3CI0I

The crystal structure of the gspk-gspi-gspj complex from enterotoxigenic escherichia coli type 2 secretion system
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
84
structure length
83
Chain Sequence
QHVLEEKTVAGWVAENQTALLYLMTRGQRAVRQQGESDMAGSRWYWRTTPLSTGNALQAVDIEVSLHEDFSSVIQSRRAWFSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the GspK-GspI-GspJ complex from the enterotoxigenic Escherichia coli type 2 secretion system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
molecule keywords Pseudopilin GspI
total genus 21
structure length 83
sequence length 84
ec nomenclature
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF02501 T2SSI Type II secretion system (T2SS), protein I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.30 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 GSPII I/J protein-like 3ci0I00
2GR8A 3CI0K 3CFIA 5BW0B 3EMOA 3CI0I 2GR7A 2RETA 2LMEA
chains in the Genus database with same CATH superfamily
4MUEA 5G2FA 2GR7A 3COZA 2LMEA 4EF6A 3Q12A 3MXTA 5BW0B 1UFVA 4DDHA 2G3DA 4MULA 3Q10A 3IMCA 2GR8A 3IUEA 2GW4A 4MUNA 4MQ6A 3LE8A 3INNA 3HL6A 2G5ZA 3MUEA 4DDMA 3COYA 3IMGA 1N2OA 4DDKA 3EMOA 3UA0A 1N2BA 4FZJA 3COWA 3CFIA 3LF4A 4EFKA 3CFFL 2RETA 5EXCA 3QTTA 1MOPA 2A54A 1IHOA 3CFAL 1N2IA 2A84A 1N2GA 3UK2A 2EJCA 3IOBA 2A53A 3UY4A 1N2JA 2IECA 2A7XA 2A52A 4MUKA 4MUIA 2G16A 2G2SA 4IXJA 3IMEA 4DE5A 3AG6A 1N2EA 4BHRA 3IVXA 2A86A 5KWVA 4MUGA 3IOCA 3IVCA 2I52A 1N2HA 4G5YA 3CFHL 3COVA 4MUJA 5HG0A 4MUHA 3N8HA 3IUBA 3IOEA 2X3FA 1V8FA 2A88A 3ISJA 4G5FA 3AG5A 3IODA 3CI0K 3CI0I 4MUFA 2A50A 2OGFA 3IVGA 2A56A
chains in the Genus database with same CATH topology
2GR8A 3CI0K 3CFIA 5BW0B 3EMOA 3CI0I 2GR7A 2RETA 3CI0J 2LMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GR8 A;  3CI0 K;  3CFI A;  5BW0 B;  3EMO A;  3CI0 I;  2GR7 A;  2RET A;  2LME A; 
#chains in the Genus database with same CATH topology
 4MUE A;  5G2F A;  2GR7 A;  3COZ A;  2LME A;  4EF6 A;  3Q12 A;  3MXT A;  5BW0 B;  1UFV A;  4DDH A;  2G3D A;  4MUL A;  3Q10 A;  3IMC A;  2GR8 A;  3IUE A;  2GW4 A;  4MUN A;  4MQ6 A;  3LE8 A;  3INN A;  3HL6 A;  2G5Z A;  3MUE A;  4DDM A;  3COY A;  3IMG A;  1N2O A;  4DDK A;  3EMO A;  3UA0 A;  1N2B A;  4FZJ A;  3COW A;  3CFI A;  3LF4 A;  4EFK A;  3CFF L;  2RET A;  5EXC A;  3QTT A;  1MOP A;  2A54 A;  1IHO A;  3CFA L;  1N2I A;  2A84 A;  1N2G A;  3UK2 A;  2EJC A;  3IOB A;  2A53 A;  3UY4 A;  1N2J A;  2IEC A;  2A7X A;  2A52 A;  4MUK A;  4MUI A;  2G16 A;  2G2S A;  4IXJ A;  3IME A;  4DE5 A;  3AG6 A;  1N2E A;  4BHR A;  3IVX A;  2A86 A;  5KWV A;  4MUG A;  3IOC A;  3IVC A;  2I52 A;  1N2H A;  4G5Y A;  3CFH L;  3COV A;  4MUJ A;  5HG0 A;  4MUH A;  3N8H A;  3IUB A;  3IOE A;  2X3F A;  1V8F A;  2A88 A;  3ISJ A;  4G5F A;  3AG5 A;  3IOD A;  3CI0 K;  3CI0 I;  4MUF A;  2A50 A;  2OGF A;  3IVG A;  2A56 A; 
#chains in the Genus database with same CATH homology
 2GR8 A;  3CI0 K;  3CFI A;  5BW0 B;  3EMO A;  3CI0 I;  2GR7 A;  2RET A;  3CI0 J;  2LME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...