4IA 4FPBA 5GIOA 3TTFA 2ZF5O 3P39A 4IWVA 2GTDA 3CI5A 4BRGA 4AF1A 4B1WB 1QHAA 3C65A 3IKMA 4IXCA 1SQKA 1ILYA 3VTIA 3LM9A 5BREA 2GELA 4IJAA 4M7YA 1Q81O 3TU5A 2GUPA 2HBJA 1MWMA 5AQHA 3KHYA 2W00A 2FSJA 4NLCA 1J6ZA 4O8UA 2V51B 3AY9A 4IDHA 1DEJA 1K8KA 4BRNA 4E1JA 1IJJA 4EAHD 4BGBA 2V7YA 5EOYA 5FPDA 4JAXA 2NRHA 3EN9A 3TTDA 4H5TA 4XH5A 2HOEA 3NMUA 3SBGA 4WCEL 3CCSN 2P9IB 5M1FA 4RWTA 5AQNA 3T69A 3FZHA 3ULEA 3U9ZA 5C2DA 5CHIA 4WYBA 1KAZA 4KH5A 3FR0A 3A5LC 3DAWA 3KWIA 3CCUN 3MDQA 5AFUH 2PAVA 3E9OA 3MN5A 4FSVA 3MN9A 3RSEB 1EO1A 3VEZA 4YOTA 5EVZA 4MLHA 3VF2A 5JLHA 2NRRA 1RDWX 2HBMA 2HBKA 4LC9B 1T6CA 3E1YA 3ID8A 4CZLA 1YF5L 4BR4A 5AZIA 3SLCA 1Z6RA 3LDNA 2QXLA 3VTHA 3OA9A 5GAGP 5GAHP 2P9NA 1YXQA 1GLAG 3OBYA 5AQYA 4GY2B 3L6QA 3SAHA 5AZJA 4GV9A 4FVUA 2HSTA 1BOTO 2VYPA 5LY3A 3M5RA 3CMEN 3MMVA 5AQGA 4BRLA 3ZX2A 4CBXA 4J8FA 3CCMN 2E1ZA 1VQNN 3A8YA 5M1OA 3C6HA 5HL7L 2QWNA 3P4IA 4IJNA 3HOSA 2FSNA 4A59A 1QQNA 1JCGA 1OVYA 2NRZA 2P9KB 4NLBA 4DCHA 4JKCA 1T3VA 4DQ8A 4BREA 3E9PA 5AQWA 1HPMA 5AR0A 4WF9L 2E2QA 3D2FB 3MN6A 4K43A 1VQ5N 2QA4N 1YJ9N 3O80A 1HX1A 4JNEA 5TKYA 1TYQB 2ASOA 3IMXA 1N8RO 2GEMA 2HF4A 1W2BM 1QQOA 2CH5A 4PKHA 4QS8A 4BRKA 4H5RA 1BG3A 3ZEUB 4YOWA 5M1PA 2E88A 1KQSM 4WQ4A 4F9OA 2CH6A 1MDUB 4I6MB 4CZMA 3UKRA 2V52B 2QWQA 5EX5A 3ENHA 2P9LA 1BUPA 3QICA 3VF6A 5AQTA 2Q36A 3GL1A 4DB3A 3QBXA 1VAZA 2QM1A 2W40A 4M7XA 1RGIA 3N4QA 4Y0WA 4BG9A 5JLFA 3CPEA 3CCRN 4CZEA 1U2VA 1C0FA 2KLAA 2WC9A 3OHRA 1NM1A 1SAZA 2YJEA 4G9ZA 4CBWA 1VQ6N 1ZC6A 4BG8A 1HKBA 2P9UB 1HUXA 4L3QA 5GAEP 4BC3A 4ISFA 3H6EA 1BA1A 3CJBA 5FPNA 1KAXA 3WXMB 4BR0A 1VQMN 1BDGA 1YI2N 4QS9A 2IVOA 2FXUA 3WXLA 3WXKA 5C12A 3CQXA 4PL7A 3CXCM 1SS6A 4YORA 1IG8A 1QQMA 3F5TA 1DGKN 1E4FT 1NGAA 1XC3A 2A42A 3MX5A 4BEBA 3BUZB 3SMSA 1CZAN 2A6AA 2P9SB 2BH1A 4FWMA 2YHXA 3R6MA 1VQ8N 3WT0A 2P9IA 2QWOA 4DKWA 1OKJA 4Z94A 3I33A 4GVEA 3K9JA 3NVKA 1H1VA 4WQ4C 2A41A 2ITMA 2ZJPL 3ZYYX 3J7ZO 3KZBA 1GLBG 4WFNL 2CGJA 1BA0A 3Q7BA 4DHYA 3O1WA 3D6RA 1VQ9N 4NO7A 5KQDA 3LM2A 1BU6O 2FF3B 3E9LA 5AZIB 4IO9L 3VESA 2Q2RA 5ADXH 3DXMA 4H0OA 3W3DA 3SJHA 2IIRA 5AZJB 5F1XA 3FZLA 1YIJN 4K25A 1NLVA 3DXKB 4B1ZA 3U9DA 3WXJA 5GINA 2F9WA 5B8HA 1KC8O 2FLOA 3WEEB 2JWLA 1SZ2A 2Q1NA 3BP8A 4RCHA 3D2EB 5AQUA 3O4WA 2RE2A 2QWRA 4XH1A 4BGAA 4BRAA 5BPLA 4UY8O 2OTJN 3PLAA 1NGIA 4YOYA 5HOOA 4JD2A 3QFUA 2VCPA 1GLLO 2D0OA 4CBUA 1RFQA 3R3LA 5C2FA 1Q7YO 2YHYA 3M6GA 4MO5A 1XUPO 3C0BA 3SAFA 4JHDB 4ISGA 4ILHA 3TSQA 5ADXA 4IOAL 1NGBA 2C1IA 1E4GT 3HSCA 3ZX3A 3G25A 4BRQA 3LDLA 3VENA 1NWKA 4FWPA 4IZ9A 4B1YB 1WUAA 3H46O 3IUCA 3U8XA 3ZETB 3PIOL 1YITN 1M1KO 4I6MA 2I7NA 4U67L 2DPNA 5E26A 4A2AA 1YJWN 3FZMA 2E20A 3CIPA 2P9LB 5MLCQ 1TUYA 4YOVA 4OPHA 4IEEA 4WQ5A 1HLUA 3MCAB 2A5XA 4NB4A 4ISEA 3AGKA 4JK8A 1VQ7N 1JCFA 3G4SN 1ZBSA 5AQLA 3CJ7A 3O8MA 4B1VA 3C6AA 4BRHA 3HBTA 1RDUA 2P9UA 4H5WA 3R1XA 4RTFD 3FGUA 1GLJO 3MWTA 3QMLA 3G71N 2YCHA 2KHOA 3AAQA 3B8AX 4C23A 5AQPA 3SK3A 4BRDA 3VETA 4YDUC 3MCPA 4BE7B 2C1GA 4BR2A 3FZKA 4JKBA 2UYTA 4FO0A 3K9KA 4EHUA 2V7ZA 4JKDA 2QW9A 1O13A 4ILJA 4BR7A 3CD6N 2Q0RA 1YHQN 1MWKA 4BRCA 3CC7N 4CJ7A 2Q31A 2GWJA 3CQYA 4H0PA 1BWFO 1TUUA 3ENOA 2CGLA 1T6DA 1U6ZA 2NNWA 3DLLL 2KKZA 4JK9A 1VQPN 1P90A 2QI2A 1YVNA 3AARA 5AQXA 3DJCA 3AAPA 2GX9A 3O9SA 5BPNA 4FWQA 3KK7A 1JJ2M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZGY A;  1ATN A;  3GG4 A;  3CET A;  2J4R A;  5ELZ A;  4PL8 A;  3U4L A;  4BVP A;  1Z05 A;  5I9E B;  4WQ5 C;  2HMP A;  1NGC A;  4PKG A;  4XEI A;  1YAG A;  3MK6 A;  3CJA A;  5AQQ A;  1HJO A;  1R59 O;  4A61 A;  5AQV A;  2CGK A;  3D7E O;  3WQT A;  1K8K B;  3DWL A;  3CJC A;  3EO3 A;  3VEO A;  1HKG A;  3HI0 A;  1KAY A;  4BRM A;  4H03 B;  4MLE A;  1X3N A;  3UB5 A;  1NGJ A;  4MO4 A;  1WOQ A;  4XH4 A;  4CD3 A;  3BF1 A;  2VWB A;  2Q97 A;  3FFK B;  4FWS A;  3VF4 A;  3O1B A;  2EWS A;  4FWN A;  1NGG A;  2P9P B;  4JHD A;  2PBD A;  3HTV A;  3A5M C;  1ESV A;  1BO5 O;  4H0Y B;  4FOE A;  4CZF A;  4FWR A;  1ATR A;  5AFU A;  2P9K A;  2E1Y A;  1GLD G;  5KPZ A;  3WXI A;  2E8A A;  4QS7 A;  5JIC A;  2GWK A;  3D2F A;  3FE1 A;  2FSK A;  2YHW A;  4BC2 A;  4FL9 A;  3R9P A;  1NGD A;  1Y64 A;  2ZWH A;  4B1U B;  3CJ1 A;  3EZW A;  3GDQ A;  4HWI A;  3O6W A;  3VEW A;  4B9Q A;  5AQO A;  5KPR A;  4PKI A;  4H0X B;  1NGF A;  4A62 A;  2HF3 A;  3UE5 A;  5AQJ A;  5CE3 A;  3GBT A;  2E2O A;  3LDQ A;  4FWO A;  1YUW A;  1V4T A;  4KBO A;  5JMV A;  2ASM A;  5FPE A;  2F9T A;  1QZ5 A;  2H3G X;  2E2P A;  5BN8 A;  1EQY A;  4AM7 A;  5BRD A;  3TPQ A;  1TYQ A;  1NBW A;  2QWL A;  1ATS A;  2NLX A;  1HKC A;  4BRF A;  2A3Z A;  1QZ6 A;  3L0Q A;  3H3O B;  3VEX A;  4BC4 A;  3O5B A;  4H0T B;  3VPZ A;  1GLC G;  4CI6 A;  2AA4 A;  5E84 A;  2A40 A;  1NMD A;  4O8K A;  4EIA A;  4BVO A;  3C7N B;  3ATU A;  5F2R A;  4GNI A;  3VGM A;  2P9S A;  3JS6 A;  5AQF A;  3UKU A;  3QDK A;  3R8E A;  3W0L A;  2YJF A;  1V4S A;  2QWP A;  1U2V B;  3M1F A;  3O08 A;  1ZXO A;  3FLC O;  4YDU A;  5AQS A;  5AQI A;  2W41 A;  1S22 A;  4BRI A;  2YI1 A;  2BTF A;  3JXU A;  1X9J A;  1KXP A;  5AQK A;  3HM8 A;  3LL3 A;  3VEV A;  3EKS A;  3ATV A;  1DKG D;  4B1X B;  1NGH A;  4BQL A;  5KQ8 A;  1D4X A;  2OAN A;  3DXM B;  5AQM A;  1XQS C;  5FPM A;  2D0P A;  2IVN A;  3A5O C;  3DXK A;  1LCU A;  3H45 C;  2WUS A;  2FF6 A;  3EL2 A;  3KVG A;  3EKU A;  4HTL A;  5EXW A;  3SMP A;  2P9P A;  4FPA A;  3WEE A;  2I7P A;  3MN7 A;  2BUP A;  3D2E A;  5BRH A;  1G99 A;  4K42 A;  3S41 A;  2D1K A;  4A2B A;  1X3M A;  3ULE B;  4CZG A;  4H5V A;  3QB0 A;  3QBW A;  1P8Z A;  4CZK A;  4JN4 A;  5AQZ A;  5BN9 A;  3H1V X;  4M63 C;  3RSE A;  3M3Z A;  4CD1 A;  3VER A;  5BR9 A;  5LJW A;  3LDO A;  4BRP A;  3ZX0 A;  5BRF A;  4CZH A;  1GLE G;  5LJV A;  4O5F A;  2P9N B;  3J8A A;  3CER A;  4BQZ A;  1Q18 A;  3GOI A;  4H5N A;  1MA9 B;  4JD2 B;  3H3N O;  2ZGZ A;  3HZ6 A;  4EHT A;  2E2N A;  1LOT B;  1S3X A;  4CZI A;  5EY4 A;  3IFR A;  4K41 A;  3VEY A;  3BF3 A;  4AM6 A;  4FWL A;  1C0G A;  2ASP A;  4CZJ A;  3VGK A;  3BEX A;  3ZET A;  3H1Q A;  1JCE A;  3A5N C;  3WUH A;  3IDH A;  5BPM A;  1T44 A;  3F9M A;  4BR5 A;  2D4W A;  2AP1 A;  3GE1 A;  3C7N A;  3LDP A;  3WQU A;  3CHW A;  3ZEU A;  2Q0U A;  2IVP A;  1NGE A;  3QFP A;  5F0X A;  3UKR B;  3VGL A;  4IO8 A;  2NZT A;  3FZF A;  3I8B A;  4BRO A;  3A0I X;  4BR9 A;  4FOI A;  5KPT A;  4FWK A;  4H0V B;  4BC5 A;  5AQR A;  4EFH A;  2QWM A;  3CJ9 A;  3VOV A;  1GLF O;  3L4I A;  4FPB A;  2ZF5 O;  4IWV A;  2GTD A;  3CI5 A;  4BRG A;  4B1W B;  1QHA A;  4IXC A;  1SQK A;  3LM9 A;  5BRE A;  2GEL A;  4IJA A;  4M7Y A;  3TU5 A;  2GUP A;  5AQH A;  1MWM A;  3KHY A;  2FSJ A;  1J6Z A;  2V51 B;  3AY9 A;  4BRN A;  1DEJ A;  1K8K A;  4E1J A;  1IJJ A;  4EAH D;  4BGB A;  2V7Y A;  5EOY A;  5FPD A;  4JAX A;  2NRH A;  3EN9 A;  4H5T A;  4XH5 A;  2HOE A;  2P9I B;  4RWT A;  5AQN A;  3ULE A;  3FZH A;  3U9Z A;  4WYB A;  1KAZ A;  3FR0 A;  3A5L C;  3DAW A;  3MDQ A;  5AFU H;  2PAV A;  3MN5 A;  4FSV A;  3MN9 A;  3RSE B;  3VEZ A;  5EVZ A;  4MLH A;  3VF2 A;  5JLH A;  1RDW X;  4LC9 B;  1T6C A;  3ID8 A;  4CZL A;  4BR4 A;  5AZI A;  3SLC A;  1Z6R A;  3LDN A;  2QXL A;  2P9N A;  1YXQ A;  1GLA G;  5AQY A;  4GY2 B;  3L6Q A;  5AZJ A;  1BOT O;  2VYP A;  5LY3 A;  3MMV A;  5AQG A;  4BRL A;  3ZX2 A;  4CBX A;  4J8F A;  2E1Z A;  3A8Y A;  2QWN A;  3P4I A;  4IJN A;  2FSN A;  1QQN A;  1JCG A;  2P9K B;  4DCH A;  4DQ8 A;  4BRE A;  5AQW A;  1HPM A;  5AR0 A;  2E2Q A;  3D2F B;  3MN6 A;  4K43 A;  3O80 A;  1HX1 A;  4JNE A;  5TKY A;  1TYQ B;  2ASO A;  3IMX A;  2GEM A;  2HF4 A;  1QQO A;  2CH5 A;  4PKH A;  4QS8 A;  4BRK A;  4H5R A;  1BG3 A;  3ZEU B;  2E88 A;  4WQ4 A;  4F9O A;  2CH6 A;  1MDU B;  4I6M B;  4CZM A;  3UKR A;  2V52 B;  2QWQ A;  5EX5 A;  3ENH A;  2P9L A;  1BUP A;  3QIC A;  3VF6 A;  5AQT A;  2Q36 A;  3GL1 A;  4DB3 A;  3QBX A;  2QM1 A;  2W40 A;  4M7X A;  1RGI A;  4Y0W A;  4BG9 A;  5JLF A;  4CZE A;  1U2V A;  1C0F A;  3OHR A;  1NM1 A;  1SAZ A;  2YJE A;  4CBW A;  1ZC6 A;  4BG8 A;  1HKB A;  2P9U B;  1HUX A;  4L3Q A;  4BC3 A;  4ISF A;  3H6E A;  1BA1 A;  3CJB A;  5FPN A;  1KAX A;  4BR0 A;  1BDG A;  4QS9 A;  2IVO A;  2FXU A;  3WXL A;  3WXK A;  3CQX A;  4PL7 A;  1IG8 A;  1QQM A;  1DGK N;  1E4F T;  1NGA A;  1XC3 A;  2A42 A;  3BUZ B;  3SMS A;  1CZA N;  2A6A A;  2P9S B;  4FWM A;  2YHX A;  3R6M A;  3WT0 A;  2P9I A;  2QWO A;  1OKJ A;  4Z94 A;  3I33 A;  1H1V A;  4WQ4 C;  2A41 A;  2ITM A;  3KZB A;  1GLB G;  2CGJ A;  1BA0 A;  4DHY A;  3O1W A;  4NO7 A;  5KQD A;  3LM2 A;  1BU6 O;  2FF3 B;  5AZI B;  3VES A;  2Q2R A;  5ADX H;  3DXM A;  4H0O A;  3W3D A;  3SJH A;  2IIR A;  5AZJ B;  5F1X A;  3FZL A;  4K25 A;  1NLV A;  3DXK B;  4B1Z A;  3U9D A;  3WXJ A;  2F9W A;  5B8H A;  2FLO A;  3WEE B;  2Q1N A;  1SZ2 A;  3BP8 A;  4RCH A;  5AQU A;  3D2E B;  4BGA A;  3O4W A;  5BPL A;  2QWR A;  4XH1 A;  4BRA A;  1NGI A;  4JD2 A;  3QFU A;  2VCP A;  1GLL O;  2D0O A;  4CBU A;  1RFQ A;  2YHY A;  3M6G A;  4MO5 A;  1XUP O;  3C0B A;  4JHD B;  4ISG A;  5ADX A;  1NGB A;  1E4G T;  3HSC A;  3ZX3 A;  3G25 A;  4BRQ A;  3LDL A;  3VEN A;  1NWK A;  4FWP A;  4IZ9 A;  4B1Y B;  1WUA A;  3H46 O;  3IUC A;  3U8X A;  3ZET B;  4I6M A;  2I7N A;  2DPN A;  5E26 A;  4A2A A;  3FZM A;  2E20 A;  3CIP A;  2P9L B;  1TUY A;  4WQ5 A;  1HLU A;  2A5X A;  4NB4 A;  4ISE A;  1JCF A;  1ZBS A;  5AQL A;  3CJ7 A;  3O8M A;  4B1V A;  4BRH A;  3HBT A;  2P9U A;  4H5W A;  4RTF D;  3FGU A;  1GLJ O;  3QML A;  2YCH A;  2KHO A;  3AAQ A;  3B8A X;  4C23 A;  5AQP A;  3SK3 A;  4BRD A;  3VET A;  4YDU C;  3MCP A;  4BR2 A;  3FZK A;  2UYT A;  4FO0 A;  4EHU A;  2V7Z A;  2QW9 A;  4BR7 A;  2Q0R A;  1MWK A;  4BRC A;  4CJ7 A;  2Q31 A;  2GWJ A;  3CQY A;  4H0P A;  1BWF O;  1TUU A;  3ENO A;  2CGL A;  1T6D A;  1U6Z A;  1YVN A;  3AAR A;  5AQX A;  3DJC A;  3AAP A;  5BPN A;  4FWQ A;  3UKU B; 
#chains in the Genus database with same CATH topology
 4C1N I;  1ATN A;  3GG4 A;  2J4R A;  5ELZ A;  1RIL A;  3U4L A;  4B3R K;  4BVP A;  4WQ5 C;  4E19 A;  5M1Q A;  1TAU A;  1LAW A;  1YAG A;  3CC4 N;  5DM6 L;  2QKB A;  3CJA A;  3Q7C A;  4PA1 A;  3OYL A;  3AVA A;  3DWL A;  3EO3 A;  5FRO A;  1ZBI A;  2F8T A;  3BF1 A;  1HNV A;  5J2N A;  4LSN A;  2Q97 A;  1NOZ A;  4O4G A;  3EY1 A;  3CCQ N;  3TAF A;  4HVJ A;  4DLE A;  2EWS A;  3DM2 A;  1T8E A;  1BO5 O;  2PFU A;  4WFA L;  4FOE A;  5M1N A;  1HYS A;  4LF7 K;  1RT1 A;  5KPZ A;  4Z4C A;  4FJM A;  3CFR A;  3OJS A;  3D2F A;  1SKR A;  2VWK A;  1ZBF A;  2UUB K;  3DOK A;  4BC2 A;  4FL9 A;  3R9P A;  1Y64 A;  4B1U B;  3AVN A;  4G1Q A;  3O6W A;  4DTN A;  3VEW A;  4B9Q A;  5AQO A;  1OVQ A;  2HHQ A;  4XIU A;  1NJI O;  3M8S A;  3MX2 A;  5AQJ A;  3C95 A;  3PSF A;  5CE3 A;  3GBT A;  3LDQ A;  1LWE A;  3LP0 A;  5JMV A;  1RBS A;  2B5J A;  4IFV A;  1C0U A;  4CGG A;  5BN8 A;  4W5R A;  3RWU A;  2OA8 A;  1DTT A;  4KHU A;  1L3V A;  2YX6 A;  1BIZ A;  1LWF A;  1S1X A;  2QWL A;  1ATS A;  2NLX A;  4H0T B;  1GLC G;  4FM2 A;  1W9H A;  4CI6 A;  1NMD A;  3L2V A;  5F2R A;  3RMD A;  4J2E A;  3UKU A;  3R8E A;  3VQP A;  3KD1 E;  4WFB L;  3HRG A;  2OPQ A;  4AHV A;  5AQS A;  4DFK A;  4JKG A;  4BRI A;  2YI1 A;  2OCE A;  4KHS A;  4KI6 A;  3EKS A;  3RR8 A;  2UXD K;  1WBB A;  3DRR A;  3O9Q A;  1ITG A;  3ULD A;  2X78 A;  4IKF A;  1U4B A;  3BDP A;  2O8F A;  2KQ2 A;  3DXM B;  5SZT A;  2O8D B;  5FPM A;  4CEF A;  3A5O C;  2IVN A;  4DU3 A;  3H45 C;  1LW2 A;  2FF6 A;  2F96 A;  5TKW A;  2FBX A;  4C1N K;  2P9P A;  4DF8 A;  1S6P A;  2I7P A;  4DTS A;  4DTM A;  1KLN A;  1FXX A;  4OO1 J;  3S41 A;  1HNW K;  3HK2 A;  1XMO K;  1A5V A;  3DMJ A;  1P8Z A;  3DRS A;  5AQZ A;  2G8K A;  2O8C B;  2WOM A;  3RSE A;  1RT7 A;  4GMJ B;  3T1H K;  4M45 A;  5BR9 A;  3TAG A;  1VRU A;  2FBV A;  1FK9 A;  3VQ5 A;  3ZX0 A;  3PSI A;  1VSD A;  4FCY A;  2PY5 A;  3K57 A;  3OW2 M;  1HPZ A;  4KH4 A;  3GOI A;  4H5N A;  4JD2 B;  4K8X A;  3H3N O;  2ZGZ A;  2F8S A;  1VQ4 N;  3HZ6 A;  1TKD A;  4FXD A;  1C0M A;  1YT3 A;  4YFU A;  2YNG A;  3VEY A;  3BF3 A;  4AM6 A;  1KFS A;  1XNQ K;  4FWL A;  2ASP A;  3VGK A;  4HHT A;  3DLE A;  1JLC A;  3ZET A;  1QE1 A;  2XO7 A;  3A5N C;  3IDH A;  3CC2 N;  3F9M A;  4DV6 K;  1XNR K;  3MXI A;  3GE1 A;  3C7N A;  3LDP A;  3ZEU A;  3CHW A;  2Q0U A;  1FKP A;  1NGE A;  4KI4 A;  5IWA K;  2NRX A;  2NZT A;  4GW6 A;  3G6E N;  2YKM A;  3FZF A;  4BRO A;  1NKE A;  4J2A A;  4DTJ A;  4CEC A;  5KPT A;  4FWK A;  3MEC A;  4BC5 A;  3ZT2 A;  2QWM A;  3QIO A;  1VSM A;  5GIO A;  3D0P A;  1IBK K;  4C8K A;  3QEI A;  1TL1 A;  3V9U A;  1IG9 A;  4FW1 A;  3V1Q A;  1J53 A;  3VTI A;  4M7Y A;  1Q81 O;  4B8A B;  3TU5 A;  2HBJ A;  5AQH A;  2FSJ A;  2XHB A;  1C1A A;  4CEQ A;  3BZK A;  3AY9 A;  1ZBU A;  1DEJ A;  4BRN A;  2NRH A;  3EN9 A;  4H5T A;  3ZSV A;  4DWI A;  2IS3 A;  3CCS N;  4FLT A;  1UAX A;  4WYB A;  4KH5 A;  3A5L C;  3MDQ A;  3MN5 A;  4FSV A;  4DSK A;  3VEZ A;  4HTU A;  4YOT A;  4H4M A;  3VF2 A;  1TGO A;  2HBM A;  4EZ6 A;  4OGE A;  3VTH A;  3OBY A;  3C94 A;  3ITH A;  1T05 A;  5AZJ A;  3MXM A;  2HST A;  1BOT O;  4BAC A;  4DSL A;  1VSH A;  2O4I A;  1WSH A;  3JAM O;  3MMV A;  4BRL A;  4DQR A;  3O3H A;  3C6H A;  5HL7 L;  3KLF A;  3P4I A;  3HYF A;  1VQ8 N;  5E41 A;  1T3V A;  3OYN A;  3E9P A;  5AQW A;  3P5J A;  3LZI A;  3MN6 A;  4CEA A;  4K43 A;  4RW6 A;  4KHQ A;  3LAM A;  1VQ5 N;  2HHV A;  1I39 A;  1VSE A;  3EYZ A;  2GEM A;  2A1S A;  2HF4 A;  4BRK A;  4M3Y A;  4MFB A;  1EXQ A;  2HHH K;  3SYZ A;  4WQ4 A;  3DLG A;  4GKJ K;  2HHW A;  4ID1 A;  1T7P A;  3AVC A;  3VF6 A;  5C24 A;  2KFN A;  3B6O A;  3QBX A;  1J5O A;  4DFP A;  4M7X A;  3K0S A;  3CCR N;  2G8H A;  3M8Q A;  2KZM A;  1C0F A;  2KLA A;  2WC9 A;  1NM1 A;  1SAZ A;  2YJE A;  1SKW A;  2QK9 A;  2YNF A;  2P9U B;  4BC3 A;  4ISF A;  3H6E A;  2IOC A;  3NH0 A;  3SQ1 A;  1KAX A;  4DU4 A;  4FJ5 A;  1VSF A;  1N36 K;  3F9K A;  4PL7 A;  1JXE A;  4DQS A;  1QQM A;  3NBP A;  5KI6 A;  3QEX A;  3RRG A;  3NFA A;  4RG8 A;  2A6A A;  2P9S B;  3NDK A;  1TK5 A;  2YHX A;  2P9I A;  3K58 A;  5C25 A;  2VWJ A;  3ZLJ A;  2QWO A;  4OLA A;  1OKJ A;  1J54 A;  3NVK A;  1RTH A;  2O8E B;  2GV9 A;  4WQ4 C;  2IDO A;  4M41 A;  3DLR A;  3ZYY X;  3J7Z O;  4FM0 A;  1MU2 A;  1GLB G;  4DV0 K;  4DHY A;  4DMN A;  3D6R A;  2VQF K;  3LM2 A;  1KFD A;  2FF3 B;  3E9L A;  2P51 A;  4PQU A;  2O8C A;  4CK1 A;  4H0O A;  1Y97 A;  1YIJ N;  3RR7 A;  3DXK B;  4B1Z A;  3PX0 A;  4QAG A;  2FLO A;  4X65 K;  2D0A A;  2Q1N A;  4RCH A;  4KHW A;  1OH6 A;  4XH1 A;  4KTZ A;  2OTJ N;  4DSE A;  1NGI A;  3L8B A;  5HP1 A;  4JD2 A;  3KD5 E;  4CJU A;  5C2F A;  3M6G A;  3C0B A;  1UA1 A;  1E4G T;  4IZ9 A;  3VQC A;  1NKB A;  4BE1 A;  3IUC A;  3U8X A;  3ZET B;  3K5L A;  2DPN A;  1GOC A;  3LP1 A;  4M3Z A;  2P9L B;  3VQ6 A;  3P1G A;  4I9L A;  4MQ3 A;  3MCA B;  4ISE A;  4AHT A;  1BQN A;  3MEG A;  3CJ7 A;  4FLX A;  3O8M A;  3S3N A;  3C6A A;  4H5W A;  1IBL K;  4PY5 A;  3QML A;  1RBT A;  1IKX A;  3SV4 A;  3MCP A;  3OYE A;  3VQ8 A;  2C1G A;  4BR2 A;  4IDK A;  3K9K A;  4KHY A;  1O13 A;  3CD6 N;  4CJ7 A;  4H0P A;  1B9F A;  1SUQ A;  3J80 O;  1U6Z A;  2NNW A;  4B8C A;  4JK9 A;  1VQP N;  3OYD A;  1YVN A;  3AAR A;  1X9W A;  3O9S A;  1W7A A;  3KK7 A;  2ZGY A;  3DLK A;  4CFD A;  1Z05 A;  5I9E B;  3LAK A;  1NGC A;  4XEI A;  1YTA A;  1D5A A;  2YV0 X;  1TKT A;  1R59 O;  4DV2 K;  5AQV A;  3T3F A;  3VEO A;  1HKG A;  4FLY A;  3V9S A;  3KWG A;  2Q3S A;  1X3N A;  1VQK N;  1NGJ A;  4Q0B A;  4GVM A;  1N33 K;  4JI1 K;  3EE8 A;  3ZSZ A;  3FFK B;  4FWS A;  4LD0 A;  3TAM A;  4DV3 K;  2GBZ A;  3O1B A;  1KRP A;  1CZ9 A;  4YOU A;  2RF2 A;  1ESV A;  3CM6 A;  4OKK A;  4H0Y B;  5SWM A;  2JWK A;  5GAD P;  1ATR A;  1XHZ A;  1BQM A;  4UQG A;  1GLD G;  2F4V K;  1WSE A;  4QS7 A;  2NRT A;  2GWK A;  4JI4 K;  2FSK A;  4DTP A;  3CJ1 A;  4CEE A;  3GDQ A;  4Y1C A;  4CW7 B;  1EKE A;  3HVT A;  3V6D A;  4PKI A;  3CG7 A;  4Z4E A;  2HF3 A;  3C6T A;  4DS4 A;  1SL0 A;  3SBT A;  2E2O A;  3SCX A;  4IOC L;  4CJ5 A;  2XY5 A;  3TSP A;  1NJW A;  5IT9 O;  2F9T A;  1EQY A;  3HP6 A;  3LWL A;  1TYQ A;  2WBN A;  3NE6 A;  1VQL N;  3RVC A;  4BRF A;  2A3Z A;  2RN2 A;  5DK5 A;  5LL6 Z;  3VEX A;  3ZSY A;  4PWD A;  2VGN A;  3E66 A;  3O5B A;  4FJ9 A;  2HBL A;  3K5O A;  2AA4 A;  3QEV A;  1BIS A;  2A40 A;  2VQE K;  4JKH A;  4K8Z A;  3ATU A;  4GNI A;  3QNO A;  1JLE A;  2P9S A;  3JS6 A;  4DV4 K;  1V4S A;  1U2V B;  2DFF A;  4JK7 A;  4HUE A;  3AVK A;  5AQI A;  1S22 A;  1TV6 A;  1X9J A;  3JXU A;  4JI0 K;  1KXP A;  3ZSW A;  2O8E A;  4DTX A;  1UWB A;  1HRH A;  3SV3 A;  2HHX A;  4O0I A;  1RT2 A;  4DS5 A;  2Z1G A;  3EZ5 A;  3ZSQ A;  2ZQB A;  5KQ8 A;  1W97 L;  1TAQ A;  3OJU A;  1XQS C;  4J2D A;  3DXK A;  4CEO A;  3SNN A;  2WUS A;  4IEI A;  3LPT A;  4R79 A;  2B4J A;  5BRH A;  1G99 A;  1WSI A;  5J1E A;  4JEP A;  1RT5 A;  2D1K A;  4IG0 A;  4A2B A;  3MWP A;  2QEX N;  3O9U A;  5LMN K;  4KKO A;  4BWJ A;  3AVG A;  2HW3 A;  3M3Z A;  4CD1 A;  3LP2 A;  3SAG A;  3VER A;  4BRP A;  4ELV A;  1WN7 A;  4W5Q A;  1Z26 A;  5LJV A;  4MDB A;  4NYF A;  2P9N B;  3V81 A;  3TAN A;  3J8A A;  2EHG A;  4BQZ A;  4CK2 A;  1A5X A;  3OS0 A;  1C1C A;  3VMF B;  4DSF A;  4CF0 A;  3T1Y K;  2E2N A;  3PV8 A;  3O9T A;  1S3X A;  4CZI A;  2OZS A;  4FJJ A;  3IFR A;  4K41 A;  3TAE A;  3TAP A;  2EX3 A;  4CZJ A;  4J2B A;  5LMU K;  3AV9 A;  3H1Q A;  3WUH A;  2G8V A;  3CMA N;  3S3O A;  4BR5 A;  4HCC A;  1ASV A;  2D4W A;  1KVA A;  4B9T A;  1C1B A;  4HUF A;  4LF5 K;  3UKR B;  4NXM K;  4IO8 A;  4A57 A;  5FLX O;  4DR7 K;  3CM5 A;  3I8B A;  1QVG M;  3A0I X;  4NCB A;  3OYA A;  4FOI A;  3G10 A;  2VGM A;  3UIQ A;  3VN5 A;  3OBW A;  1NNE A;  3EEQ A;  4LF4 K;  4DR1 K;  1RT3 A;  3SQ2 A;  1NG9 A;  3QER A;  2ZF5 O;  3P39 A;  3KK2 A;  3CI5 A;  1UA0 A;  3QLH A;  1C6V A;  3THY B;  1NK6 A;  4LF8 K;  2O8F B;  1J9A A;  3LM9 A;  5BRE A;  3L3U A;  2GEL A;  4IJA A;  3S3M A;  1MWM A;  2W00 A;  4IDH A;  2DTU A;  1BI4 A;  4EAH D;  4BGB A;  5FPD A;  2KTQ A;  1CXU A;  4CJ4 A;  2GUI A;  4FM1 A;  3WNE A;  3TTD A;  1ZBL A;  4XH5 A;  2HOE A;  1N5Y A;  3NMU A;  4WCE L;  3I0R A;  4AHC A;  3T69 A;  2BE2 A;  3FZH A;  5C2D A;  1QS4 A;  5CHI A;  3V9Z A;  3SJJ A;  4JRP A;  3CCU N;  1Q9Y A;  2G8U A;  2PAV A;  1Q9X A;  3RSE B;  3P83 D;  2ZE2 A;  5EVZ A;  4FJL A;  1RDW X;  1JLA A;  3VQQ A;  4LC9 B;  1VK0 A;  1T6C A;  3ID8 A;  1Z6R A;  3LDN A;  2QXL A;  5AQY A;  1JXB A;  4O0J A;  1LAV A;  4GV9 A;  4F2S A;  3KKS A;  1N6Q A;  5LY3 A;  3O3F A;  3CCM N;  4FJN A;  1BHL A;  5M1O A;  3AVM A;  3HOS A;  4H4O A;  5M1F A;  1OVY A;  1VHX A;  4M3T A;  4JKC A;  4DQ8 A;  2E2Q A;  1YJ9 N;  1HX1 A;  5TKY A;  1TYQ B;  3IMX A;  1N8R O;  4NYN A;  4DF4 A;  2CH5 A;  2XY8 A;  4H5R A;  3ZEU B;  5M1P A;  2E88 A;  1FW6 A;  1KQS M;  1U45 A;  2FBT A;  4N47 A;  3JYT A;  3T19 A;  4TSX A;  1HQU A;  1QTM A;  5AQT A;  1KVC A;  2E6L A;  1NU0 A;  1VAZ A;  4BG9 A;  4Y0W A;  2UUA K;  4DFM A;  1B9D A;  5JLF A;  1U2V A;  4NXN K;  5FRM A;  2E5L K;  3ZSR A;  1ZC6 A;  4BG8 A;  1HKB A;  4L3Q A;  4LFB K;  3CJB A;  5FPN A;  1VQM N;  1BDG A;  4OGC A;  4QS9 A;  4AHR A;  1YI2 N;  2IVO A;  3WXK A;  2FXU A;  4W5O A;  1CXQ A;  3J7A P;  3CQX A;  3CXC M;  4I2Q A;  1SS6 A;  4OJR A;  4C8N A;  1IG8 A;  1DGK N;  1XC3 A;  3DLB A;  2A42 A;  3MX5 A;  2BH1 A;  4AHU A;  4FJ7 A;  2VG7 A;  3IRX A;  1IV0 A;  5K14 A;  3TI0 A;  3OY9 A;  4DKW A;  4CFC A;  4YY3 K;  4Z94 A;  3I33 A;  2FBY A;  4OKE A;  3AVL A;  2ITM A;  1FJG K;  4FLZ A;  2CGJ A;  3Q7B A;  5KQD A;  4E7K A;  4CHN A;  3VES A;  5ADX H;  3W3D A;  2IIR A;  5AZJ B;  3FZL A;  1NLV A;  5GIN A;  3SPZ A;  5B8H A;  1XC9 A;  1SZ2 A;  3BP8 A;  4CJS A;  3D2E B;  5AQU A;  3VQ7 A;  2RE2 A;  2QWR A;  4BRA A;  1XMQ K;  4ZTF A;  4CF1 A;  4CJ3 A;  1GOA A;  5D3G A;  4CBU A;  1RFQ A;  3R3L A;  2G8W A;  3V4I A;  3SQ0 A;  1XUP O;  4FZZ A;  4E0D A;  4JHD B;  4ILH A;  3ZT3 A;  4E7J A;  1NGB A;  3VQA A;  3G25 A;  1OH5 A;  1L5U A;  1EWR A;  3KIO A;  1M1K O;  4CHY A;  2I7N A;  1YJW N;  3KLI A;  1QHT A;  3CIP A;  2UXB K;  1TUY A;  3AO5 A;  3OS1 A;  2XY7 A;  3L2W A;  1ZBS A;  3AVF A;  5AQL A;  4KB0 A;  4BDY A;  1RDU A;  2P9U A;  4OPJ A;  4H8K A;  2UXC K;  3FGU A;  1GLJ O;  3MWT A;  3G71 N;  3V1R A;  3B8A X;  4C23 A;  3AA4 A;  3SK3 A;  3VET A;  4YDU C;  1NK5 A;  1NK0 A;  3D45 A;  1HQE A;  4FO0 A;  4EHU A;  2QW9 A;  4ILJ A;  4BR7 A;  2Q0R A;  2OYQ A;  5HBM A;  4IBN A;  4BRC A;  3CC7 N;  2OPS A;  2Q31 A;  3ENO A;  1X9S A;  2CGL A;  1NOY A;  2KKZ A;  4Z0U A;  2QI2 A;  3M8P A;  4ZTJ A;  2RKI A;  1JL1 A;  1NMN A;  3CET A;  5HRS A;  3DI6 A;  3JSM A;  3CFP A;  1NK9 A;  4GKK K;  4QOZ B;  4DR5 K;  2ITG A;  4PHT X;  1K9M O;  1WSF A;  3MK6 A;  1NJY A;  3WNG A;  5AQQ A;  1HJO A;  4CJE A;  3TSU A;  1VSJ A;  1IKW A;  4LSL A;  1KAY A;  4H03 B;  2BGG A;  1RDA A;  4JKE A;  1HYZ A;  1CZB A;  1WOQ A;  4XH4 A;  5CZ2 A;  3ZT4 A;  4B9M A;  2QXF A;  2HB5 A;  3DYA A;  5KGX A;  4B3T K;  4BE0 A;  3VF4 A;  1TL3 A;  3AO1 A;  1S72 N;  4FWN A;  2P1J A;  3TAB A;  3A5M C;  3WNF A;  4CZF A;  1VRT A;  2HNZ A;  3OYB A;  2E1Y A;  3WXI A;  2E8A A;  5JIC A;  5KRS A;  4DV1 K;  2D0B A;  4DG1 A;  4RW9 A;  1NGD A;  2D0C A;  4FJX A;  1A5W A;  1NK4 A;  4QCL A;  1HYV A;  4YOX A;  5KPR A;  2I5J A;  5M1K A;  4H0X B;  1XHX A;  1KD1 O;  2KFZ A;  4A62 A;  3CCV N;  4IG3 A;  1K8A O;  4KAZ A;  4OPK A;  1Q8I A;  4I2P A;  4FWO A;  1YUW A;  4CF2 A;  4KBO A;  5DMR A;  4CJW A;  2ASM A;  4EP4 A;  1Q86 O;  1QVF M;  3NCI A;  4B9N A;  3DOL A;  3T1A A;  3TPQ A;  4IFY A;  4Z4H A;  3OTO K;  2ETJ A;  1QZ6 A;  4KTQ A;  3O4Q A;  4BC4 A;  2IAJ A;  4CED A;  3VPZ A;  2F7T A;  1WSJ A;  4FW2 A;  1C0T A;  4FVM A;  5E84 A;  2PZS A;  3OYM A;  1K6Y A;  4JKF A;  4O8K A;  4B08 A;  4BVO A;  3F2K A;  3RTV A;  1OH8 A;  3HP9 A;  1X1P A;  5J2P A;  5AQF A;  3QDK A;  3W0L A;  3M1F A;  3O08 A;  1U48 A;  2ZJR L;  1ZXO A;  3FLC O;  4YDU A;  2JGU A;  1BGX T;  3VEV A;  5JVG L;  3O3G A;  4CE9 A;  3L4Q A;  3F73 A;  2E6M A;  4B1X B;  2NUB A;  4W5N A;  1S9E A;  3AO4 A;  3PIP L;  4DFJ A;  3AO2 A;  4CJT A;  4CCH A;  1D4X A;  4AHS A;  4FLV A;  3KLH A;  2OAN A;  4E7L A;  4ILG B;  5AQM A;  4DQI A;  2Z1H A;  5C15 A;  1RBR A;  2D0P A;  4ICL A;  2W42 A;  1LCU A;  1RT6 A;  5C10 A;  5HRO A;  3EL2 A;  5EXW A;  3SMP A;  4E3S A;  1RTJ A;  4BDZ A;  4FLU A;  3D2E A;  3IG1 A;  4OPA A;  1S1T A;  4K42 A;  4CJP A;  3AVB A;  4M3U A;  4W5T A;  3PO4 A;  3ULE B;  2QTD A;  3QBW A;  4JN4 A;  5BN9 A;  4FJG A;  3HJF A;  1DTQ A;  5LJW A;  3T7Z A;  3CPW M;  4XJX A;  3V9W A;  4CZH A;  1U49 A;  1GLE G;  1T03 A;  4O5F A;  4LY7 A;  4CER A;  3L2Q A;  3CER A;  3NH1 A;  1TKX A;  3NF6 A;  3O9R A;  1MA9 B;  3U3Y A;  5JS2 A;  2PYJ A;  3ID6 A;  4NCG A;  4DUZ K;  1LOT B;  4CIG A;  4IOX A;  5EY4 A;  1C0G A;  3TAR A;  2X74 A;  3CYG A;  3CF5 L;  4LH4 A;  1JCE A;  2HHU A;  3QEP A;  4JI8 K;  1W0H A;  5BPM A;  4M3R A;  1WAF A;  2AP1 A;  1QSL A;  2RHK A;  3NGZ A;  5HRN A;  4GV6 A;  3IAY A;  4Z4G A;  3E01 A;  4E72 A;  4FK0 A;  3QIN A;  4HCB A;  2YNH A;  1VSK A;  3CJ9 A;  3VOV A;  1GLF O;  3AGR A;  1E3M A;  4KTW A;  2ZM6 K;  4M3W A;  4IWV A;  2GTD A;  4AIL C;  4AF1 A;  3VA3 A;  3AVI A;  3C65 A;  1SQK A;  1ILY A;  4I9Q A;  2HVH A;  4O8U A;  1JLQ A;  2V51 B;  1XI1 A;  1HNI A;  1ZYQ A;  2V7Y A;  5EOY A;  3C6U A;  4JAX A;  1HNZ K;  2AJQ A;  4B9S A;  4KPY A;  4AQY K;  2WON A;  3U9Z A;  3KLE A;  1KAZ A;  3FFI A;  3FR0 A;  1KSP A;  3DAW A;  5AFU H;  4O55 A;  1RBU A;  2HHI A;  1SL1 A;  1EP4 A;  1NJX A;  2X6S A;  3AVH A;  4MLH A;  5JLH A;  1BL3 A;  2NRR A;  5I3U A;  3QNN A;  3E1Y A;  1YF5 L;  4BR4 A;  5AZI A;  3SLC A;  4ELT A;  2P9N A;  1YXQ A;  4GY2 B;  3L6Q A;  4FVU A;  3CYM A;  2VYP A;  3CME N;  4N41 A;  1J5E K;  3ZX2 A;  4J8F A;  1WAJ A;  2E1Z A;  3RRH A;  1QSS A;  1JKH A;  1ZBH A;  5HLF A;  1HMV A;  2QWN A;  2FSN A;  4A59 A;  2P9K B;  4DCH A;  4BRE A;  3L2U A;  1HPM A;  5AR0 A;  1U04 A;  2QA4 N;  3O80 A;  4JNE A;  4M42 A;  3NGY A;  1W2B M;  4PKH A;  1QSY A;  4CJF A;  3SI6 A;  2CH6 A;  4I6M B;  3UKR A;  4CGH A;  1JL2 A;  5J2M A;  3VQB A;  2QWQ A;  3ENH A;  1BUP A;  3NAE A;  4DR2 K;  4CJL A;  5EU7 A;  2Q36 A;  4CFB A;  3OYK A;  2W40 A;  2Y1J A;  3LZJ A;  4F4K A;  4CZE A;  1BCO A;  3OHR A;  2KZZ A;  1S9G A;  2HND A;  1HUX A;  5GAE P;  3THY A;  4BR0 A;  4DTR A;  1EET A;  3BY5 A;  3ASM A;  2HHS A;  3F5T A;  1BI4 B;  4FK4 A;  4BEB A;  3K59 A;  5CYQ A;  3R6M A;  3WT0 A;  5FDL A;  4X66 K;  2DY4 A;  4X64 K;  2P5G A;  1KLM A;  3ZT0 A;  4OKJ A;  1YTU A;  1H1V A;  2A41 A;  2IGI A;  1WNS A;  3SUN A;  3KZB A;  3QET A;  4WFN L;  1TK8 A;  4FYD A;  1WSG A;  3ZT1 A;  3KJV A;  1VQ9 N;  2UU9 K;  4NO7 A;  1BU6 O;  2OPR A;  1D8Y A;  2O8B B;  2Q2R A;  4FZX C;  3IS9 A;  4CIE A;  5F1X A;  4K25 A;  3WXJ A;  2HVI A;  3NF9 A;  1HR0 K;  1KC8 O;  3WEE B;  1KTQ A;  2UUC K;  1JLG A;  2JWL A;  4IOA L;  5BPL A;  4UY8 O;  3O4W A;  1S6Q A;  1CLQ A;  4YOY A;  5HOO A;  1RNH A;  3PX4 A;  1GLL O;  2D0O A;  1Q7Y O;  3AA2 A;  2YHY A;  3RMA A;  1L3S A;  4F2R A;  3HSC A;  4YNQ A;  4BRQ A;  3LDL A;  1SV5 A;  2KW4 A;  3VQ9 A;  3H46 O;  1RCH A;  3PIO L;  3RMB A;  5E26 A;  4A2A A;  3FZM A;  3A2F A;  4YOV A;  3NF7 A;  3J81 O;  1HLU A;  2IC3 A;  4Q5V A;  2BDP A;  4LFA K;  3QIP A;  4CHZ A;  4C8M A;  4NB4 A;  3AGK A;  1UOC A;  3PO5 A;  4B1V A;  4DV5 K;  3OYF A;  3HBT A;  3G0Z A;  3DRP A;  2DFH A;  3R1X A;  4FK2 A;  2A1R A;  1BIU A;  4AH9 A;  5AQP A;  5J2Q A;  3M8R A;  3AA5 X;  2Y1I A;  2V7Z A;  2XRI A;  4JKD A;  4K0K K;  1KVB A;  3PUF A;  2JLE A;  1MWK A;  2ATQ A;  4N5S A;  4DQQ A;  2R7Y A;  5FRN A;  2GWJ A;  3CQY A;  5HRR A;  1TUU A;  4FZY A;  1T6D A;  5CYM A;  2YHB A;  1JLB A;  4CJV A;  3SQ4 A;  1P90 A;  1IKY A;  3AAP A;  2GX9 A;  5BPN A;  4FWQ A;  1NKC A;  3UKU B;  4E1N A;  5BR8 K;  1EX4 A;  1K73 O;  3THV A;  4WE1 A;  4PL8 A;  1TK0 A;  1ASU A;  4CK3 A;  4JKG B;  2HMP A;  4PKG A;  4BY9 C;  1I94 K;  3K5M A;  1RTD A;  4CGD A;  2RPI A;  3B6P A;  4A61 A;  3VQE A;  2CGK A;  4E7H A;  4KH6 A;  5JVH L;  3D7E O;  3WQT A;  4DTO A;  1K8K B;  3CJC A;  1R0A A;  4Z4I A;  3HI0 A;  2DFE A;  3MEE A;  4BRM A;  4MLE A;  2YNI A;  4BE2 A;  3UB5 A;  5AJ3 K;  2HMI A;  4MO4 A;  4CD3 A;  3EE9 A;  2VWB A;  2E4L A;  4IFE A;  2W6K A;  4LFC K;  4JV5 K;  1HNX K;  4F8R A;  1NGG A;  2P9P B;  3CCE N;  4JHD A;  1YVU A;  2PBD A;  3THX A;  3HTV A;  1DLO A;  3KTQ A;  4FWR A;  1RBV A;  5AFU A;  1SL2 A;  2P9K A;  5T7B A;  1DT9 A;  5CZ1 A;  4N76 A;  4MDA A;  5CR4 A;  4CEB A;  3FE1 A;  3U6F A;  2YHW A;  3I55 N;  3HPO A;  3LAL A;  3HM9 A;  2ZWH A;  3EZW A;  4HWI A;  4JS4 A;  4CF8 A;  1NGF A;  3ZSX A;  3ISN C;  1L3T A;  3UE5 A;  1NJZ A;  1Z25 A;  2WTU A;  3MED A;  1V4T A;  3ZSO A;  4FJK A;  4JYA K;  3ENB A;  4CHP A;  5FPE A;  4JRQ A;  2H3G X;  1QZ5 A;  2NRW A;  2E2P A;  3MXJ A;  3CCL N;  1ASW A;  4KV8 A;  4A5B A;  4AM7 A;  5BRD A;  5C0Y A;  5DM7 L;  1Q82 O;  4JI3 K;  1NBW A;  1HKC A;  3OYJ A;  3L0Q A;  3H3O B;  3AO3 A;  3TAQ A;  1RDD A;  4CJQ A;  4LH5 A;  1JLF A;  2Z1I A;  4FJH A;  4EIA A;  1N34 K;  3C7N B;  3HPH A;  3VGM A;  4OLB A;  3TWH A;  5I42 A;  2YJF A;  2QWP A;  3HOT A;  3AVJ A;  4DQP A;  3P38 A;  2W41 A;  3HT3 A;  2BTF A;  4EZ9 A;  5AQK A;  3HM8 A;  3LL3 A;  1RDC A;  3P31 A;  4B9L A;  3ATV A;  4BEC A;  4CGF A;  3HO1 A;  1DKG D;  1G15 A;  3H08 A;  1NGH A;  4N56 A;  3V9X A;  4BQL A;  2O8B A;  4BWM A;  1EWQ A;  2ZJQ L;  1GOB A;  4CIF A;  4CES A;  1LW0 A;  3LPU A;  3S5T A;  3O4N A;  3KVG A;  3EKU A;  4HTL A;  3WEE A;  1WBD A;  4FPA A;  3V1O A;  3MN7 A;  2BUP A;  3KLG A;  2O4G A;  4JI5 K;  1X3M A;  2OPP A;  2HHT A;  4DSJ A;  2WFB A;  4CZG A;  1M90 O;  4H5V A;  4U7B A;  3QB0 A;  4F3T A;  4CZK A;  3NVM A;  3WNH A;  3H1V X;  4KB1 A;  4M63 C;  3OVN A;  5H1S Q;  3CCJ N;  4RW7 A;  4KRE A;  1VQO N;  3LDO A;  4A5A A;  2OTL N;  5BRF A;  4JI2 K;  2HNY A;  2PYL A;  4DU1 A;  1Q18 A;  3I0S A;  2FC0 A;  4YHH K;  4O44 A;  4EHT A;  5HRP A;  3N4P A;  4DSI A;  4E7I A;  3SUO A;  4B3M K;  4KFB A;  4CGI A;  4DLG A;  4CJR A;  3OYI A;  3TTC A;  3BEX A;  3VQD A;  4ELU A;  3QEW A;  4LF9 K;  4KRF A;  4JKA A;  1T44 A;  3LWM A;  1IBM K;  4JS5 A;  1YJN N;  3I56 N;  4DV7 K;  3OYG A;  4B9V A;  4L8R B;  2NRV A;  4DTU A;  3WQU A;  1OH7 A;  2IVP A;  3NHG A;  4GV3 A;  3QFP A;  5F0X A;  4EP5 A;  3KK3 A;  2W6L A;  3VGL A;  3OYC A;  1NK8 A;  1REV A;  5GIP A;  4BR9 A;  1VSL A;  3VQ4 A;  4H0V B;  5AQR A;  4EFH A;  4I7F A;  4LF6 K;  3AA3 A;  3L4I A;  4FPB A;  3TTF A;  1S5J A;  1D9D A;  4BRG A;  1VSI A;  2BAN A;  4B1W B;  1QHA A;  3THW B;  3IKM A;  4IXC A;  2YKN A;  2GUP A;  1F21 A;  3KHY A;  4NLC A;  4DR3 K;  1J6Z A;  4O5B A;  3J7Y P;  1K8K A;  4E1J A;  1IJJ A;  4CEZ A;  1RT4 A;  3SBG A;  3CFO A;  2P9I B;  4OVL A;  5KGW A;  4RWT A;  4X62 K;  5AQN A;  3ULE A;  2G8F A;  1S1V A;  1TKZ A;  3KWI A;  1RDB A;  1FKO A;  3THX B;  3E9O A;  3SZ2 A;  3MN9 A;  1IH7 A;  1EO1 A;  1HJR A;  2X6N A;  2Z1J A;  2HBK A;  3I8D A;  4CZL A;  1X9M A;  4DUY K;  1B92 A;  3HXM A;  3OA9 A;  1WLJ A;  5GAG P;  5GAH P;  4DR4 K;  1GLA G;  3SAH A;  2OZM A;  1QQC A;  5CY4 A;  1NK7 A;  3M5R A;  1BCM A;  4ID5 A;  4CBX A;  5AQG A;  1TVR A;  3MAQ A;  1WB9 A;  1VQN N;  1S1W A;  3A8Y A;  4PUO A;  3TR8 A;  3CQ8 A;  4IJN A;  3K5N A;  4R5P A;  3PY8 A;  1JCG A;  1QQN A;  2NRZ A;  4CJK A;  4HUG A;  4NLB A;  3OYH A;  3LP3 A;  4WF9 L;  3D2F B;  3NGI A;  3LDS A;  1D9F A;  3L3V A;  3K2P A;  5JS1 A;  2ASO A;  1QQO A;  4QS8 A;  1BG3 A;  4YOW A;  3KK1 A;  4F9O A;  1MDU B;  4CZM A;  4CFA A;  2V52 B;  4F3O A;  5EX5 A;  2P9L A;  3QIC A;  1LV5 A;  3GL1 A;  4DB3 A;  2QM1 A;  4E1M A;  5KTQ A;  1RGI A;  3N4Q A;  3CPE A;  4CHQ A;  3S9H A;  3NH2 A;  4G9Z A;  1LWC A;  4CBW A;  1VQ6 N;  4DR6 K;  3KKR A;  3WXM B;  1BA1 A;  2B6A A;  4ZHR A;  4JI6 K;  3WXL A;  4JLH A;  5C12 A;  4YOR A;  1E4F T;  1NGA A;  3BUZ B;  3SMS A;  1CZA N;  4FWM A;  1KCF A;  5JEN A;  5A2Q O;  1IO2 A;  1IKV A;  4GVE A;  3K9J A;  2QKK A;  4Y1D A;  4C8L A;  3HST B;  3U3G A;  3VA0 A;  4B3S K;  4C8O A;  4KHP K;  2ZJP L;  3QES A;  4B9U A;  1BA0 A;  4RW8 A;  3O1W A;  3LAN A;  4B3O A;  4RW4 A;  5AZI B;  2XY6 A;  4IO9 L;  3SPY A;  3DXM A;  3SUQ A;  3HL8 A;  3SJH A;  1XWL A;  2O8D A;  3U9D A;  3ZCM A;  4JI7 K;  4CGJ A;  2F9W A;  4M3X A;  2YHA A;  2VG5 A;  4BGA A;  3PLA A;  3QFU A;  2VCP A;  3QO9 A;  4MO5 A;  3NF8 A;  3SAF A;  3TSQ A;  4ISG A;  5ADX A;  2C1I A;  3ZX3 A;  3VEN A;  1NWK A;  4FWP A;  3HVR A;  1U47 A;  4KHN A;  4B1Y B;  1WUA A;  1YIT N;  3BZC A;  4I6M A;  4U67 L;  2P5O A;  4CF9 A;  2D5R A;  2E20 A;  4CVN E;  4CHO A;  5MLC Q;  4V19 S;  4OPH A;  4IEE A;  4WQ5 A;  4FJI A;  4FLW A;  2G8I A;  3HPG A;  4FJ8 A;  2A5X A;  2VG6 A;  3L2R A;  1RTI A;  4JK8 A;  3BGR A;  1VQ7 N;  1JCF A;  3G4S N;  1I3A A;  5KRT A;  3OS2 A;  3SUP A;  3PX6 A;  4BRH A;  4OX9 K;  1N32 K;  4RTF D;  2LSN A;  1SKS A;  2YCH A;  2KHO A;  3AAQ A;  4BRD A;  4BE7 B;  5C42 A;  3FZK A;  4JKB A;  2UYT A;  4NCA A;  3THW A;  3RMC A;  3ALY A;  4Z4F A;  1YHQ N;  1S1U A;  1O1W A;  4BDP A;  1BWF O;  2ZD1 A;  4E89 A;  3DLL L;  5AQX A;  3DJC A;  3DLH A;  1L3U A;  1JJ2 M;  4KO0 A; 
#chains in the Genus database with same CATH homology
 2ZGY A;  4C1N I;  1ATN A;  3GG4 A;  1K73 O;  3CET A;  2J4R A;  5ELZ A;  4PL8 A;  3U4L A;  4BVP A;  1Z05 A;  5I9E B;  4WQ5 C;  4JKG B;  2HMP A;  5M1Q A;  1NGC A;  4PKG A;  4XEI A;  4PHT X;  4BY9 C;  1YAG A;  1K9M O;  3MK6 A;  3CC4 N;  5DM6 L;  3CJA A;  3Q7C A;  5AQQ A;  1HJO A;  1R59 O;  4A61 A;  5AQV A;  3TSU A;  2CGK A;  4KH6 A;  5JVH L;  3D7E O;  3WQT A;  1K8K B;  3DWL A;  3CJC A;  3EO3 A;  3VEO A;  1HKG A;  3HI0 A;  1KAY A;  4BRM A;  3KWG A;  4H03 B;  4MLE A;  4JKE A;  1X3N A;  3UB5 A;  1VQK N;  1NGJ A;  4MO4 A;  1WOQ A;  4XH4 A;  4CD3 A;  3EE8 A;  3BF1 A;  3EE9 A;  2VWB A;  2Q97 A;  3FFK B;  4IFE A;  4FWS A;  3CCQ N;  3VF4 A;  3O1B A;  2EWS A;  4FWN A;  1S72 N;  1NGG A;  2P9P B;  3CCE N;  4JHD A;  2PBD A;  3HTV A;  3A5M C;  4YOU A;  1ESV A;  1BO5 O;  2PFU A;  4WFA L;  4H0Y B;  4FOE A;  4CZF A;  2JWK A;  4FWR A;  1ATR A;  5M1N A;  5AFU A;  5GAD P;  2P9K A;  1DT9 A;  2E1Y A;  1GLD G;  5KPZ A;  3WXI A;  2E8A A;  4QS7 A;  5JIC A;  2NRT A;  2GWK A;  3D2F A;  4MDA A;  5CR4 A;  3FE1 A;  2FSK A;  2YHW A;  3I55 N;  4BC2 A;  4FL9 A;  3R9P A;  1NGD A;  1Y64 A;  2ZWH A;  4B1U B;  3CJ1 A;  3EZW A;  3GDQ A;  4HWI A;  3O6W A;  3VEW A;  4B9Q A;  5AQO A;  4YOX A;  5KPR A;  4PKI A;  4H0X B;  5M1K A;  1NGF A;  1KD1 O;  4A62 A;  2HF3 A;  1NJI O;  3UE5 A;  3CCV N;  3MX2 A;  5AQJ A;  1K8A O;  5CE3 A;  3GBT A;  3SBT A;  2E2O A;  3LDQ A;  4FWO A;  1YUW A;  1V4T A;  4IOC L;  4KBO A;  3TSP A;  3ENB A;  5JMV A;  2ASM A;  5FPE A;  1Q86 O;  1QVF M;  2F9T A;  1QZ5 A;  2H3G X;  2NRW A;  2E2P A;  5BN8 A;  3CCL N;  1EQY A;  4A5B A;  4AM7 A;  5BRD A;  5C0Y A;  5DM7 L;  3TPQ A;  1TYQ A;  1Q82 O;  2WBN A;  2YX6 A;  1NBW A;  1VQL N;  2QWL A;  1ATS A;  2NLX A;  3RVC A;  1HKC A;  4BRF A;  2A3Z A;  1QZ6 A;  3L0Q A;  3H3O B;  3VEX A;  4BC4 A;  2VGN A;  3E66 A;  3O5B A;  4H0T B;  3VPZ A;  2F7T A;  2HBL A;  1GLC G;  4CI6 A;  2AA4 A;  5E84 A;  2A40 A;  1NMD A;  4JKH A;  3UKU B;  4JKF A;  4O8K A;  4EIA A;  4BVO A;  3C7N B;  3ATU A;  3F2K A;  5F2R A;  4GNI A;  3VGM A;  2P9S A;  3JS6 A;  5AQF A;  3UKU A;  3QDK A;  3R8E A;  3W0L A;  2YJF A;  1V4S A;  2QWP A;  1U2V B;  3M1F A;  3O08 A;  4WFB L;  1ZXO A;  3FLC O;  3HRG A;  4JK7 A;  3HOT A;  2ZJR L;  3P38 A;  4YDU A;  5AQS A;  4JKG A;  2W41 A;  5AQI A;  1S22 A;  4BRI A;  2YI1 A;  2BTF A;  1X9J A;  3JXU A;  1KXP A;  5AQK A;  3HM8 A;  3LL3 A;  3VEV A;  5JVG L;  3P31 A;  3EKS A;  3ATV A;  4BEC A;  1DKG D;  3L4Q A;  3O9Q A;  4B1X B;  1NGH A;  4BQL A;  5KQ8 A;  3PIP L;  1D4X A;  2OAN A;  1W97 L;  3DXM B;  4ILG B;  5AQM A;  2ZJQ L;  1XQS C;  5FPM A;  5C15 A;  2D0P A;  2IVN A;  3A5O C;  3DXK A;  1LCU A;  3H45 C;  5C10 A;  2WUS A;  4IEI A;  2FF6 A;  5TKW A;  3EL2 A;  3KVG A;  3EKU A;  4HTL A;  5EXW A;  3SMP A;  2P9P A;  4FPA A;  3WEE A;  4C1N K;  2I7P A;  3MN7 A;  4R79 A;  2BUP A;  3D2E A;  4OPA A;  5BRH A;  1G99 A;  4K42 A;  4JEP A;  3S41 A;  4OO1 J;  2D1K A;  4A2B A;  1X3M A;  3MWP A;  3ULE B;  2QEX N;  2WFB A;  4CZG A;  1M90 O;  3O9U A;  4H5V A;  4U7B A;  2QTD A;  3QB0 A;  3QBW A;  1P8Z A;  4CZK A;  4JN4 A;  5AQZ A;  3NVM A;  5BN9 A;  3H1V X;  4M63 C;  3RSE A;  5H1S Q;  3CCJ N;  3M3Z A;  4CD1 A;  3SAG A;  3VER A;  5BR9 A;  5LJW A;  3T7Z A;  1VQO N;  3LDO A;  4BRP A;  4A5A A;  2OTL N;  3ZX0 A;  3CPW M;  4XJX A;  5BRF A;  4CZH A;  1GLE G;  5LJV A;  4MDB A;  4O5F A;  2P9N B;  3J8A A;  3CER A;  3OW2 M;  4BQZ A;  4KH4 A;  3O9R A;  1Q18 A;  3GOI A;  4H5N A;  1MA9 B;  4JD2 B;  3H3N O;  2ZGZ A;  3VMF B;  1VQ4 N;  3HZ6 A;  4EHT A;  3N4P A;  3ID6 A;  2E2N A;  1LOT B;  3O9T A;  4IOX A;  1S3X A;  4CZI A;  5EY4 A;  3IFR A;  4K41 A;  3VEY A;  3BF3 A;  4AM6 A;  4FWL A;  1C0G A;  2ASP A;  3TTC A;  4CZJ A;  3VGK A;  3BEX A;  3CF5 L;  3ZET A;  3H1Q A;  1JCE A;  3A5N C;  3WUH A;  3IDH A;  3CMA N;  3CC2 N;  4JKA A;  5BPM A;  1T44 A;  3F9M A;  4BR5 A;  2D4W A;  1YJN N;  3I56 N;  2AP1 A;  3GE1 A;  3C7N A;  2NRV A;  3LDP A;  3WQU A;  3CHW A;  3ZEU A;  2Q0U A;  2IVP A;  1NGE A;  2RHK A;  4GV3 A;  3QFP A;  5F0X A;  3UKR B;  4GV6 A;  3VGL A;  4IO8 A;  4A57 A;  2NRX A;  2NZT A;  3G6E N;  3FZF A;  3I8B A;  5GIP A;  4BRO A;  3A0I X;  1QVG M;  4BR9 A;  4FOI A;  2VGM A;  5KPT A;  4FWK A;  4H0V B;  4BC5 A;  5AQR A;  3OBW A;  4EFH A;  2QWM A;  3CJ9 A;  3VOV A;  1GLF O;  3AGR A;  3L4I A;  4FPB A;  5GIO A;  3TTF A;  2ZF5 O;  3P39 A;  4IWV A;  2GTD A;  3CI5 A;  4BRG A;  4AF1 A;  4B1W B;  1QHA A;  3C65 A;  3IKM A;  4IXC A;  1SQK A;  1ILY A;  3VTI A;  3LM9 A;  5BRE A;  2GEL A;  4IJA A;  4M7Y A;  1Q81 O;  3TU5 A;  2GUP A;  2HBJ A;  1MWM A;  5AQH A;  3KHY A;  2W00 A;  2FSJ A;  4NLC A;  1J6Z A;  4O8U A;  2V51 B;  3AY9 A;  4IDH A;  1DEJ A;  1K8K A;  4BRN A;  4E1J A;  1IJJ A;  4EAH D;  4BGB A;  2V7Y A;  5EOY A;  5FPD A;  4JAX A;  2NRH A;  3EN9 A;  3TTD A;  4H5T A;  4XH5 A;  2HOE A;  3NMU A;  3SBG A;  4WCE L;  3CCS N;  2P9I B;  5M1F A;  4RWT A;  5AQN A;  3T69 A;  3FZH A;  3ULE A;  3U9Z A;  5C2D A;  5CHI A;  4WYB A;  1KAZ A;  4KH5 A;  3FR0 A;  3A5L C;  3DAW A;  3KWI A;  3CCU N;  3MDQ A;  5AFU H;  2PAV A;  3E9O A;  3MN5 A;  4FSV A;  3MN9 A;  3RSE B;  1EO1 A;  3VEZ A;  4YOT A;  5EVZ A;  4MLH A;  3VF2 A;  5JLH A;  2NRR A;  1RDW X;  2HBM A;  2HBK A;  4LC9 B;  1T6C A;  3E1Y A;  3ID8 A;  4CZL A;  1YF5 L;  4BR4 A;  5AZI A;  3SLC A;  1Z6R A;  3LDN A;  2QXL A;  3VTH A;  3OA9 A;  5GAG P;  5GAH P;  2P9N A;  1YXQ A;  1GLA G;  3OBY A;  5AQY A;  4GY2 B;  3L6Q A;  3SAH A;  5AZJ A;  4GV9 A;  4FVU A;  2HST A;  1BOT O;  2VYP A;  5LY3 A;  3M5R A;  3CME N;  3MMV A;  5AQG A;  4BRL A;  3ZX2 A;  4CBX A;  4J8F A;  3CCM N;  2E1Z A;  1VQN N;  3A8Y A;  5M1O A;  3C6H A;  5HL7 L;  2QWN A;  3P4I A;  4IJN A;  3HOS A;  2FSN A;  4A59 A;  1QQN A;  1JCG A;  1OVY A;  2NRZ A;  2P9K B;  4NLB A;  4DCH A;  4JKC A;  1T3V A;  4DQ8 A;  4BRE A;  3E9P A;  5AQW A;  1HPM A;  5AR0 A;  4WF9 L;  2E2Q A;  3D2F B;  3MN6 A;  4K43 A;  1VQ5 N;  2QA4 N;  1YJ9 N;  3O80 A;  1HX1 A;  4JNE A;  5TKY A;  1TYQ B;  2ASO A;  3IMX A;  1N8R O;  2GEM A;  2HF4 A;  1W2B M;  1QQO A;  2CH5 A;  4PKH A;  4QS8 A;  4BRK A;  4H5R A;  1BG3 A;  3ZEU B;  4YOW A;  5M1P A;  2E88 A;  1KQS M;  4WQ4 A;  4F9O A;  2CH6 A;  1MDU B;  4I6M B;  4CZM A;  3UKR A;  2V52 B;  2QWQ A;  5EX5 A;  3ENH A;  2P9L A;  1BUP A;  3QIC A;  3VF6 A;  5AQT A;  2Q36 A;  3GL1 A;  4DB3 A;  3QBX A;  1VAZ A;  2QM1 A;  2W40 A;  4M7X A;  1RGI A;  3N4Q A;  4Y0W A;  4BG9 A;  5JLF A;  3CPE A;  3CCR N;  4CZE A;  1U2V A;  1C0F A;  2KLA A;  2WC9 A;  3OHR A;  1NM1 A;  1SAZ A;  2YJE A;  4G9Z A;  4CBW A;  1VQ6 N;  1ZC6 A;  4BG8 A;  1HKB A;  2P9U B;  1HUX A;  4L3Q A;  5GAE P;  4BC3 A;  4ISF A;  3H6E A;  1BA1 A;  3CJB A;  5FPN A;  1KAX A;  3WXM B;  4BR0 A;  1VQM N;  1BDG A;  1YI2 N;  4QS9 A;  2IVO A;  2FXU A;  3WXL A;  3WXK A;  5C12 A;  3CQX A;  4PL7 A;  3CXC M;  1SS6 A;  4YOR A;  1IG8 A;  1QQM A;  3F5T A;  1DGK N;  1E4F T;  1NGA A;  1XC3 A;  2A42 A;  3MX5 A;  4BEB A;  3BUZ B;  3SMS A;  1CZA N;  2A6A A;  2P9S B;  2BH1 A;  4FWM A;  2YHX A;  3R6M A;  1VQ8 N;  3WT0 A;  2P9I A;  2QWO A;  4DKW A;  1OKJ A;  4Z94 A;  3I33 A;  4GVE A;  3K9J A;  3NVK A;  1H1V A;  4WQ4 C;  2A41 A;  2ITM A;  2ZJP L;  3ZYY X;  3J7Z O;  3KZB A;  1GLB G;  4WFN L;  2CGJ A;  1BA0 A;  3Q7B A;  4DHY A;  3O1W A;  3D6R A;  1VQ9 N;  4NO7 A;  5KQD A;  3LM2 A;  1BU6 O;  2FF3 B;  3E9L A;  5AZI B;  4IO9 L;  3VES A;  2Q2R A;  5ADX H;  3DXM A;  4H0O A;  3W3D A;  3SJH A;  2IIR A;  5AZJ B;  5F1X A;  3FZL A;  1YIJ N;  4K25 A;  1NLV A;  3DXK B;  4B1Z A;  3U9D A;  3WXJ A;  5GIN A;  2F9W A;  5B8H A;  1KC8 O;  2FLO A;  3WEE B;  2JWL A;  1SZ2 A;  2Q1N A;  3BP8 A;  4RCH A;  3D2E B;  5AQU A;  3O4W A;  2RE2 A;  2QWR A;  4XH1 A;  4BGA A;  4BRA A;  5BPL A;  4UY8 O;  2OTJ N;  3PLA A;  1NGI A;  4YOY A;  5HOO A;  4JD2 A;  3QFU A;  2VCP A;  1GLL O;  2D0O A;  4CBU A;  1RFQ A;  3R3L A;  5C2F A;  1Q7Y O;  2YHY A;  3M6G A;  4MO5 A;  1XUP O;  3C0B A;  3SAF A;  4JHD B;  4ISG A;  4ILH A;  3TSQ A;  5ADX A;  4IOA L;  1NGB A;  2C1I A;  1E4G T;  3HSC A;  3ZX3 A;  3G25 A;  4BRQ A;  3LDL A;  3VEN A;  1NWK A;  4FWP A;  4IZ9 A;  4B1Y B;  1WUA A;  3H46 O;  3IUC A;  3U8X A;  3ZET B;  3PIO L;  1YIT N;  1M1K O;  4I6M A;  2I7N A;  4U67 L;  2DPN A;  5E26 A;  4A2A A;  1YJW N;  3FZM A;  2E20 A;  3CIP A;  2P9L B;  5MLC Q;  1TUY A;  4YOV A;  4OPH A;  4IEE A;  4WQ5 A;  1HLU A;  3MCA B;  2A5X A;  4NB4 A;  4ISE A;  3AGK A;  4JK8 A;  1VQ7 N;  1JCF A;  3G4S N;  1ZBS A;  5AQL A;  3CJ7 A;  3O8M A;  4B1V A;  3C6A A;  4BRH A;  3HBT A;  1RDU A;  2P9U A;  4H5W A;  3R1X A;  4RTF D;  3FGU A;  1GLJ O;  3MWT A;  3QML A;  3G71 N;  2YCH A;  2KHO A;  3AAQ A;  3B8A X;  4C23 A;  5AQP A;  3SK3 A;  4BRD A;  3VET A;  4YDU C;  3MCP A;  4BE7 B;  2C1G A;  4BR2 A;  3FZK A;  4JKB A;  2UYT A;  4FO0 A;  3K9K A;  4EHU A;  2V7Z A;  4JKD A;  2QW9 A;  1O13 A;  4ILJ A;  4BR7 A;  3CD6 N;  2Q0R A;  1YHQ N;  1MWK A;  4BRC A;  3CC7 N;  4CJ7 A;  2Q31 A;  2GWJ A;  3CQY A;  4H0P A;  1BWF O;  1TUU A;  3ENO A;  2CGL A;  1T6D A;  1U6Z A;  2NNW A;  3DLL L;  2KKZ A;  4JK9 A;  1VQP N;  1P90 A;  2QI2 A;  1YVN A;  3AAR A;  5AQX A;  3DJC A;  3AAP A;  2GX9 A;  3O9S A;  5BPN A;  4FWQ A;  3KK7 A;  1JJ2 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...