3CI0I

The crystal structure of the gspk-gspi-gspj complex from enterotoxigenic escherichia coli type 2 secretion system
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
84
structure length
83
Chain Sequence
QHVLEEKTVAGWVAENQTALLYLMTRGQRAVRQQGESDMAGSRWYWRTTPLSTGNALQAVDIEVSLHEDFSSVIQSRRAWFSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pseudopilin GspI
publication title Structure of the GspK-GspI-GspJ complex from the enterotoxigenic Escherichia coli type 2 secretion system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
total genus 21
structure length 83
sequence length 84
ec nomenclature
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF02501 T2SSI Type II secretion system (T2SS), protein I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.30 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 GSPII I/J protein-like 3ci0I00
3CI0K 3CI0I 5BW0B 2GR7A 2LMEA 3CFIA 3EMOA 2RETA 2GR8A
chains in the Genus database with same CATH superfamily
2GR7A 2A53A 4EFKA 1N2BA 3COZA 4MUKA 3ISJA 3HL6A 2A84A 5HG0A 4DDHA 2A7XA 1V8FA 3IVCA 4MUFA 2GR8A 1N2OA 4MUGA 3IVGA 2A50A 5G2FA 3AG5A 4DE5A 3QTTA 4EF6A 2A86A 5KWVA 3N8HA 4DDKA 1IHOA 3COWA 3CFHL 3CI0K 3MUEA 5BW0B 2G16A 4IXJA 1N2EA 2IECA 3CFFL 4MQ6A 3CFAL 4G5YA 2I52A 1N2JA 2OGFA 3IOEA 2G2SA 3UY4A 3IUEA 2LMEA 2A52A 5EXCA 3IUBA 3IVXA 2RETA 3Q10A 3CI0I 3LE8A 4BHRA 1UFVA 3COVA 3CFIA 3IODA 2A56A 2G3DA 4MUNA 3AG6A 3COYA 4DDMA 3MXTA 4MULA 2A88A 3INNA 1N2HA 2GW4A 4MUEA 3IMGA 3UA0A 3Q12A 3IMEA 2EJCA 3UK2A 1MOPA 3IOBA 2X3FA 4FZJA 4MUHA 3EMOA 1N2GA 2G5ZA 3IOCA 3IMCA 3LF4A 4MUJA 4G5FA 2A54A 1N2IA 4MUIA
chains in the Genus database with same CATH topology
3CI0K 3CI0I 3CI0J 5BW0B 2GR7A 2LMEA 3CFIA 3EMOA 2RETA 2GR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CI0 K;  3CI0 I;  5BW0 B;  2GR7 A;  2LME A;  3CFI A;  3EMO A;  2RET A;  2GR8 A; 
#chains in the Genus database with same CATH topology
 2GR7 A;  2A53 A;  4EFK A;  1N2B A;  3COZ A;  4MUK A;  3ISJ A;  3HL6 A;  2A84 A;  5HG0 A;  4DDH A;  2A7X A;  1V8F A;  3IVC A;  4MUF A;  2GR8 A;  1N2O A;  4MUG A;  3IVG A;  2A50 A;  5G2F A;  3AG5 A;  4DE5 A;  3QTT A;  4EF6 A;  2A86 A;  5KWV A;  3N8H A;  4DDK A;  1IHO A;  3COW A;  3CFH L;  3CI0 K;  3MUE A;  5BW0 B;  2G16 A;  4IXJ A;  1N2E A;  2IEC A;  3CFF L;  4MQ6 A;  3CFA L;  4G5Y A;  2I52 A;  1N2J A;  2OGF A;  3IOE A;  2G2S A;  3UY4 A;  3IUE A;  2LME A;  2A52 A;  5EXC A;  3IUB A;  3IVX A;  2RET A;  3Q10 A;  3CI0 I;  3LE8 A;  4BHR A;  1UFV A;  3COV A;  3CFI A;  3IOD A;  2A56 A;  2G3D A;  4MUN A;  3AG6 A;  3COY A;  4DDM A;  3MXT A;  4MUL A;  2A88 A;  3INN A;  1N2H A;  2GW4 A;  4MUE A;  3IMG A;  3UA0 A;  3Q12 A;  3IME A;  2EJC A;  3UK2 A;  1MOP A;  3IOB A;  2X3F A;  4FZJ A;  4MUH A;  3EMO A;  1N2G A;  2G5Z A;  3IOC A;  3IMC A;  3LF4 A;  4MUJ A;  4G5F A;  2A54 A;  1N2I A;  4MUI A; 
#chains in the Genus database with same CATH homology
 3CI0 K;  3CI0 I;  3CI0 J;  5BW0 B;  2GR7 A;  2LME A;  3CFI A;  3EMO A;  2RET A;  2GR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...