3CI5G

Complex of phosphorylated dictyostelium discoideum actin with gelsolin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
126
structure length
126
Chain Sequence
HMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modulation of actin structure and function by phosphorylation of Tyr-53 and profilin binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Major actin
total genus 42
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 3ci5G00
2NUPB 1M4JA 4CBXG 1COFA 1CNUA 1M2VA 3EGDB 1AK7A 1NM1G 2XFAA 3EH1A 2QTVA 1PD0A 1X67A 3EG9B 2FH3A 1F7SA 1SVRA 1T3XA 3A5OS 3EGXB 1NLVG 4JD2H 4PKIG 5KYUA 2VIKA 1JHWA 3DAWB 3FG6A 5KYNA 2NUTA 1ESVS 3FFKA 1QPVA 3TU5B 4BEX1 1Q8XA 1YVNG 3A5LS 3A5MS 1CFYA 1EQYS 1UDMA 4PKHB 1TMWA 5FAEA 1D0NA 1RGIG 1SVYA 3EG9A 4PKGG 1WM4A 5KYWB 2FH4A 2HD7A 1WFSA 1VKKA 2KVKA 1KCQA 3EGDA 1HQZ1 2FF6G 1AHQA 5KYXB 2XF1A 5IVUA 3EFOB 1T2LA 1T44G 2NUTB 1M2VB 2VILA 5KYYB 2FF3A 2I2QA 5FAFA 4S10C 3A5NS 1P8XA 3EH2A 1C0FS 1VFQA 5DD2A 2VACA 3FG7A 1T3YA 3FFNA 4Z94G 2LXXA 3Q2BA 3EGXA 5A1MA 2FH1A 4KEEA 1MDUA 1AK6A 4CBUG 1C0GS 1J72A 2NUPA 5KYWA 1H1VG 3CI5G 1NMDG 2FGHA 2FH2A 1Q8GA 2MP4A 4CBWG 5KYXA 1PCXA 2D8BA 3CIPG 4KEFA 2L72A 1M2OA 2MV2A 3EFOA 5KYYA 5HVKD 5HVKB 1SVQA 5KYUB 2W0IA 5L6WC 2MOTA 3CJBG 4KEDA 4LIZA 1TVJA 1D4XG 2LJ8A 1WNJA 1DEJS 3CJCG 1YAGG 2LLFA 1V6FA 1NPHA 1PD1A 3L50A 1P8ZG
chains in the Genus database with same CATH superfamily
2NUPB 1M4JA 4CBXG 1COFA 1CNUA 1M2VA 3EGDB 1AK7A 1NM1G 2XFAA 3EH1A 2QTVA 1PD0A 1X67A 3EG9B 2FH3A 1F7SA 1SVRA 1T3XA 3A5OS 3EGXB 1NLVG 4JD2H 4PKIG 5KYUA 2VIKA 1JHWA 3DAWB 3FG6A 5KYNA 2NUTA 1ESVS 3FFKA 1QPVA 3TU5B 4BEX1 1Q8XA 1YVNG 3A5LS 3A5MS 1CFYA 1EQYS 1UDMA 4PKHB 1TMWA 5FAEA 1D0NA 1RGIG 1SVYA 3EG9A 4PKGG 1WM4A 5KYWB 2FH4A 2HD7A 1WFSA 1VKKA 2KVKA 1KCQA 3EGDA 1HQZ1 2FF6G 1AHQA 5KYXB 2XF1A 5IVUA 3EFOB 1T2LA 1T44G 2NUTB 1M2VB 2VILA 5KYYB 2FF3A 2I2QA 5FAFA 4S10C 3A5NS 1P8XA 3EH2A 1C0FS 1VFQA 5DD2A 2VACA 3FG7A 1T3YA 3FFNA 4Z94G 2LXXA 3Q2BA 3EGXA 5A1MA 2FH1A 4KEEA 1MDUA 1AK6A 4CBUG 1C0GS 1J72A 2NUPA 5KYWA 1H1VG 3CI5G 3DA7A 1NMDG 2FGHA 2FH2A 1Q8GA 2MP4A 4CBWG 5KYXA 1PCXA 2D8BA 3CIPG 4KEFA 2L72A 1M2OA 2MV2A 3EFOA 5KYYA 5HVKD 5HVKB 1SVQA 5KYUB 2W0IA 5L6WC 2MOTA 3CJBG 4KEDA 4LIZA 1TVJA 1D4XG 2LJ8A 1WNJA 1DEJS 3CJCG 1YAGG 2LLFA 1V6FA 1NPHA 1PD1A 3L50A 1P8ZG
chains in the Genus database with same CATH topology
2NUPB 1M4JA 4CBXG 1COFA 1CNUA 1M2VA 3EGDB 1AK7A 1NM1G 2XFAA 3EH1A 2QTVA 1PD0A 1X67A 3EG9B 2FH3A 1F7SA 1SVRA 1T3XA 3A5OS 3EGXB 1NLVG 4JD2H 4PKIG 5KYUA 2VIKA 1JHWA 3DAWB 3FG6A 5KYNA 2NUTA 1ESVS 3FFKA 1QPVA 3TU5B 4BEX1 1Q8XA 1YVNG 3A5LS 3A5MS 1CFYA 1EQYS 1UDMA 4PKHB 1TMWA 5FAEA 1D0NA 1RGIG 1SVYA 3EG9A 4PKGG 1WM4A 5KYWB 2FH4A 2HD7A 1WFSA 1VKKA 2KVKA 1KCQA 3EGDA 1HQZ1 2FF6G 1AHQA 5KYXB 2XF1A 5IVUA 3EFOB 1T2LA 1T44G 2NUTB 1M2VB 2VILA 5KYYB 2FF3A 2I2QA 5FAFA 4S10C 3A5NS 1P8XA 3EH2A 1C0FS 1VFQA 5DD2A 2VACA 3FG7A 1T3YA 3FFNA 4Z94G 2LXXA 3Q2BA 3EGXA 5A1MA 2FH1A 4KEEA 1MDUA 1AK6A 4CBUG 1C0GS 1J72A 2NUPA 5KYWA 1H1VG 3CI5G 3DA7A 1NMDG 2FGHA 2FH2A 1Q8GA 2MP4A 4CBWG 5KYXA 1PCXA 2D8BA 3CIPG 4KEFA 2L72A 1M2OA 2MV2A 3EFOA 5KYYA 5HVKD 5HVKB 1SVQA 5KYUB 2W0IA 5L6WC 2MOTA 3CJBG 4KEDA 4LIZA 1TVJA 1D4XG 2LJ8A 1WNJA 1DEJS 3CJCG 1YAGG 2LLFA 1V6FA 1NPHA 1PD1A 3L50A 1P8ZG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NUP B;  1M4J A;  4CBX G;  1COF A;  1CNU A;  1M2V A;  3EGD B;  1AK7 A;  1NM1 G;  2XFA A;  3EH1 A;  2QTV A;  1PD0 A;  1X67 A;  3EG9 B;  2FH3 A;  1F7S A;  1SVR A;  1T3X A;  3A5O S;  3EGX B;  1NLV G;  4JD2 H;  4PKI G;  5KYU A;  2VIK A;  1JHW A;  3DAW B;  3FG6 A;  5KYN A;  2NUT A;  1ESV S;  3FFK A;  1QPV A;  3TU5 B;  4BEX 1;  1Q8X A;  1YVN G;  3A5L S;  3A5M S;  1CFY A;  1EQY S;  1UDM A;  4PKH B;  1TMW A;  5FAE A;  1D0N A;  1RGI G;  1SVY A;  3EG9 A;  4PKG G;  1WM4 A;  5KYW B;  2FH4 A;  2HD7 A;  1WFS A;  1VKK A;  2KVK A;  1KCQ A;  3EGD A;  1HQZ 1;  2FF6 G;  1AHQ A;  5KYX B;  2XF1 A;  5IVU A;  3EFO B;  1T2L A;  1T44 G;  2NUT B;  1M2V B;  2VIL A;  5KYY B;  2FF3 A;  2I2Q A;  5FAF A;  4S10 C;  3A5N S;  1P8X A;  3EH2 A;  1C0F S;  1VFQ A;  5DD2 A;  2VAC A;  3FG7 A;  1T3Y A;  3FFN A;  4Z94 G;  2LXX A;  3Q2B A;  3EGX A;  5A1M A;  2FH1 A;  4KEE A;  1MDU A;  1AK6 A;  4CBU G;  1C0G S;  1J72 A;  2NUP A;  5KYW A;  1H1V G;  3CI5 G;  1NMD G;  2FGH A;  2FH2 A;  1Q8G A;  2MP4 A;  4CBW G;  5KYX A;  1PCX A;  2D8B A;  3CIP G;  4KEF A;  2L72 A;  1M2O A;  2MV2 A;  3EFO A;  5KYY A;  5HVK D;  5HVK B;  1SVQ A;  5KYU B;  2W0I A;  5L6W C;  2MOT A;  3CJB G;  4KED A;  4LIZ A;  1TVJ A;  1D4X G;  2LJ8 A;  1WNJ A;  1DEJ S;  3CJC G;  1YAG G;  2LLF A;  1V6F A;  1NPH A;  1PD1 A;  3L50 A;  1P8Z G; 
#chains in the Genus database with same CATH topology
 2NUP B;  1M4J A;  4CBX G;  1COF A;  1CNU A;  1M2V A;  3EGD B;  1AK7 A;  1NM1 G;  2XFA A;  3EH1 A;  2QTV A;  1PD0 A;  1X67 A;  3EG9 B;  2FH3 A;  1F7S A;  1SVR A;  1T3X A;  3A5O S;  3EGX B;  1NLV G;  4JD2 H;  4PKI G;  5KYU A;  2VIK A;  1JHW A;  3DAW B;  3FG6 A;  5KYN A;  2NUT A;  1ESV S;  3FFK A;  1QPV A;  3TU5 B;  4BEX 1;  1Q8X A;  1YVN G;  3A5L S;  3A5M S;  1CFY A;  1EQY S;  1UDM A;  4PKH B;  1TMW A;  5FAE A;  1D0N A;  1RGI G;  1SVY A;  3EG9 A;  4PKG G;  1WM4 A;  5KYW B;  2FH4 A;  2HD7 A;  1WFS A;  1VKK A;  2KVK A;  1KCQ A;  3EGD A;  1HQZ 1;  2FF6 G;  1AHQ A;  5KYX B;  2XF1 A;  5IVU A;  3EFO B;  1T2L A;  1T44 G;  2NUT B;  1M2V B;  2VIL A;  5KYY B;  2FF3 A;  2I2Q A;  5FAF A;  4S10 C;  3A5N S;  1P8X A;  3EH2 A;  1C0F S;  1VFQ A;  5DD2 A;  2VAC A;  3FG7 A;  1T3Y A;  3FFN A;  4Z94 G;  2LXX A;  3Q2B A;  3EGX A;  5A1M A;  2FH1 A;  4KEE A;  1MDU A;  1AK6 A;  4CBU G;  1C0G S;  1J72 A;  2NUP A;  5KYW A;  1H1V G;  3CI5 G;  3DA7 A;  1NMD G;  2FGH A;  2FH2 A;  1Q8G A;  2MP4 A;  4CBW G;  5KYX A;  1PCX A;  2D8B A;  3CIP G;  4KEF A;  2L72 A;  1M2O A;  2MV2 A;  3EFO A;  5KYY A;  5HVK D;  5HVK B;  1SVQ A;  5KYU B;  2W0I A;  5L6W C;  2MOT A;  3CJB G;  4KED A;  4LIZ A;  1TVJ A;  1D4X G;  2LJ8 A;  1WNJ A;  1DEJ S;  3CJC G;  1YAG G;  2LLF A;  1V6F A;  1NPH A;  1PD1 A;  3L50 A;  1P8Z G; 
#chains in the Genus database with same CATH homology
 2NUP B;  1M4J A;  4CBX G;  1COF A;  1CNU A;  1M2V A;  3EGD B;  1AK7 A;  1NM1 G;  2XFA A;  3EH1 A;  2QTV A;  1PD0 A;  1X67 A;  3EG9 B;  2FH3 A;  1F7S A;  1SVR A;  1T3X A;  3A5O S;  3EGX B;  1NLV G;  4JD2 H;  4PKI G;  5KYU A;  2VIK A;  1JHW A;  3DAW B;  3FG6 A;  5KYN A;  2NUT A;  1ESV S;  3FFK A;  1QPV A;  3TU5 B;  4BEX 1;  1Q8X A;  1YVN G;  3A5L S;  3A5M S;  1CFY A;  1EQY S;  1UDM A;  4PKH B;  1TMW A;  5FAE A;  1D0N A;  1RGI G;  1SVY A;  3EG9 A;  4PKG G;  1WM4 A;  5KYW B;  2FH4 A;  2HD7 A;  1WFS A;  1VKK A;  2KVK A;  1KCQ A;  3EGD A;  1HQZ 1;  2FF6 G;  1AHQ A;  5KYX B;  2XF1 A;  5IVU A;  3EFO B;  1T2L A;  1T44 G;  2NUT B;  1M2V B;  2VIL A;  5KYY B;  2FF3 A;  2I2Q A;  5FAF A;  4S10 C;  3A5N S;  1P8X A;  3EH2 A;  1C0F S;  1VFQ A;  5DD2 A;  2VAC A;  3FG7 A;  1T3Y A;  3FFN A;  4Z94 G;  2LXX A;  3Q2B A;  3EGX A;  5A1M A;  2FH1 A;  4KEE A;  1MDU A;  1AK6 A;  4CBU G;  1C0G S;  1J72 A;  2NUP A;  5KYW A;  1H1V G;  3CI5 G;  3DA7 A;  1NMD G;  2FGH A;  2FH2 A;  1Q8G A;  2MP4 A;  4CBW G;  5KYX A;  1PCX A;  2D8B A;  3CIP G;  4KEF A;  2L72 A;  1M2O A;  2MV2 A;  3EFO A;  5KYY A;  5HVK D;  5HVK B;  1SVQ A;  5KYU B;  2W0I A;  5L6W C;  2MOT A;  3CJB G;  4KED A;  4LIZ A;  1TVJ A;  1D4X G;  2LJ8 A;  1WNJ A;  1DEJ S;  3CJC G;  1YAG G;  2LLF A;  1V6F A;  1NPH A;  1PD1 A;  3L50 A;  1P8Z G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...