3CI0I

The crystal structure of the gspk-gspi-gspj complex from enterotoxigenic escherichia coli type 2 secretion system
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
84
structure length
83
Chain Sequence
QHVLEEKTVAGWVAENQTALLYLMTRGQRAVRQQGESDMAGSRWYWRTTPLSTGNALQAVDIEVSLHEDFSSVIQSRRAWFSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the GspK-GspI-GspJ complex from the enterotoxigenic Escherichia coli type 2 secretion system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
molecule keywords Pseudopilin GspI
total genus 21
structure length 83
sequence length 84
ec nomenclature
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF02501 T2SSI Type II secretion system (T2SS), protein I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.30 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 GSPII I/J protein-like 3ci0I00
2GR8A 3CI0I 2LMEA 3CFIA 2RETA 3EMOA 2GR7A 5BW0B 3CI0K
chains in the Genus database with same CATH superfamily
3MXTA 4EFKA 4DE5A 3CFAL 5HG0A 4G5FA 4IXJA 3IUEA 2A53A 3COWA 3Q10A 4MUNA 4DDKA 2GR7A 2OGFA 3CI0K 2A56A 3COZA 2IECA 3UA0A 4DDMA 2RETA 2G5ZA 2G3DA 3IOCA 2G16A 1N2HA 3LF4A 4G5YA 3IUBA 3UY4A 3CFIA 5G2FA 2A88A 3IVGA 4MUKA 2A84A 2I52A 3COYA 4MUHA 3AG6A 3QTTA 1MOPA 4MUGA 3ISJA 2A52A 1N2EA 2GW4A 3CI0I 3INNA 2A7XA 4DDHA 4MULA 1N2GA 3UK2A 1N2IA 3MUEA 1V8FA 1N2BA 5EXCA 2A50A 1IHOA 3HL6A 2GR8A 3COVA 2LMEA 3IMGA 3EMOA 3N8HA 3IVCA 3CFHL 1UFVA 4MQ6A 2A86A 2G2SA 3Q12A 4MUFA 3IOBA 4MUIA 4MUEA 4BHRA 5BW0B 1N2OA 3IODA 3IVXA 2EJCA 3AG5A 4FZJA 2A54A 4EF6A 3LE8A 2X3FA 5KWVA 1N2JA 3IMCA 3IOEA 3IMEA 4MUJA 3CFFL
chains in the Genus database with same CATH topology
2GR8A 3CI0I 3CI0J 2LMEA 3CFIA 2RETA 3EMOA 2GR7A 5BW0B 3CI0K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GR8 A;  3CI0 I;  2LME A;  3CFI A;  2RET A;  3EMO A;  2GR7 A;  5BW0 B;  3CI0 K; 
#chains in the Genus database with same CATH topology
 3MXT A;  4EFK A;  4DE5 A;  3CFA L;  5HG0 A;  4G5F A;  4IXJ A;  3IUE A;  2A53 A;  3COW A;  3Q10 A;  4MUN A;  4DDK A;  2GR7 A;  2OGF A;  3CI0 K;  2A56 A;  3COZ A;  2IEC A;  3UA0 A;  4DDM A;  2RET A;  2G5Z A;  2G3D A;  3IOC A;  2G16 A;  1N2H A;  3LF4 A;  4G5Y A;  3IUB A;  3UY4 A;  3CFI A;  5G2F A;  2A88 A;  3IVG A;  4MUK A;  2A84 A;  2I52 A;  3COY A;  4MUH A;  3AG6 A;  3QTT A;  1MOP A;  4MUG A;  3ISJ A;  2A52 A;  1N2E A;  2GW4 A;  3CI0 I;  3INN A;  2A7X A;  4DDH A;  4MUL A;  1N2G A;  3UK2 A;  1N2I A;  3MUE A;  1V8F A;  1N2B A;  5EXC A;  2A50 A;  1IHO A;  3HL6 A;  2GR8 A;  3COV A;  2LME A;  3IMG A;  3EMO A;  3N8H A;  3IVC A;  3CFH L;  1UFV A;  4MQ6 A;  2A86 A;  2G2S A;  3Q12 A;  4MUF A;  3IOB A;  4MUI A;  4MUE A;  4BHR A;  5BW0 B;  1N2O A;  3IOD A;  3IVX A;  2EJC A;  3AG5 A;  4FZJ A;  2A54 A;  4EF6 A;  3LE8 A;  2X3F A;  5KWV A;  1N2J A;  3IMC A;  3IOE A;  3IME A;  4MUJ A;  3CFF L; 
#chains in the Genus database with same CATH homology
 2GR8 A;  3CI0 I;  3CI0 J;  2LME A;  3CFI A;  2RET A;  3EMO A;  2GR7 A;  5BW0 B;  3CI0 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...