3CIRB

E. coli quinol fumarate reductase frda t234a mutation
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
243
structure length
243
Chain Sequence
AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fumarate reductase flavoprotein subunit
publication title A threonine on the active site loop controls transition state formation in Escherichia coli respiratory complex II.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 62
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2008-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3cirB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3cirB01
1DOYA 4C7ZA 2WP9B 3HVZA 1GTHA 3AEEB 2BS3B 1YQ3B 1QOFA 1GPXA 2W3SA 1FM0D 1NI3A 1YJIA 2W54A 4YSYB 2PVOD 3B2FA 1PDXA 3AN1A 3KWLA 4HRSA 5EE1A 3W5UB 4A9AA 4YT0B 3W5VB 1XLPA 1E7PB 1JWBD 3WCQA 1KFYB 5H8YE 3SR6A 3AEBB 1V8CA 1PFDA 3AECB 3AEAB 2ACZB 1WWTA 1E6EB 3B9JA 3NVVA 5AUKA 4US9A 2Q5WD 3AE8B 4C7YA 1QOBA 5EE3A 4JX1C 1ZP0B 2EKIA 4YSXB 4WWMA 1B9RA 1NYQA 3AB5A 4N58A 3LB8C 4ZHOA 1N63A 2WU2B 1SIJA 1CJEA 3AEDB 2WU5B 1QOAA 5AUIA 2H88B 4YXDB 1E0ZA 1XLOA 3DWMA 3P63A 1F0ZA 3P4QB 3SFEB 1IUEA 1WXQA 2K22A 3VR8B 2M19A 1N62A 1PUTA 2N0SB 2WDRB 4YSZB 1L6VA 2WDVB 4HROA 1JW9D 2KAJA 3AEFB 5C3JB 4YTPB 4YTMB 1ZUD2 1RFKA 3ABVB 3FC4A 1TKEA 4ITKA 4ZOHC 2JQRB 5G5GA 1QF6A 3NRZA 1DGJA 2K5PA 1JROA 1JRPA 3P1MA 1TYGB 1AYFA 3CIRB 1GAQB 3NVYA 1JQ4A 1FFUA 1FXAA 1XLQA 3CWIA 1J7CA 1N61A 3HRDD 3W9CB 1JWAD 2WDQB 2KMMA 4N6EB 1XLNA 1ZXIA 1VDVA 1XO3A 1WYGA 2CJNA 1OQQA 1KRHA 3ETRA 4USAA 1TJEA 2JX5A 4LTUA 3AV8A 1H7XA 3VR9B 1I7HA 2K9XA 3AE5B 3HUIA 4WQMA 1FRRA 3P4PB 2L83A 3AM9A 3PO0A 2Y5CA 1KF6B 2CJOA 4YTNB 2AX5A 2PKOA 1L5PA 4IDIA 1J7BA 1FMAD 5G5HA 1VLBA 3AE4B 1QLBB 3AE3B 2DBYA 1N5WA 4JWSC 1E10A 2QIEB 1FO4A 3NVZA 2E3TA 1NEKB 1FIQA 2BS2B 1T3QA 1GT8A 3RPFC 1FFVA 2LEKA 3AH7A 1N5XA 4US8A 2PVGC 1AWDA 3L4PA 2CU3A 3CF4A 1TKYA 1JALA 3AMZA 1FRDA 3FAHA 3NS1A 2QJLA 3AE2B 1N60A 1OFFA 1RWSA 4P6VF 1YJJA 5EE9A 2PIAA 5GXGB 1V97A 1UWMA 1VJKA 4ZHPA 1DOXA 1TKGA 1E9MA 1RM6C 1J7AA 3B2GA 3DWGC 3NVWA 3VRAB 2W3RA 3ZYYX 3AE9B 2BS4B 2L52A 2BT6A 1WGKA 2WS3B 1WRIA 1EWYC 1L6UA 3P4RB 1NYRA 3AEGB 3P4SB 3EUB2 2MJDA 1NVID 5H92C 1FXIA 4FXCA 4C80A 1R7SA 2DWQA 2HTME 4N59A 1GTEA 1DOIA 2G1EA 1YQ4B 3SFDB 2FBWB 2MH7A 2B76B 4JWUC 5MPOA 2W55A 1ROEA 2WQYB 4KX6B 2H89B 3LXFA 1ZOYB 1A70A 1RYJA 2MJ3A 2M56B 1QT9A 1OQRA 2OHFA 1SF0A 3BIID 1L0VB 3AE7B 5C2TB 5EE0A 1CZPA 1NENB 3AE6B 1QOGA 3VRBB 2MJEA 3AE1B 1SB3C 2WLBA 1H7WA
chains in the Genus database with same CATH superfamily
4K7WA 3RI7C 4WURA 2C7MB 4ACFA 1XLPA 3VFKA 3PZ8A 3VUXA 3A9KA 2QDFA 5BMHA 2NMQA 1QILA 4HLEA 2AL3A 1YN4A 1I42A 1WZ0A 3UF8A 3DWMA 4G11A 2KK8A 3IVFA 1UF0A 2JZZA 2GI9A 4LJOB 1WYWB 2KLGA 5D6JB 4L23A 4K81A 3CWIA 3BVGA 3MHZA 3PTFC 4N6EB 3T9LA 4RNAA 2FCSA 2CJNA 2V0GA 4JLCA 2BYTA 3K9PB 3URYA 2JWZA 2IGHA 3ZIMA 4DDGD 1Y8RC 3Q3NC 2D3GA 1VR9A 1HA5A 1DYQA 1J7BA 1QLBB 3AE3B 2WXIA 2WNMA 3VXWA 1SEBD 4GLSC 3SEBA 3N20C 2LEKA 2KNBA 4LJPB 2M0AA 2CU3A 2ZCBA 3MJWA 3ONSA 1PQSA 3PLUA 3B0AA 1D5XC 4G50A 2N7EA 2KFJA 3VRAB 3ZYYX 3ZVVA 3BINA 3PHXB 4OZBA 2C7HA 2LHEA 2OJRA 5IAAC 2FIFA 1FXIA 4FXCA 4HPLB 4IWOA 1R7SA 3Q6BA 1WRDB 4KGSA 3JW0X 2PTLA 3DVGY 4XDDA 4KDLB 3MTNB 2M0XA 2C5LC 2INDC 1JWUD 1XQQA 1RAXA 3ECIA 1J8CA 1GTHA 1JRUA 3DPDA 2W3SA 2RSUA 1QKZA 3V62A 3CSFA 2BYVE 3RYTA 2KD0A 5EE3A 2EKIA 4YSXB 1XCQL 3CMMB 2JZPA 2NBUA 3TIXA 4YXDB 1FPYA 5J17A 1M94A 2G4DB 3O65B 4HROA 3L08A 5C3JB 2IDYA 1RFKA 1TKEA 1GJZA 1P9DU 2KDEB 2N4FA 3WAOA 1J7CA 3HHMA 4LNKA 3UGBB 2MW5A 4W9IA 4A3OA 1I7HA 1GOZA 2IGGA 3RNBC 4W9KA 1YMHE 3APDA 2KKCA 2BQQA 4C4VB 3PO0A 4MACA 4DHJB 1V2YA 5AZFA 4GN1A 3VUWA 3TMPB 3DVNU 4US8A 4ANXA 4DK5A 2LJ5A 1RWSA 2JUOA 5AZGA 3GE8C 1LO5D 3ZJVA 2VZKB 2BS4B 3ML9A 2LUEA 3W1SA 1GC7A 4PS7A 2X8XX 3DHHC 3U4EG 1ZKHA 1FNVA 2DZMA 1ROEA 3ALBA 3PREA 1P7FA 3VDZA 4ZYNA 3AE7B 3HIZA 3ZNZB 1HZ6A 1P3QU 3KLSX 1H7WA 3NOBA 3PS6A 3M95A 2M4NA 4W9GA 2O6VB 4REZA 3GS2A 3SR6A 1GB1A 1WZ3A 2MHJA 5AUKA 4LNNA 4C7YA 3N9YC 4KGRA 1C1YB 4MT5A 2RMMA 2KDIA 4XWWA 1F0ZA 4KIKA 2IPKD 2O6VD 3VTUA 1QF6A 2J7QB 3L10B 4J3OD 4JIOU 4CHKA 1S1QB 3BVMA 3QHTA 2J4XA 3TUOA 1ZXIA 3Q3MC 2GMIC 1XO3A 4XWTA 1KJTA 1I35A 3U8ZA 2O2VA 2JF5A 3AM9A 4HEA1 4NAWA 2G9HD 1AW7A 4TMAB 4YWGG 2PKOA 3H1UA 2KYWA 4JQWC 3RZFA 3B1LX 1WGYA 2FCMA 4KDIC 1HTQA 1VD2A 1SIFA 2E3TA 3SHQA 3LYYA 4II2B 1N5XA 2JY6A 2MSED 1FRDA 3ZTDA 2Z0DB 2XN9C 1FD6A 2NR2A 2J0JA 3IXSA 3BZDB 1WH3A 3V05A 1YIWA 1MFWA 2BT6A 4BBNF 4NNJB 1WJUA 4IM0A 1VZ6A 3KVFB 4JWUC 1MHXA 1ZOYB 2NPTB 2AQ3B 5GMVA 4MH8A 5EE0A 4HPMB 4FJZA 3H8HA 2I2YA 1T0RC 3S2AA 2CHXA 2REXA 1ENFA 2BKFA 2BB6A 2IBIB 2MP2A 2LXAA 1NI3A 3R7QA 5EE1A 2HTHA 2MBHA 3NG0A 4MSQB 2NPTA 2N9KA 1L4DB 5JH5C 1ZP0B 3UI3A 3U7DA 1N63A 2WU2B 3IHPC 3PGEA 3T8MA 5CHVC 4ITKA 2WDRB 2DNFA 1I4XA 1IGDA 3AEFB 1EO6A 2NBWB 4YTMB 4W9FA 1JROA 3N32A 4G3XB 1AYFA 2CHZA 3HRDD 3L13A 4A90A 1T0SC 1EU4A 3TEXA 5DPWA 1EWCA 4WQMA 3ZJUA 4FHKA 1KF6B 3GZNI 2KHWB 3ZLZA 2MQJA 4HJGE 1EUVB 4M02A 2LHDA 1WX8A 1E10A 1WJ6A 3ZRFA 2NTSA 2KX0A 2BYFA 4RM8A 3Q8AA 2KDFB 4FJVB 4C00A 2GOWA 1V97A 2ZPNA 2LVOA 4TSSA 1M4VA 3TEWA 1K8RB 3AE9B 3TEZA 3RN9C 4IW0A 2BWES 2E6XA 2PPHA 4DHZB 2RR9A 3EECA 3Q8BA 1SGHA 2DWQA 4N59A 1E8ZA 2PJHA 1GTEA 1YJ1A 2G1EA 3IAM1 3DBHI 3LXFA 1RYJA 4FBJB 2JU6X 1Q0WB 1SF0A 5E6NA 3CF6E 1QOGA 2QCZA 3PRZA 2WLBA 4OZAA 4ANUA 4RGNA 4DWFA 2ZEQA 4BKGA 1UNSA 3Q8FA 4NY0A 1YX6B 2KC1A 5H8YE 4ANWA 1R4NB 2Z59B 4NQKE 1E6EB 2LGIA 3MHSD 3AB5A 1LFDA 3DHGC 1ZXHA 3JYUA 3T3NA 4YSZB 1L6VA 1F52A 3P2BA 4WWPA 3LDZE 5G5GA 3EA6A 1TYGB 1BMLC 4KVGB 1JWSD 2DHZA 1XLNA 1VDVA 2YEPF 4KSKC 2GBMA 1GUAB 1T0QC 1BXTA 2M17A 2PEAA 1ZW7A 3N1YC 2LGYA 4DXFA 3NUHB 3IBEA 3RNAC 1K52A 1SE4A 1KLUD 2NCNA 1ZGUB 2GBNA 2BTEA 2A4ZA 1J0GA 4ANVA 3ZNID 1OFFA 5BMGA 2KDBA 2B3AA 2GLSA 3MP9A 4X57B 1NI2A 4K7UA 4ZRKA 1KLGD 2UWQA 3DDCB 4FULA 1NYRA 2YLMA 4M8MA 5BYRA 2RDBC 3I3TB 4F7ZA 1WR1A 4KSLC 4K3BA 2KTRB 3BWUD 1NENB 4II3B 4IC7B 3BK2A 3Q14C 2WP9B 1Y56A 5G55A 3DCGA 2W54A 2DYOA 4EUTA 2W9NA 1WWTA 4E71A 3AE8B 2N7JA 4N58A 4NJCA 3TJPA 5KHQA 2MBQA 1CJEA 2H88B 4L1BA 2C7NB 4W9EA 3P4QB 4XX5A 1TS4A 3ZO5B 3M63B 1E5WA 1DGJA 4PYUA 2CKHB 4GSWA 3U2SC 1BT0A 1OQQA 5EDSA 4KGTA 3M3JA 2ASQA 2GBKA 1RRBA 3KUZA 4RGTA 3RNCC 1VZ8A 3GOEA 2JRHA 2BYEA 1AARA 1N5WA 2DZIA 1FNWA 2KTFA 2KOXA 3M62B 5HHDG 2GB1A 3OJ4B 2PMVA 2QSDA 3FAHA 2K6DB 3C0RB 4RGOS 4P6VF 3ZXRA 5EE9A 4NZLB 1UGMA 5HKHA 2KT7A 1TIFA 2L52A 3U30A 5H92C 5BYSA 4HKQA 4IM3A 1YNTE 1I4GA 5MPOA 1L0YB 2H89B 1AN8A 2KVZA 1HEZE 5C2TB 1CZPA 3Q3JA 1HXYD 3ZDMC 3D32A 4MJSA 5E6JA 2FUHB 3V6CB 3KWLA 1V86A 4HRSA 4NAMA 2BF8B 2N7DA 2PVOD 1Z2MA 4A9AA 4YT0B 2N9LA 2LGSA 4GB9A 1E7UA 3VVWB 2RDGA 1KOTA 3B9JA 2N1VA 1TBEA 2V3NA 1QOBA 3V6EB 5HFYA 1FEHA 2RDHA 2WX1A 3AEDB 3ZQ4A 5AUIA 3H6NA 3VTWA 1JQ4A 4I6LB 5D3IB 1WXMA 2WXPA 3V60A 2DX5B 4FHJA 4I6NB 1D3ZA 4MGKE 4YTPB 1OEYJ 1T6BX 1E90A 1P98A 2HJ8A 3CIRB 1FFUA 1FXAA 1RFAA 2KMMA 3TBLD 4LTUA 3AV8A 5LNK1 3VR9B 3QA8A 5D2MB 3QIJA 2Y5CA 1LXDA 3O13A 1E8XA 3VUYA 1WGGA 4FA6A 1C4PA 4E3CA 3NVZA 2KVRA 1XEEA 1D5ZC 2OOBB 2PVGC 4ARCA 2LGDA 1SBBB 1N6ZA 4EZLA 4RF0A 2QJLA 1IYFA 3R2IA 5GXGB 2N9EB 4LK0M 5DPTA 3UINB 1UWMA 1DOXA 3NZSA 1CK1A 3IT6B 2V3PA 2KO3A 1KTKA 1WGKA 3NY5A 1EWYC 1TT5B 3P4SB 4N9F4 2JVCA 1SE3A 2HTME 3MJ5A 3KQ4A 3SFDB 3TEYA 1H8CA 1GG3A 3ZDTA 4B95A 3DHIC 3R66C 1UZXB 4ICUA 3VHTC 4DHJD 4ZYSA 2MA9B 2PIAA 2CS4A 2GBJA 3AU5A 4WJQA 1L7YA 3J9CA 5LXHA 4DQOC 4G0NB 2BKRB 2SEBD 3QWZB 1WXVA 2JPHA 2IY1B 1BUIC 2J53A 1PYWD 3WA0A 4IKGA 1ET9A 1C3TA 2VZKD 1FNUA 1Q1OA 2M19A 1PUTA 1TS5A 3N1ZC 3FC4A 1P1AA 4KIKB 4PS3A 2GRIA 5TSSA 2K8CA 4BOZB 1XCTL 3B08A 4WH4A 1YN5A 4MGYE 3DBSA 5DPSA 3Q3FA 4ICVA 4USAA 1FXTB 1H7XA 1H4RA 2K1FA 2WHIA 3WIMA 4P1CC 3DBLB 1VRAB 4K7SA 2LJIA 3VTVA 2O2VB 2BB5A 4IDIA 4HPPA 4NAWB 3DBRB 2QIEB 4IWQA 3HM3A 2HE7A 2QHOA 3RNGC 4TV3A 2DYBA 3WAMA 2L7RA 3A4SC 3PVLA 3P42A 1V6EA 1J7AA 2ZW0A 4EE2A 4P16A 2WS3B 3AULA 4OZCA 4BVUC 3ZUNA 1YQ4B 3QJZA 1ZDVA 2IO3B 2IO0B 1QT9A 1OQRA 2OHFA 3VH3B 1SSNA 4A3PA 4WIPA 3WAPA 1WR6E 3W1SC 3KYCD 1FM0D 1YJIA 4YSYB 3PV1A 2D07B 1QZEA 2ZNVB 3W5VB 2MP2B 3ZNGC 2ACZB 3TL5A 2ICIA 3I5JC 1K53A 1NYQA 4MELA 1MJDA 4KKJA 3ZRCA 1SIJA 2WXRA 1I4RA 1WXQA 2KN5A 1KLVA 1R4MB 4XDCA 2TSSA 2QEJC 3KUCB 2KWUB 5L83A 2C9WB 1F1HA 2K5PA 2FE8A 4W9LA 4DBGA 4WJNA 5C23A 1F2RC 1N61A 2BW2A 2KX3A 4A8XC 2IJ0A 3V61A 4FN2A 3A9JA 2KMCA 3TCAA 3HUIA 2LRUA 4WQOB 1MVKA 1FRRA 3KUDB 2PE9A 3QAQA 1ZE3D 2AX5A 5HI1A 4OVZA 1J19A 2MBEA 2I1JA 4LDTB 2IYDB 2WXGA 3AH7A 3Q3OC 3EFCA 3CF4A 4BBNC 5IN7A 3AE2B 1UH6A 4ASWC 3BY4B 2QMTA 2FAZA 3H9DA 3NJTA 3R2TA 2K3UA 3E9SA 3MC0B 1D4BA 2WXOA 3DVNV 5G2NA 4LDTD 4BFRA 4CYEA 1PGAA 2INCC 3P4RB 5IP4D 1LM8B 1R4NI 2B76B 3PZDA 1SJHD 2MLBA 4RH6A 5CTRC 2KWDA 1L0VB 3APFA 2MEKA 2AWTA 2WXJA 4HCPB 2ZVNA 1WJNA 3IAS1 3GB1A 4M8NA 4OHJA 3KWVA 2LASA 4JGHB 2Y3AA 4MEMA 5J18A 2DLBA 1PGBA 3HVDA 2VH2A 1V5OA 2V4LA 1E8YA 1PFDA 3AECB 1JCKB 2D5GA 2YEPB 2QC8A 1TY0A 1WJ4A 2WXKA 2DYMA 2FCQA 1Q5WB 2ZNVC 1XLOA 2BGFA 4LCDE 2CHWA 1LQBA 2WGSA 4RGMA 2LVPA 2Z0EB 3MFGA 4J6IA 3R7RA 4OW0A 3DVGX 2J0KA 1HE8A 2L0FA 4MM3B 2KWVB 4AOFA 1ET6A 4BZAA 1KRHA 3SD5A 2YVCA 3AE5B 3PSEB 3RCZA 2IZVB 2K39A 4AWJA 2L83A 4AP4C 2K8BA 1V1PA 2LZ6A 2R2OA 3IG3A 4MM3A 4E74A 3NHEB 3ZW3A 3VAWA 1WX9A 1AWDA 1TKYA 4IUMB 3NS1A 2NBVB 2RPVA 3T3OA 3ZGZA 4M0WB 3B2GA 1FCLA 2JYEA 1WGDA 3KH0A 2DENB 2L0TA 1L6UA 3NZUA 1C4CA 1XF5L 3BYYB 2K6QA 3OAWA 2JZ3B 5E6PA 3UQBA 1A70A 2LVQA 2MJ3A 2N9PC 4M0WA 4M00A 3A33B 4MGZE 1GC6A 2FCNA 2R61A 2MJEA 2ON8A 1QOFA 2IGDA 2AL6A 1IGCA 1E7PB 2HD5B 1V8CA 1CMXB 4IOIE 2MX2A 3FILB 4JX1C 4WWMA 1WE6A 1IBXA 3RMKC 1TS2A 3LB8C 4ZHOA 1HQRD 2MRPA 1IUEA 1K51A 3HVZA 1MG8A 3NS8A 4HKZE 2ZPYA 4PT5A 1EU3A 3EHVA 2X38A 4W9DA 3FILA 4ZRIA 1C4AA 4BKSA 3HK0A 2KQ4X 2QILA 2XK5B 2WDQB 1WX7A 3PRPB 4URKA 3IT4B 4O1NA 2KJ6A 3ZKJC 3GP7A 2WX0A 2J0MA 4W9JA 1IP9A 1ACCA 2XK5A 4AJYB 4F1SA 2RGFA 3AMZA 1PGXA 2FIDA 3HM6X 3BK1A 4M01A 1VJKA 4ZRPA 1YD8U 5TR5A 1SXTA 4AJWA 3JSVA 2W82A 4HK2A 2JXXA 1TTNA 1YQBA 1YOVB 4UDUC 4B0EA 4LNIA 1STEA 2KANA 2HDEA 2PW9A 2PLPA 2J42A 2M1MA 3OWEB 4RF1A 1ZPSA 1I4PA 3ML8A 1YQ3B 1DOYA 1QQRA 1PDXA 4MJSB 1WY8A 2D11A 4WAFA 4BOSC 3MC9A 1T0YA 4XC2A 1UUPA 1B9RA 2PE6B 4A20A 1Z5SB 3C8YA 4DXGA 1NBFC 2LRWA 2INNE 3QQ8B 3L54A 1V5TA 2N0SB 3AU4A 4GGQA 2D3CA 2LGXA 2V9HA 2D10A 1TS3A 4MGIE 4Q2JA 4EZKA 1OTRB 4B6WA 1KM7A 2Y5PA 1GAQB 4JL9A 4GMVA 3U7ZA 1K50A 4K3CA 2KQ7A 1TJEA 1GNUA 4P1BC 3QK0A 5JXVA 5JZEB 4MDKE 1WXSA 4AS1A 3PHWB 1SE9A 3N1XC 2GBRA 1WXAA 2FUG1 3AE4B 4DXAB 1FO4A 1LGRA 2DZJA 1FIQA 1T3QA 2BS2B 3RUIB 1GT8A 2C60A 1EM7A 4TUUA 4R3DA 1TGZB 1N60A 2BVCA 5D94A 1ESFA 1TKGA 3RNFC 5LXIB 2XNAC 3ZTCA 2W3RA 4JE3B 2ZJDA 4BAXA 1SJED 3Q8EA 2J52A 4XE0A 3N3KB 1V1OA 5I4DA 3ENEA 1V9JA 2KQSA 1I4HA 1YX5B 2EMSA 3UIOB 2L1AA 1CQVA 3RULA 2MCNB 1MPEA 5FR6A 2G45B 3EC8A 2KACA 1F2RI 2AQ1B 4C7ZA 1UWXA 3AEEB 4AQ7A 3PPAA 3AN1A 3DQVA 4GDLB 1KFYB 2OEDA 4HDQA 4HDOA 3AEAB 3W2DA 1V81A 5JHAA 2VRRB 4CO7A 1V49A 4D2KA 1UGJA 3RT3B 1C78A 2ZVOA 2JSVX 2L05A 3UIPB 2WXLA 1L4ZB 3OLMD 3X23A 2AYOB 2DAJA 3DBLI 4GIVA 1MI0A 4GDLA 4NQLB 1ZUD2 3AI5A 4CQNA 1WM2A 3DBRI 2UU7A 2ONQA 3IFWB 5AZHA 1XLQA 1GB4A 1Q10A 3W9CB 1JWAD 4BKTA 1WYGA 4C4VA 3ETRA 3R8BA 5FR3A 1C9FA 1L0XB 4YTNB 1A5RA 2IO2B 1L5PA 4S17A 2A5UA 5G5HA 2LUMA 2DBYA 2LFIA 1SE2A 3RPFC 2MBOA 3L4PA 4WJPA 1JALA 4S0RA 5FKAC 4ZHPA 1WE7A 5CX3A 4LNFA 2I38A 2K0PA 5KHOA 3NVWA 2JRIB 3EGRA 3WALA 2WXNA 4GXBA 3CSTA 5E6OA 1XD3B 2G4SA 1DOIA 2MH7A 2Y5BB 3ZJTA 5L95C 4KX6B 1F77A 4XGAB 1UBQA 1D5MC 1VZ7A 2L3ZA 5CHWA 2WWZA 2BBCA 2IO1B 4A6QA 1L2NA 3VRBB 1OQYA 3AE1B 2O6VA 5HG2A 4ARIA 1WM3A 1R4MI 3B2FA 3WCQA 4TQ1A 2I1KA 5DCNA 4EKUA 3AEBB 2WXQA 3A1QB 3Q8CA 3NVVA 1E7VA 5D7GA 2Q5WD 1XXGA 3R3MA 2EMTA 4ZRQA 2NVUI 5CHFA 1TY2A 2KMAA 3Q2AC 3RNEC 1EF1A 2AEHA 2BWFA 3ABVB 3A1QA 5BMIA 3I63C 1WF9A 2JQRB 2Z8LA 3L16A 4KZ0A 4C56C 2UYZB 2KN4A 3KW5B 1MHHE 2LI5A 3PT2B 4XZ4A 1X1MA 2JT4B 3QC8B 2N1WA 4XYCA 2KDMA 4KZCA 3P4PB 2D2QA 2D3AA 3A9JB 5IOIA 1XT9B 2KFKB 1NDDA 1FMAD 4LLGM 4JWSC 5D3DA 2WXMA 5BO4B 1NEKB 3OJ3A 1FFVA 1WIAA 2RD0A 2K8HA 1V80A 4FLHA 4WJOA 1ISNA 4DHZE 1IPGA 4DDID 4W9CA 3QCAA 1WGRA 2HJ1A 1E9MA 2KFKA 3SDLC 2KWCA 3H7PB 1WFYA 4IM2A 1UD7A 4NPNA 1UBIA 3DWGC 3FKYA 1HZ5A 1E8WA 4RMAA 5DPRA 3APCA 4PYZA 5C1ZA 4W9HA 1VCBA 4GOCA 1T5XD 1S3SG 2JWUA 5IA7A 1JMLA 4NJ7A 2KC2A 3H7PA 3BIID 2JXTA 4GDKB 2DZKA 3OG5A 2BS3B 3ZNHB 1WGHA 4K1RB 4RFBA 1F9JA 2MWSB 4PK1A 1EF5A 2LXCA 2CR5A 4US9A 4GDKA 1QOAA 4HCNB 4RCOA 2L76A 4KKIA 2K22A 3SFEB 4B0MA 3ZXVA 4P7IA 4IG7B 1JW9D 2LWPA 1MG4A 5JHBA 1JWMD 2L8JA 1OGWA 3NRZA 3P1MA 5J2RA 3Q69A 4AUQC 4YL8A 1WI0A 3L0WB 2D3BA 3BVZA 2V1YA 1C77A 3MC8A 1KH0A 2KLCA 4KV2A 4LNOA 2ZCCA 2ZW1A 4WAAA 1TZ1A 1VLBA 3N30A 1V1PB 3I57A 2JYTA 4MSMB 4L2YA 1YJJA 2KJHB 4OVVA 3GZNB 1RM6C 3H7SA 1OEYA 2BPSA 5AEKB 2K25A 5LLIA 2R2QA 1WRIA 4RM9A 4HJKA 2V3SA 4PS8A 3EUB2 2MJDA 1NVID 4HWIB 2L00B 2FBWB 3AXCA 4EZJA 4FADA 3RZWC 3KYDD 2V4IB 4ZRJA 2M56B 3SU8X 4EOYA 1HTOA 4IWPA 3VQIA 3QARA 2INPE 2VH1A 3NZ3A 4HXDA 2IY0B 2L32A 2ZZPB 3PLVA 4F8CB 4EEWA 1GPXA 2EELA 2NTTA 3I9V1 3W5UB 4I6PA 2AQ2B 3QX1A 1JWBD 4JPSA 2MBBB 2SAKA 4WWOA 2XEWA 3E56A 3DBHB 3PZ7A 1ZDXA 4TKNA 3W1YA 3JVZX 1FCCC 2CU1A 2EKEC 4NJ6A 2WU5B 2N9XA 3GE3C 2RPQA 1E0ZA 4TQ0A 1IBXB 3P63A 3VR8B 4ZDVA 1N62A 2WDVB 2KAJA 3U52E 4OVUA 3TSSA 1TZOA 5IO9A 1P7EA 4ZOHC 1D6EC 1WSPA 1JRPA 4FJYA 1U4AA 4MH0E 3BYTB 3NVYA 2WYQA 4EFOA 3UQAA 2JX5A 2G3QB 4B9KA 2K9XA 1C79A 2M8SA 5BYQA 2LMCA 3X0WA 1I4QA 2LD9A 2WXHA 2CJOA 1WMHB 4HVBA 3PRMB 4WWNA 5T8IA 2NS5A 3RD2A 3RFZB 2DAFA 4BKSD 3C19A 1RLFA 1UELA 3WANA 3A4RA 1YN3A 1WMHA 4H2AA 1P0RA 3VH4B 3V3XA 3LJ3A 3DOWA 3AEGB 3L17A 4C80A 2KTRA 3JSVB 3EFUA 3K9OB 1C76A 1B1ZA 2W55A 2WQYB 3A9KB 2WXFA 4A55A 1G6JA 4QAYA 2KJRA 2KZRA 5FK9C 3AE6B 2XBBC 2WDTB 2KXJA 1SB3C 2OJWA 4GU2A 5IKCM 2FNJB
chains in the Genus database with same CATH topology
4RGNA 4C7ZA 1UWXA 3AEEB 4AQ7A 1FM0D 1YJIA 4YSYB 1UNSA 4WURA 3AN1A 3Q8FA 3W5VB 1XLPA 3PZ8A 4GDLB 1KFYB 5H8YE 2OEDA 3AEAB 2ACZB 5BMHA 1E6EB 3W2DA 2ICIA 2LGIA 1K53A 2NMQA 1QILA 1NYQA 3AB5A 4D2KA 1ZXHA 4KKJA 1UGJA 1SIJA 1C78A 3T3NA 2JSVX 1YN4A 2WXLA 1L4ZB 2WXRA 1I4RA 3DWMA 1WXQA 1MI0A 4YSZB 1L6VA 4XDCA 2TSSA 2QEJC 2GI9A 1ZUD2 4CQNA 5G5GA 3EA6A 2K5PA 2FE8A 2ONQA 4L23A 1TYGB 1BMLC 1XLQA 1GB4A 1F2RC 3CWIA 1N61A 1Q10A 1JWSD 3W9CB 1JWAD 2BW2A 3BVGA 3MHZA 4N6EB 1XLNA 1VDVA 2YEPF 4A8XC 4RNAA 1WYGA 2IJ0A 2CJNA 3ETRA 2V0GA 2BYTA 1BXTA 3R8BA 3HUIA 5FR3A 3URYA 1C9FA 1MVKA 1FRRA 2IGHA 1L0XB 1ZE3D 4YTNB 4DXFA 2AX5A 3NUHB 5HI1A 1K52A 1VR9A 1HA5A 1DYQA 1L5PA 1J7BA 1SE4A 4OVZA 5G5HA 2LUMA 1QLBB 3AE3B 1KLUD 2DBYA 2LFIA 1SE2A 2WXIA 2WNMA 1SEBD 4GLSC 3SEBA 2BTEA 3RPFC 2LEKA 2WXGA 3AH7A 3L4PA 2M0AA 2CU3A 3CF4A 1JALA 3AE2B 1OFFA 5BMGA 5FKAC 1D5XC 4ZHPA 2QMTA 3MP9A 2I38A 2K0PA 3R2TA 2K3UA 1KLGD 3E9SA 3NVWA 3MC0B 3VRAB 3EGRA 3ZYYX 1D4BA 2WXOA 2WXNA 4OZBA 2LHEA 1PGAA 3P4RB 1NYRA 5BYRA 1FXIA 4FXCA 1R7SA 1DOIA 2MH7A 2B76B 4KGSA 1SJHD 2PTLA 3ZJTA 4XDDA 4KX6B 1F77A 4RH6A 1D5MC 2KWDA 1VZ7A 3BWUD 1L0VB 2MEKA 2BBCA 1JWUD 4A6QA 2WXJA 1NENB 3VRBB 3AE1B 5HG2A 4ARIA 3BK2A 3IAS1 3GB1A 4OHJA 3KWVA 2WP9B 1Y56A 1GTHA 2Y3AA 2W3SA 2W54A 2DLBA 3B2FA 1PGBA 1QKZA 2DYOA 3HVDA 3WCQA 4TQ1A 3AEBB 2WXQA 1PFDA 3AECB 1JCKB 3NVVA 3Q8CA 1WWTA 2D5GA 2YEPB 5D7GA 2Q5WD 3AE8B 1TY0A 2N7JA 2WXKA 5EE3A 1XXGA 4YSXB 1XCQL 2EKIA 4N58A 4ZRQA 4NJCA 2DYMA 2JZPA 1TY2A 1CJEA 2H88B 4YXDB 1XLOA 4L1BA 3P4QB 4HROA 1TS4A 4RGMA 5C3JB 2IDYA 1RFKA 3ABVB 5BMIA 3MFGA 1TKEA 2JQRB 2Z8LA 1DGJA 4OW0A 4C56C 4MM3B 2KN4A 1MHHE 1J7CA 1ET6A 3U2SC 1OQQA 1KRHA 1I7HA 1GOZA 4KGTA 3AE5B 2IGGA 2KDMA 1YMHE 4RGTA 3P4PB 1VZ8A 2L83A 3PO0A 4MACA 1V1PA 1FMAD 4LLGM 4JWSC 1N5WA 5D3DA 2WXMA 1FNWA 1NEKB 4US8A 1FFVA 5HHDG 1AWDA 2GB1A 2PMVA 1TKYA 2QSDA 3FAHA 3NS1A 4RGOS 1RWSA 4P6VF 5EE9A 4NZLB 2RPVA 1E9MA 3T3OA 3ZGZA 1LO5D 3ZJVA 3B2GA 1FCLA 2JYEA 3DWGC 1HZ5A 2VZKB 2BS4B 2L52A 3W1SA 1L6UA 1T5XD 5H92C 2JWUA 5BYSA 1C4CA 1XF5L 4HKQA 3U4EG 1YNTE 1I4GA 1FNVA 3BYYB 5MPOA 1JMLA 1L0YB 1ROEA 2H89B 1A70A 2MJ3A 1AN8A 1P7FA 4M0WA 1HEZE 3BIID 3AE7B 5C2TB 2JXTA 1CZPA 1HXYD 2R61A 4GDKB 1HZ6A 2MJEA 2ON8A 3KLSX 1H7WA 5E6JA 2BS3B 1QOFA 2IGDA 3KWLA 4NAMA 4HRSA 2PVOD 1IGCA 4RFBA 4A9AA 4OZAA 4REZA 4YT0B 3GS2A 1E7PB 2N9LA 3SR6A 1GB1A 1V8CA 2RDGA 3B9JA 5AUKA 2V3NA 4IOIE 4US9A 4C7YA 1QOBA 3FILB 3N9YC 4JX1C 4KGRA 4WWMA 1IBXA 4MT5A 5HFYA 1TS2A 3LB8C 4ZHOA 1FEHA 2RMMA 2RDHA 4XWWA 3ZQ4A 3AEDB 1QOAA 1HQRD 5AUIA 4RCOA 4KKIA 1F0ZA 1JQ4A 1IUEA 3SFEB 1K51A 2K22A 3HVZA 5D3IB 4B0MA 2IPKD 2WXPA 1JW9D 4HKZE 4YTPB 4PT5A 1T6BX 1EU3A 1JWMD 1QF6A 2X38A 3NRZA 4J3OD 3FILA 3P1MA 1C4AA 3BVMA 3CIRB 3Q69A 1FFUA 1FXAA 2KQ4X 2J4XA 2QILA 3TUOA 2WDQB 2KMMA 1ZXIA 4XWTA 1XO3A 3BVZA 1C77A 4LTUA 3IT4B 4O1NA 3AV8A 1KH0A 5LNK1 3VR9B 3GP7A 3AM9A 2Y5CA 4HEA1 2G9HD 1AW7A 4TMAB 2ZW1A 4YWGG 2PKOA 3O13A 1VLBA 1ACCA 1C4PA 1V1PB 3NVZA 1XEEA 1D5ZC 2E3TA 3I57A 3LYYA 1N5XA 2JYTA 2PVGC 4ARCA 1SBBB 3AMZA 1FRDA 1PGXA 4L2YA 4RF0A 2QJLA 3R2IA 1YJJA 5GXGB 4LK0M 3BK1A 1UWMA 1VJKA 1DOXA 2XN9C 1FD6A 3IXSA 3BZDB 1CK1A 3IT6B 4ZRPA 3V05A 1RM6C 2V3PA 1SXTA 2BT6A 1KTKA 1WGKA 1WRIA 1EWYC 3P4SB 3EUB2 2MJDA 1NVID 2W82A 1SE3A 1VZ6A 2HTME 3MJ5A 4JWUC 3KQ4A 3SFDB 2FBWB 4UDUC 4B0EA 1STEA 3TEYA 1MHXA 1ZOYB 2V4IB 2HDEA 2M56B 2AQ3B 2PW9A 2PLPA 4MH8A 3VQIA 2J42A 2INPE 5EE0A 3H8HA 3OWEB 4RF1A 3NZ3A 4ZYSA 1ZPSA 2I2YA 1I4PA 2L32A 2PIAA 1ENFA 2BB6A 1YQ3B 3J9CA 1GPXA 2EELA 1NI3A 2NTTA 3I9V1 1DOYA 1QQRA 1PDXA 3W5UB 5EE1A 4DQOC 2AQ2B 4JPSA 1JWBD 2SAKA 3E56A 4WAFA 2N9KA 2SEBD 1L4DB 3PZ7A 1ZDXA 1ZP0B 1UUPA 1B9RA 1BUIC 2J53A 3C8YA 3UI3A 4DXGA 1FCCC 1N63A 2WU2B 1PYWD 2INNE 2WU5B 4IKGA 1E0ZA 1ET9A 4TQ0A 1IBXB 2VZKD 3P63A 1FNUA 2M19A 4ITKA 2N0SB 3VR8B 1N62A 1PUTA 2WDRB 2WDVB 1I4XA 1IGDA 1TS5A 2KAJA 3AEFB 1TS3A 4YTMB 4Q2JA 3U52E 3FC4A 3TSSA 1TZOA 1P7EA 4ZOHC 1D6EC 1JROA 1WSPA 1JRPA 2Y5PA 1AYFA 1GAQB 2GRIA 3BYTB 3NVYA 5TSSA 3U7ZA 1XCTL 1K50A 3HRDD 4WH4A 1YN5A 4A90A 4USAA 1EU4A 3TEXA 1TJEA 2JX5A 1H7XA 1C79A 2K9XA 5JXVA 1EWCA 5BYQA 2LMCA 4WQMA 4AS1A 3ZJUA 1I4QA 2WXHA 1VRAB 2LJIA 1KF6B 2CJOA 2BB5A 4HJGE 4IDIA 2FUG1 3AE4B 2LHDA 4NAWB 1E10A 5T8IA 2QIEB 1FO4A 1FIQA 1T3QA 2BS2B 2NTSA 1GT8A 3RFZB 1EM7A 4R3DA 3Q8AA 1N60A 1V97A 1ESFA 1YN3A 1TKGA 4H2AA 3P42A 4TSSA 3TEWA 1M4VA 2XNAC 1J7AA 2ZW0A 2W3RA 4EE2A 4JE3B 3AE9B 4P16A 3TEZA 3V3XA 2WS3B 2E6XA 1SJED 3AEGB 3Q8EA 3Q8BA 4OZCA 4C80A 2J52A 4XE0A 2DWQA 1V1OA 4N59A 5I4DA 1GTEA 2G1EA 1YQ4B 1ZDVA 3IAM1 1C76A 1B1ZA 2W55A 2WQYB 1I4HA 3LXFA 1RYJA 2WXFA 2JU6X 1QT9A 1OQRA 2L1AA 2OHFA 1SF0A 4A55A 1CQVA 1MPEA 1SSNA 5FK9C 3AE6B 4WIPA 1QOGA 1SB3C 2WLBA 2KACA 1F2RI 2AQ1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DOY A;  4C7Z A;  2WP9 B;  3HVZ A;  1GTH A;  3AEE B;  2BS3 B;  1YQ3 B;  1QOF A;  1GPX A;  2W3S A;  1FM0 D;  1NI3 A;  1YJI A;  2W54 A;  4YSY B;  2PVO D;  3B2F A;  1PDX A;  3AN1 A;  3KWL A;  4HRS A;  5EE1 A;  3W5U B;  4A9A A;  4YT0 B;  3W5V B;  1XLP A;  1E7P B;  1JWB D;  3WCQ A;  1KFY B;  5H8Y E;  3SR6 A;  3AEB B;  1V8C A;  1PFD A;  3AEC B;  3AEA B;  2ACZ B;  1WWT A;  1E6E B;  3B9J A;  3NVV A;  5AUK A;  4US9 A;  2Q5W D;  3AE8 B;  4C7Y A;  1QOB A;  5EE3 A;  4JX1 C;  1ZP0 B;  2EKI A;  4YSX B;  4WWM A;  1B9R A;  1NYQ A;  3AB5 A;  4N58 A;  3LB8 C;  4ZHO A;  1N63 A;  2WU2 B;  1SIJ A;  1CJE A;  3AED B;  2WU5 B;  1QOA A;  5AUI A;  2H88 B;  4YXD B;  1E0Z A;  1XLO A;  3DWM A;  3P63 A;  1F0Z A;  3P4Q B;  3SFE B;  1IUE A;  1WXQ A;  2K22 A;  3VR8 B;  2M19 A;  1N62 A;  1PUT A;  2N0S B;  2WDR B;  4YSZ B;  1L6V A;  2WDV B;  4HRO A;  1JW9 D;  2KAJ A;  3AEF B;  5C3J B;  4YTP B;  4YTM B;  1ZUD 2;  1RFK A;  3ABV B;  3FC4 A;  1TKE A;  4ITK A;  4ZOH C;  2JQR B;  5G5G A;  1QF6 A;  3NRZ A;  1DGJ A;  2K5P A;  1JRO A;  1JRP A;  3P1M A;  1TYG B;  1AYF A;  3CIR B;  1GAQ B;  3NVY A;  1JQ4 A;  1FFU A;  1FXA A;  1XLQ A;  3CWI A;  1J7C A;  1N61 A;  3HRD D;  3W9C B;  1JWA D;  2WDQ B;  2KMM A;  4N6E B;  1XLN A;  1ZXI A;  1VDV A;  1XO3 A;  1WYG A;  2CJN A;  1OQQ A;  1KRH A;  3ETR A;  4USA A;  1TJE A;  2JX5 A;  4LTU A;  3AV8 A;  1H7X A;  3VR9 B;  1I7H A;  2K9X A;  3AE5 B;  3HUI A;  4WQM A;  1FRR A;  3P4P B;  2L83 A;  3AM9 A;  3PO0 A;  2Y5C A;  1KF6 B;  2CJO A;  4YTN B;  2AX5 A;  2PKO A;  1L5P A;  4IDI A;  1J7B A;  1FMA D;  5G5H A;  1VLB A;  3AE4 B;  1QLB B;  3AE3 B;  2DBY A;  1N5W A;  4JWS C;  1E10 A;  2QIE B;  1FO4 A;  3NVZ A;  2E3T A;  1NEK B;  1FIQ A;  2BS2 B;  1T3Q A;  1GT8 A;  3RPF C;  1FFV A;  2LEK A;  3AH7 A;  1N5X A;  4US8 A;  2PVG C;  1AWD A;  3L4P A;  2CU3 A;  3CF4 A;  1TKY A;  1JAL A;  3AMZ A;  1FRD A;  3FAH A;  3NS1 A;  2QJL A;  3AE2 B;  1N60 A;  1OFF A;  1RWS A;  4P6V F;  1YJJ A;  5EE9 A;  2PIA A;  5GXG B;  1V97 A;  1UWM A;  1VJK A;  4ZHP A;  1DOX A;  1TKG A;  1E9M A;  1RM6 C;  1J7A A;  3B2G A;  3DWG C;  3NVW A;  3VRA B;  2W3R A;  3ZYY X;  3AE9 B;  2BS4 B;  2L52 A;  2BT6 A;  1WGK A;  2WS3 B;  1WRI A;  1EWY C;  1L6U A;  3P4R B;  1NYR A;  3AEG B;  3P4S B;  3EUB 2;  2MJD A;  1NVI D;  5H92 C;  1FXI A;  4FXC A;  4C80 A;  1R7S A;  2DWQ A;  2HTM E;  4N59 A;  1GTE A;  1DOI A;  2G1E A;  1YQ4 B;  3SFD B;  2FBW B;  2MH7 A;  2B76 B;  4JWU C;  5MPO A;  2W55 A;  1ROE A;  2WQY B;  4KX6 B;  2H89 B;  3LXF A;  1ZOY B;  1A70 A;  1RYJ A;  2MJ3 A;  2M56 B;  1QT9 A;  1OQR A;  2OHF A;  1SF0 A;  3BII D;  1L0V B;  3AE7 B;  5C2T B;  5EE0 A;  1CZP A;  1NEN B;  3AE6 B;  1QOG A;  3VRB B;  2MJE A;  3AE1 B;  1SB3 C;  2WLB A;  1H7W A; 
#chains in the Genus database with same CATH topology
 4K7W A;  3RI7 C;  4WUR A;  2C7M B;  4ACF A;  1XLP A;  3VFK A;  3PZ8 A;  3VUX A;  3A9K A;  2QDF A;  5BMH A;  2NMQ A;  1QIL A;  4HLE A;  2AL3 A;  1YN4 A;  1I42 A;  1WZ0 A;  3UF8 A;  3DWM A;  4G11 A;  2KK8 A;  3IVF A;  1UF0 A;  2JZZ A;  2GI9 A;  4LJO B;  1WYW B;  2KLG A;  5D6J B;  4L23 A;  4K81 A;  3CWI A;  3BVG A;  3MHZ A;  3PTF C;  4N6E B;  3T9L A;  4RNA A;  2FCS A;  2CJN A;  2V0G A;  4JLC A;  2BYT A;  3K9P B;  3URY A;  2JWZ A;  2IGH A;  3ZIM A;  4DDG D;  1Y8R C;  3Q3N C;  2D3G A;  1VR9 A;  1HA5 A;  1DYQ A;  1J7B A;  1QLB B;  3AE3 B;  2WXI A;  2WNM A;  3VXW A;  1SEB D;  4GLS C;  3SEB A;  3N20 C;  2LEK A;  2KNB A;  4LJP B;  2M0A A;  2CU3 A;  2ZCB A;  3MJW A;  3ONS A;  1PQS A;  3PLU A;  3B0A A;  1D5X C;  4G50 A;  2N7E A;  2KFJ A;  3VRA B;  3ZYY X;  3ZVV A;  3BIN A;  3PHX B;  4OZB A;  2C7H A;  2LHE A;  2OJR A;  5IAA C;  2FIF A;  1FXI A;  4FXC A;  4HPL B;  4IWO A;  1R7S A;  3Q6B A;  1WRD B;  4KGS A;  3JW0 X;  2PTL A;  3DVG Y;  4XDD A;  4KDL B;  3MTN B;  2M0X A;  2C5L C;  2IND C;  1JWU D;  1XQQ A;  1RAX A;  3ECI A;  1J8C A;  1GTH A;  1JRU A;  3DPD A;  2W3S A;  2RSU A;  1QKZ A;  3V62 A;  3CSF A;  2BYV E;  3RYT A;  2KD0 A;  5EE3 A;  2EKI A;  4YSX B;  1XCQ L;  3CMM B;  2JZP A;  2NBU A;  3TIX A;  4YXD B;  1FPY A;  5J17 A;  1M94 A;  2G4D B;  3O65 B;  4HRO A;  3L08 A;  5C3J B;  2IDY A;  1RFK A;  1TKE A;  1GJZ A;  1P9D U;  2KDE B;  2N4F A;  3WAO A;  1J7C A;  3HHM A;  4LNK A;  3UGB B;  2MW5 A;  4W9I A;  4A3O A;  1I7H A;  1GOZ A;  2IGG A;  3RNB C;  4W9K A;  1YMH E;  3APD A;  2KKC A;  2BQQ A;  4C4V B;  3PO0 A;  4MAC A;  4DHJ B;  1V2Y A;  5AZF A;  4GN1 A;  3VUW A;  3TMP B;  3DVN U;  4US8 A;  4ANX A;  4DK5 A;  2LJ5 A;  1RWS A;  2JUO A;  5AZG A;  3GE8 C;  1LO5 D;  3ZJV A;  2VZK B;  2BS4 B;  3ML9 A;  2LUE A;  3W1S A;  1GC7 A;  4PS7 A;  2X8X X;  3DHH C;  3U4E G;  1ZKH A;  1FNV A;  2DZM A;  1ROE A;  3ALB A;  3PRE A;  1P7F A;  3VDZ A;  4ZYN A;  3AE7 B;  3HIZ A;  3ZNZ B;  1HZ6 A;  1P3Q U;  3KLS X;  1H7W A;  3NOB A;  3PS6 A;  3M95 A;  2M4N A;  4W9G A;  2O6V B;  4REZ A;  3GS2 A;  3SR6 A;  1GB1 A;  1WZ3 A;  2MHJ A;  5AUK A;  4LNN A;  4C7Y A;  3N9Y C;  4KGR A;  1C1Y B;  4MT5 A;  2RMM A;  2KDI A;  4XWW A;  1F0Z A;  4KIK A;  2IPK D;  2O6V D;  3VTU A;  1QF6 A;  2J7Q B;  3L10 B;  4J3O D;  4JIO U;  4CHK A;  1S1Q B;  3BVM A;  3QHT A;  2J4X A;  3TUO A;  1ZXI A;  3Q3M C;  2GMI C;  1XO3 A;  4XWT A;  1KJT A;  1I35 A;  3U8Z A;  2O2V A;  2JF5 A;  3AM9 A;  4HEA 1;  4NAW A;  2G9H D;  1AW7 A;  4TMA B;  4YWG G;  2PKO A;  3H1U A;  2KYW A;  4JQW C;  3RZF A;  3B1L X;  1WGY A;  2FCM A;  4KDI C;  1HTQ A;  1VD2 A;  1SIF A;  2E3T A;  3SHQ A;  3LYY A;  4II2 B;  1N5X A;  2JY6 A;  2MSE D;  1FRD A;  3ZTD A;  2Z0D B;  2XN9 C;  1FD6 A;  2NR2 A;  2J0J A;  3IXS A;  3BZD B;  1WH3 A;  3V05 A;  1YIW A;  1MFW A;  2BT6 A;  4BBN F;  4NNJ B;  1WJU A;  4IM0 A;  1VZ6 A;  3KVF B;  4JWU C;  1MHX A;  1ZOY B;  2NPT B;  2AQ3 B;  5GMV A;  4MH8 A;  5EE0 A;  4HPM B;  4FJZ A;  3H8H A;  2I2Y A;  1T0R C;  3S2A A;  2CHX A;  2REX A;  1ENF A;  2BKF A;  2BB6 A;  2IBI B;  2MP2 A;  2LXA A;  1NI3 A;  3R7Q A;  5EE1 A;  2HTH A;  2MBH A;  3NG0 A;  4MSQ B;  2NPT A;  2N9K A;  1L4D B;  5JH5 C;  1ZP0 B;  3UI3 A;  3U7D A;  1N63 A;  2WU2 B;  3IHP C;  3PGE A;  3T8M A;  5CHV C;  4ITK A;  2WDR B;  2DNF A;  1I4X A;  1IGD A;  3AEF B;  1EO6 A;  2NBW B;  4YTM B;  4W9F A;  1JRO A;  3N32 A;  4G3X B;  1AYF A;  2CHZ A;  3HRD D;  3L13 A;  4A90 A;  1T0S C;  1EU4 A;  3TEX A;  5DPW A;  1EWC A;  4WQM A;  3ZJU A;  4FHK A;  1KF6 B;  3GZN I;  2KHW B;  3ZLZ A;  2MQJ A;  4HJG E;  1EUV B;  4M02 A;  2LHD A;  1WX8 A;  1E10 A;  1WJ6 A;  3ZRF A;  2NTS A;  2KX0 A;  2BYF A;  4RM8 A;  3Q8A A;  2KDF B;  4FJV B;  4C00 A;  2GOW A;  1V97 A;  2ZPN A;  2LVO A;  4TSS A;  1M4V A;  3TEW A;  1K8R B;  3AE9 B;  3TEZ A;  3RN9 C;  4IW0 A;  2BWE S;  2E6X A;  2PPH A;  4DHZ B;  2RR9 A;  3EEC A;  3Q8B A;  1SGH A;  2DWQ A;  4N59 A;  1E8Z A;  2PJH A;  1GTE A;  1YJ1 A;  2G1E A;  3IAM 1;  3DBH I;  3LXF A;  1RYJ A;  4FBJ B;  2JU6 X;  1Q0W B;  1SF0 A;  5E6N A;  3CF6 E;  1QOG A;  2QCZ A;  3PRZ A;  2WLB A;  4OZA A;  4ANU A;  4RGN A;  4DWF A;  2ZEQ A;  4BKG A;  1UNS A;  3Q8F A;  4NY0 A;  1YX6 B;  2KC1 A;  5H8Y E;  4ANW A;  1R4N B;  2Z59 B;  4NQK E;  1E6E B;  2LGI A;  3MHS D;  3AB5 A;  1LFD A;  3DHG C;  1ZXH A;  3JYU A;  3T3N A;  4YSZ B;  1L6V A;  1F52 A;  3P2B A;  4WWP A;  3LDZ E;  5G5G A;  3EA6 A;  1TYG B;  1BML C;  4KVG B;  1JWS D;  2DHZ A;  1XLN A;  1VDV A;  2YEP F;  4KSK C;  2GBM A;  1GUA B;  1T0Q C;  1BXT A;  2M17 A;  2PEA A;  1ZW7 A;  3N1Y C;  2LGY A;  4DXF A;  3NUH B;  3IBE A;  3RNA C;  1K52 A;  1SE4 A;  1KLU D;  2NCN A;  1ZGU B;  2GBN A;  2BTE A;  2A4Z A;  1J0G A;  4ANV A;  3ZNI D;  1OFF A;  5BMG A;  2KDB A;  2B3A A;  2GLS A;  3MP9 A;  4X57 B;  1NI2 A;  4K7U A;  4ZRK A;  1KLG D;  2UWQ A;  3DDC B;  4FUL A;  1NYR A;  2YLM A;  4M8M A;  5BYR A;  2RDB C;  3I3T B;  4F7Z A;  1WR1 A;  4KSL C;  4K3B A;  2KTR B;  3BWU D;  1NEN B;  4II3 B;  4IC7 B;  3BK2 A;  3Q14 C;  2WP9 B;  1Y56 A;  5G55 A;  3DCG A;  2W54 A;  2DYO A;  4EUT A;  2W9N A;  1WWT A;  4E71 A;  3AE8 B;  2N7J A;  4N58 A;  4NJC A;  3TJP A;  5KHQ A;  2MBQ A;  1CJE A;  2H88 B;  4L1B A;  2C7N B;  4W9E A;  3P4Q B;  4XX5 A;  1TS4 A;  3ZO5 B;  3M63 B;  1E5W A;  1DGJ A;  4PYU A;  2CKH B;  4GSW A;  3U2S C;  1BT0 A;  1OQQ A;  5EDS A;  4KGT A;  3M3J A;  2ASQ A;  2GBK A;  1RRB A;  3KUZ A;  4RGT A;  3RNC C;  1VZ8 A;  3GOE A;  2JRH A;  2BYE A;  1AAR A;  1N5W A;  2DZI A;  1FNW A;  2KTF A;  2KOX A;  3M62 B;  5HHD G;  2GB1 A;  3OJ4 B;  2PMV A;  2QSD A;  3FAH A;  2K6D B;  3C0R B;  4RGO S;  4P6V F;  3ZXR A;  5EE9 A;  4NZL B;  1UGM A;  5HKH A;  2KT7 A;  1TIF A;  2L52 A;  3U30 A;  5H92 C;  5BYS A;  4HKQ A;  4IM3 A;  1YNT E;  1I4G A;  5MPO A;  1L0Y B;  2H89 B;  1AN8 A;  2KVZ A;  1HEZ E;  5C2T B;  1CZP A;  3Q3J A;  1HXY D;  3ZDM C;  3D32 A;  4MJS A;  5E6J A;  2FUH B;  3V6C B;  3KWL A;  1V86 A;  4HRS A;  4NAM A;  2BF8 B;  2N7D A;  2PVO D;  1Z2M A;  4A9A A;  4YT0 B;  2N9L A;  2LGS A;  4GB9 A;  1E7U A;  3VVW B;  2RDG A;  1KOT A;  3B9J A;  2N1V A;  1TBE A;  2V3N A;  1QOB A;  3V6E B;  5HFY A;  1FEH A;  2RDH A;  2WX1 A;  3AED B;  3ZQ4 A;  5AUI A;  3H6N A;  3VTW A;  1JQ4 A;  4I6L B;  5D3I B;  1WXM A;  2WXP A;  3V60 A;  2DX5 B;  4FHJ A;  4I6N B;  1D3Z A;  4MGK E;  4YTP B;  1OEY J;  1T6B X;  1E90 A;  1P98 A;  2HJ8 A;  3CIR B;  1FFU A;  1FXA A;  1RFA A;  2KMM A;  3TBL D;  4LTU A;  3AV8 A;  5LNK 1;  3VR9 B;  3QA8 A;  5D2M B;  3QIJ A;  2Y5C A;  1LXD A;  3O13 A;  1E8X A;  3VUY A;  1WGG A;  4FA6 A;  1C4P A;  4E3C A;  3NVZ A;  2KVR A;  1XEE A;  1D5Z C;  2OOB B;  2PVG C;  4ARC A;  2LGD A;  1SBB B;  1N6Z A;  4EZL A;  4RF0 A;  2QJL A;  1IYF A;  3R2I A;  5GXG B;  2N9E B;  4LK0 M;  5DPT A;  3UIN B;  1UWM A;  1DOX A;  3NZS A;  1CK1 A;  3IT6 B;  2V3P A;  2KO3 A;  1KTK A;  1WGK A;  3NY5 A;  1EWY C;  1TT5 B;  3P4S B;  4N9F 4;  2JVC A;  1SE3 A;  2HTM E;  3MJ5 A;  3KQ4 A;  3SFD B;  3TEY A;  1H8C A;  1GG3 A;  3ZDT A;  4B95 A;  3DHI C;  3R66 C;  1UZX B;  4ICU A;  3VHT C;  4DHJ D;  4ZYS A;  2MA9 B;  2PIA A;  2CS4 A;  2GBJ A;  3AU5 A;  4WJQ A;  1L7Y A;  3J9C A;  5LXH A;  4DQO C;  4G0N B;  2BKR B;  2SEB D;  3QWZ B;  1WXV A;  2JPH A;  2IY1 B;  1BUI C;  2J53 A;  1PYW D;  3WA0 A;  4IKG A;  1ET9 A;  1C3T A;  2VZK D;  1FNU A;  1Q1O A;  2M19 A;  1PUT A;  1TS5 A;  3N1Z C;  3FC4 A;  1P1A A;  4KIK B;  4PS3 A;  2GRI A;  5TSS A;  2K8C A;  4BOZ B;  1XCT L;  3B08 A;  4WH4 A;  1YN5 A;  4MGY E;  3DBS A;  5DPS A;  3Q3F A;  4ICV A;  4USA A;  1FXT B;  1H7X A;  1H4R A;  2K1F A;  2WHI A;  3WIM A;  4P1C C;  3DBL B;  1VRA B;  4K7S A;  2LJI A;  3VTV A;  2O2V B;  2BB5 A;  4IDI A;  4HPP A;  4NAW B;  3DBR B;  2QIE B;  4IWQ A;  3HM3 A;  2HE7 A;  2QHO A;  3RNG C;  4TV3 A;  2DYB A;  3WAM A;  2L7R A;  3A4S C;  3PVL A;  3P42 A;  1V6E A;  1J7A A;  2ZW0 A;  4EE2 A;  4P16 A;  2WS3 B;  3AUL A;  4OZC A;  4BVU C;  3ZUN A;  1YQ4 B;  3QJZ A;  1ZDV A;  2IO3 B;  2IO0 B;  1QT9 A;  1OQR A;  2OHF A;  3VH3 B;  1SSN A;  4A3P A;  4WIP A;  3WAP A;  1WR6 E;  3W1S C;  3KYC D;  1FM0 D;  1YJI A;  4YSY B;  3PV1 A;  2D07 B;  1QZE A;  2ZNV B;  3W5V B;  2MP2 B;  3ZNG C;  2ACZ B;  3TL5 A;  2ICI A;  3I5J C;  1K53 A;  1NYQ A;  4MEL A;  1MJD A;  4KKJ A;  3ZRC A;  1SIJ A;  2WXR A;  1I4R A;  1WXQ A;  2KN5 A;  1KLV A;  1R4M B;  4XDC A;  2TSS A;  2QEJ C;  3KUC B;  2KWU B;  5L83 A;  2C9W B;  1F1H A;  2K5P A;  2FE8 A;  4W9L A;  4DBG A;  4WJN A;  5C23 A;  1F2R C;  1N61 A;  2BW2 A;  2KX3 A;  4A8X C;  2IJ0 A;  3V61 A;  4FN2 A;  3A9J A;  2KMC A;  3TCA A;  3HUI A;  2LRU A;  4WQO B;  1MVK A;  1FRR A;  3KUD B;  2PE9 A;  3QAQ A;  1ZE3 D;  2AX5 A;  5HI1 A;  4OVZ A;  1J19 A;  2MBE A;  2I1J A;  4LDT B;  2IYD B;  2WXG A;  3AH7 A;  3Q3O C;  3EFC A;  3CF4 A;  4BBN C;  5IN7 A;  3AE2 B;  1UH6 A;  4ASW C;  3BY4 B;  2QMT A;  2FAZ A;  3H9D A;  3NJT A;  3R2T A;  2K3U A;  3E9S A;  3MC0 B;  1D4B A;  2WXO A;  3DVN V;  5G2N A;  4LDT D;  4BFR A;  4CYE A;  1PGA A;  2INC C;  3P4R B;  5IP4 D;  1LM8 B;  1R4N I;  2B76 B;  3PZD A;  1SJH D;  2MLB A;  4RH6 A;  5CTR C;  2KWD A;  1L0V B;  3APF A;  2MEK A;  2AWT A;  2WXJ A;  4HCP B;  2ZVN A;  1WJN A;  3IAS 1;  3GB1 A;  4M8N A;  4OHJ A;  3KWV A;  2LAS A;  4JGH B;  2Y3A A;  4MEM A;  5J18 A;  2DLB A;  1PGB A;  3HVD A;  2VH2 A;  1V5O A;  2V4L A;  1E8Y A;  1PFD A;  3AEC B;  1JCK B;  2D5G A;  2YEP B;  2QC8 A;  1TY0 A;  1WJ4 A;  2WXK A;  2DYM A;  2FCQ A;  1Q5W B;  2ZNV C;  1XLO A;  2BGF A;  4LCD E;  2CHW A;  1LQB A;  2WGS A;  4RGM A;  2LVP A;  2Z0E B;  3MFG A;  4J6I A;  3R7R A;  4OW0 A;  3DVG X;  2J0K A;  1HE8 A;  2L0F A;  4MM3 B;  2KWV B;  4AOF A;  1ET6 A;  4BZA A;  1KRH A;  3SD5 A;  2YVC A;  3AE5 B;  3PSE B;  3RCZ A;  2IZV B;  2K39 A;  4AWJ A;  2L83 A;  4AP4 C;  2K8B A;  1V1P A;  2LZ6 A;  2R2O A;  3IG3 A;  4MM3 A;  4E74 A;  3NHE B;  3ZW3 A;  3VAW A;  1WX9 A;  1AWD A;  1TKY A;  4IUM B;  3NS1 A;  2NBV B;  2RPV A;  3T3O A;  3ZGZ A;  4M0W B;  3B2G A;  1FCL A;  2JYE A;  1WGD A;  3KH0 A;  2DEN B;  2L0T A;  1L6U A;  3NZU A;  1C4C A;  1XF5 L;  3BYY B;  2K6Q A;  3OAW A;  2JZ3 B;  5E6P A;  3UQB A;  1A70 A;  2LVQ A;  2MJ3 A;  2N9P C;  4M0W A;  4M00 A;  3A33 B;  4MGZ E;  1GC6 A;  2FCN A;  2R61 A;  2MJE A;  2ON8 A;  1QOF A;  2IGD A;  2AL6 A;  1IGC A;  1E7P B;  2HD5 B;  1V8C A;  1CMX B;  4IOI E;  2MX2 A;  3FIL B;  4JX1 C;  4WWM A;  1WE6 A;  1IBX A;  3RMK C;  1TS2 A;  3LB8 C;  4ZHO A;  1HQR D;  2MRP A;  1IUE A;  1K51 A;  3HVZ A;  1MG8 A;  3NS8 A;  4HKZ E;  2ZPY A;  4PT5 A;  1EU3 A;  3EHV A;  2X38 A;  4W9D A;  3FIL A;  4ZRI A;  1C4A A;  4BKS A;  3HK0 A;  2KQ4 X;  2QIL A;  2XK5 B;  2WDQ B;  1WX7 A;  3PRP B;  4URK A;  3IT4 B;  4O1N A;  2KJ6 A;  3ZKJ C;  3GP7 A;  2WX0 A;  2J0M A;  4W9J A;  1IP9 A;  1ACC A;  2XK5 A;  4AJY B;  4F1S A;  2RGF A;  3AMZ A;  1PGX A;  2FID A;  3HM6 X;  3BK1 A;  4M01 A;  1VJK A;  4ZRP A;  1YD8 U;  5TR5 A;  1SXT A;  4AJW A;  3JSV A;  2W82 A;  4HK2 A;  2JXX A;  1TTN A;  1YQB A;  1YOV B;  4UDU C;  4B0E A;  4LNI A;  1STE A;  2KAN A;  2HDE A;  2PW9 A;  2PLP A;  2J42 A;  2M1M A;  3OWE B;  4RF1 A;  1ZPS A;  1I4P A;  3ML8 A;  1YQ3 B;  1DOY A;  1QQR A;  1PDX A;  4MJS B;  1WY8 A;  2D11 A;  4WAF A;  4BOS C;  3MC9 A;  1T0Y A;  4XC2 A;  1UUP A;  1B9R A;  2PE6 B;  4A20 A;  1Z5S B;  3C8Y A;  4DXG A;  1NBF C;  2LRW A;  2INN E;  3QQ8 B;  3L54 A;  1V5T A;  2N0S B;  3AU4 A;  4GGQ A;  2D3C A;  2LGX A;  2V9H A;  2D10 A;  1TS3 A;  4MGI E;  4Q2J A;  4EZK A;  1OTR B;  4B6W A;  1KM7 A;  2Y5P A;  1GAQ B;  4JL9 A;  4GMV A;  3U7Z A;  1K50 A;  4K3C A;  2KQ7 A;  1TJE A;  1GNU A;  4P1B C;  3QK0 A;  5JXV A;  5JZE B;  4MDK E;  1WXS A;  4AS1 A;  3PHW B;  1SE9 A;  3N1X C;  2GBR A;  1WXA A;  2FUG 1;  3AE4 B;  4DXA B;  1FO4 A;  1LGR A;  2DZJ A;  1FIQ A;  1T3Q A;  2BS2 B;  3RUI B;  1GT8 A;  2C60 A;  1EM7 A;  4TUU A;  4R3D A;  1TGZ B;  1N60 A;  2BVC A;  5D94 A;  1ESF A;  1TKG A;  3RNF C;  5LXI B;  2XNA C;  3ZTC A;  2W3R A;  4JE3 B;  2ZJD A;  4BAX A;  1SJE D;  3Q8E A;  2J52 A;  4XE0 A;  3N3K B;  1V1O A;  5I4D A;  3ENE A;  1V9J A;  2KQS A;  1I4H A;  1YX5 B;  2EMS A;  3UIO B;  2L1A A;  1CQV A;  3RUL A;  2MCN B;  1MPE A;  5FR6 A;  2G45 B;  3EC8 A;  2KAC A;  1F2R I;  2AQ1 B;  4C7Z A;  1UWX A;  3AEE B;  4AQ7 A;  3PPA A;  3AN1 A;  3DQV A;  4GDL B;  1KFY B;  2OED A;  4HDQ A;  4HDO A;  3AEA B;  3W2D A;  1V81 A;  5JHA A;  2VRR B;  4CO7 A;  1V49 A;  4D2K A;  1UGJ A;  3RT3 B;  1C78 A;  2ZVO A;  2JSV X;  2L05 A;  3UIP B;  2WXL A;  1L4Z B;  3OLM D;  3X23 A;  2AYO B;  2DAJ A;  3DBL I;  4GIV A;  1MI0 A;  4GDL A;  4NQL B;  1ZUD 2;  3AI5 A;  4CQN A;  1WM2 A;  3DBR I;  2UU7 A;  2ONQ A;  3IFW B;  5AZH A;  1XLQ A;  1GB4 A;  1Q10 A;  3W9C B;  1JWA D;  4BKT A;  1WYG A;  4C4V A;  3ETR A;  3R8B A;  5FR3 A;  1C9F A;  1L0X B;  4YTN B;  1A5R A;  2IO2 B;  1L5P A;  4S17 A;  2A5U A;  5G5H A;  2LUM A;  2DBY A;  2LFI A;  1SE2 A;  3RPF C;  2MBO A;  3L4P A;  4WJP A;  1JAL A;  4S0R A;  5FKA C;  4ZHP A;  1WE7 A;  5CX3 A;  4LNF A;  2I38 A;  2K0P A;  5KHO A;  3NVW A;  2JRI B;  3EGR A;  3WAL A;  2WXN A;  4GXB A;  3CST A;  5E6O A;  1XD3 B;  2G4S A;  1DOI A;  2MH7 A;  2Y5B B;  3ZJT A;  5L95 C;  4KX6 B;  1F77 A;  4XGA B;  1UBQ A;  1D5M C;  1VZ7 A;  2L3Z A;  5CHW A;  2WWZ A;  2BBC A;  2IO1 B;  4A6Q A;  1L2N A;  3VRB B;  1OQY A;  3AE1 B;  2O6V A;  5HG2 A;  4ARI A;  1WM3 A;  1R4M I;  3B2F A;  3WCQ A;  4TQ1 A;  2I1K A;  5DCN A;  4EKU A;  3AEB B;  2WXQ A;  3A1Q B;  3Q8C A;  3NVV A;  1E7V A;  5D7G A;  2Q5W D;  1XXG A;  3R3M A;  2EMT A;  4ZRQ A;  2NVU I;  5CHF A;  1TY2 A;  2KMA A;  3Q2A C;  3RNE C;  1EF1 A;  2AEH A;  2BWF A;  3ABV B;  3A1Q A;  5BMI A;  3I63 C;  1WF9 A;  2JQR B;  2Z8L A;  3L16 A;  4KZ0 A;  4C56 C;  2UYZ B;  2KN4 A;  3KW5 B;  1MHH E;  2LI5 A;  3PT2 B;  4XZ4 A;  1X1M A;  2JT4 B;  3QC8 B;  2N1W A;  4XYC A;  2KDM A;  4KZC A;  3P4P B;  2D2Q A;  2D3A A;  3A9J B;  5IOI A;  1XT9 B;  2KFK B;  1NDD A;  1FMA D;  4LLG M;  4JWS C;  5D3D A;  2WXM A;  5BO4 B;  1NEK B;  3OJ3 A;  1FFV A;  1WIA A;  2RD0 A;  2K8H A;  1V80 A;  4FLH A;  4WJO A;  1ISN A;  4DHZ E;  1IPG A;  4DDI D;  4W9C A;  3QCA A;  1WGR A;  2HJ1 A;  1E9M A;  2KFK A;  3SDL C;  2KWC A;  3H7P B;  1WFY A;  4IM2 A;  1UD7 A;  4NPN A;  1UBI A;  3DWG C;  3FKY A;  1HZ5 A;  1E8W A;  4RMA A;  5DPR A;  3APC A;  4PYZ A;  5C1Z A;  4W9H A;  1VCB A;  4GOC A;  1T5X D;  1S3S G;  2JWU A;  5IA7 A;  1JML A;  4NJ7 A;  2KC2 A;  3H7P A;  3BII D;  2JXT A;  4GDK B;  2DZK A;  3OG5 A;  2BS3 B;  3ZNH B;  1WGH A;  4K1R B;  4RFB A;  1F9J A;  2MWS B;  4PK1 A;  1EF5 A;  2LXC A;  2CR5 A;  4US9 A;  4GDK A;  1QOA A;  4HCN B;  4RCO A;  2L76 A;  4KKI A;  2K22 A;  3SFE B;  4B0M A;  3ZXV A;  4P7I A;  4IG7 B;  1JW9 D;  2LWP A;  1MG4 A;  5JHB A;  1JWM D;  2L8J A;  1OGW A;  3NRZ A;  3P1M A;  5J2R A;  3Q69 A;  4AUQ C;  4YL8 A;  1WI0 A;  3L0W B;  2D3B A;  3BVZ A;  2V1Y A;  1C77 A;  3MC8 A;  1KH0 A;  2KLC A;  4KV2 A;  4LNO A;  2ZCC A;  2ZW1 A;  4WAA A;  1TZ1 A;  1VLB A;  3N30 A;  1V1P B;  3I57 A;  2JYT A;  4MSM B;  4L2Y A;  1YJJ A;  2KJH B;  4OVV A;  3GZN B;  1RM6 C;  3H7S A;  1OEY A;  2BPS A;  5AEK B;  2K25 A;  5LLI A;  2R2Q A;  1WRI A;  4RM9 A;  4HJK A;  2V3S A;  4PS8 A;  3EUB 2;  2MJD A;  1NVI D;  4HWI B;  2L00 B;  2FBW B;  3AXC A;  4EZJ A;  4FAD A;  3RZW C;  3KYD D;  2V4I B;  4ZRJ A;  2M56 B;  3SU8 X;  4EOY A;  1HTO A;  4IWP A;  3VQI A;  3QAR A;  2INP E;  2VH1 A;  3NZ3 A;  4HXD A;  2IY0 B;  2L32 A;  2ZZP B;  3PLV A;  4F8C B;  4EEW A;  1GPX A;  2EEL A;  2NTT A;  3I9V 1;  3W5U B;  4I6P A;  2AQ2 B;  3QX1 A;  1JWB D;  4JPS A;  2MBB B;  2SAK A;  4WWO A;  2XEW A;  3E56 A;  3DBH B;  3PZ7 A;  1ZDX A;  4TKN A;  3W1Y A;  3JVZ X;  1FCC C;  2CU1 A;  2EKE C;  4NJ6 A;  2WU5 B;  2N9X A;  3GE3 C;  2RPQ A;  1E0Z A;  4TQ0 A;  1IBX B;  3P63 A;  3VR8 B;  4ZDV A;  1N62 A;  2WDV B;  2KAJ A;  3U52 E;  4OVU A;  3TSS A;  1TZO A;  5IO9 A;  1P7E A;  4ZOH C;  1D6E C;  1WSP A;  1JRP A;  4FJY A;  1U4A A;  4MH0 E;  3BYT B;  3NVY A;  2WYQ A;  4EFO A;  3UQA A;  2JX5 A;  2G3Q B;  4B9K A;  2K9X A;  1C79 A;  2M8S A;  5BYQ A;  2LMC A;  3X0W A;  1I4Q A;  2LD9 A;  2WXH A;  2CJO A;  1WMH B;  4HVB A;  3PRM B;  4WWN A;  5T8I A;  2NS5 A;  3RD2 A;  3RFZ B;  2DAF A;  4BKS D;  3C19 A;  1RLF A;  1UEL A;  3WAN A;  3A4R A;  1YN3 A;  1WMH A;  4H2A A;  1P0R A;  3VH4 B;  3V3X A;  3LJ3 A;  3DOW A;  3AEG B;  3L17 A;  4C80 A;  2KTR A;  3JSV B;  3EFU A;  3K9O B;  1C76 A;  1B1Z A;  2W55 A;  2WQY B;  3A9K B;  2WXF A;  4A55 A;  1G6J A;  4QAY A;  2KJR A;  2KZR A;  5FK9 C;  3AE6 B;  2XBB C;  2WDT B;  2KXJ A;  1SB3 C;  2OJW A;  4GU2 A;  5IKC M;  2FNJ B; 
#chains in the Genus database with same CATH homology
 4RGN A;  4C7Z A;  1UWX A;  3AEE B;  4AQ7 A;  1FM0 D;  1YJI A;  4YSY B;  1UNS A;  4WUR A;  3AN1 A;  3Q8F A;  3W5V B;  1XLP A;  3PZ8 A;  4GDL B;  1KFY B;  5H8Y E;  2OED A;  3AEA B;  2ACZ B;  5BMH A;  1E6E B;  3W2D A;  2ICI A;  2LGI A;  1K53 A;  2NMQ A;  1QIL A;  1NYQ A;  3AB5 A;  4D2K A;  1ZXH A;  4KKJ A;  1UGJ A;  1SIJ A;  1C78 A;  3T3N A;  2JSV X;  1YN4 A;  2WXL A;  1L4Z B;  2WXR A;  1I4R A;  3DWM A;  1WXQ A;  1MI0 A;  4YSZ B;  1L6V A;  4XDC A;  2TSS A;  2QEJ C;  2GI9 A;  1ZUD 2;  4CQN A;  5G5G A;  3EA6 A;  2K5P A;  2FE8 A;  2ONQ A;  4L23 A;  1TYG B;  1BML C;  1XLQ A;  1GB4 A;  1F2R C;  3CWI A;  1N61 A;  1Q10 A;  1JWS D;  3W9C B;  1JWA D;  2BW2 A;  3BVG A;  3MHZ A;  4N6E B;  1XLN A;  1VDV A;  2YEP F;  4A8X C;  4RNA A;  1WYG A;  2IJ0 A;  2CJN A;  3ETR A;  2V0G A;  2BYT A;  1BXT A;  3R8B A;  3HUI A;  5FR3 A;  3URY A;  1C9F A;  1MVK A;  1FRR A;  2IGH A;  1L0X B;  1ZE3 D;  4YTN B;  4DXF A;  2AX5 A;  3NUH B;  5HI1 A;  1K52 A;  1VR9 A;  1HA5 A;  1DYQ A;  1L5P A;  1J7B A;  1SE4 A;  4OVZ A;  5G5H A;  2LUM A;  1QLB B;  3AE3 B;  1KLU D;  2DBY A;  2LFI A;  1SE2 A;  2WXI A;  2WNM A;  1SEB D;  4GLS C;  3SEB A;  2BTE A;  3RPF C;  2LEK A;  2WXG A;  3AH7 A;  3L4P A;  2M0A A;  2CU3 A;  3CF4 A;  1JAL A;  3AE2 B;  1OFF A;  5BMG A;  5FKA C;  1D5X C;  4ZHP A;  2QMT A;  3MP9 A;  2I38 A;  2K0P A;  3R2T A;  2K3U A;  1KLG D;  3E9S A;  3NVW A;  3MC0 B;  3VRA B;  3EGR A;  3ZYY X;  1D4B A;  2WXO A;  2WXN A;  4OZB A;  2LHE A;  1PGA A;  3P4R B;  1NYR A;  5BYR A;  1FXI A;  4FXC A;  1R7S A;  1DOI A;  2MH7 A;  2B76 B;  4KGS A;  1SJH D;  2PTL A;  3ZJT A;  4XDD A;  4KX6 B;  1F77 A;  4RH6 A;  1D5M C;  2KWD A;  1VZ7 A;  3BWU D;  1L0V B;  2MEK A;  2BBC A;  1JWU D;  4A6Q A;  2WXJ A;  1NEN B;  3VRB B;  3AE1 B;  5HG2 A;  4ARI A;  3BK2 A;  3IAS 1;  3GB1 A;  4OHJ A;  3KWV A;  2WP9 B;  1Y56 A;  1GTH A;  2Y3A A;  2W3S A;  2W54 A;  2DLB A;  3B2F A;  1PGB A;  1QKZ A;  2DYO A;  3HVD A;  3WCQ A;  4TQ1 A;  3AEB B;  2WXQ A;  1PFD A;  3AEC B;  1JCK B;  3NVV A;  3Q8C A;  1WWT A;  2D5G A;  2YEP B;  5D7G A;  2Q5W D;  3AE8 B;  1TY0 A;  2N7J A;  2WXK A;  5EE3 A;  1XXG A;  4YSX B;  1XCQ L;  2EKI A;  4N58 A;  4ZRQ A;  4NJC A;  2DYM A;  2JZP A;  1TY2 A;  1CJE A;  2H88 B;  4YXD B;  1XLO A;  4L1B A;  3P4Q B;  4HRO A;  1TS4 A;  4RGM A;  5C3J B;  2IDY A;  1RFK A;  3ABV B;  5BMI A;  3MFG A;  1TKE A;  2JQR B;  2Z8L A;  1DGJ A;  4OW0 A;  4C56 C;  4MM3 B;  2KN4 A;  1MHH E;  1J7C A;  1ET6 A;  3U2S C;  1OQQ A;  1KRH A;  1I7H A;  1GOZ A;  4KGT A;  3AE5 B;  2IGG A;  2KDM A;  1YMH E;  4RGT A;  3P4P B;  1VZ8 A;  2L83 A;  3PO0 A;  4MAC A;  1V1P A;  1FMA D;  4LLG M;  4JWS C;  1N5W A;  5D3D A;  2WXM A;  1FNW A;  1NEK B;  4US8 A;  1FFV A;  5HHD G;  1AWD A;  2GB1 A;  2PMV A;  1TKY A;  2QSD A;  3FAH A;  3NS1 A;  4RGO S;  1RWS A;  4P6V F;  5EE9 A;  4NZL B;  2RPV A;  1E9M A;  3T3O A;  3ZGZ A;  1LO5 D;  3ZJV A;  3B2G A;  1FCL A;  2JYE A;  3DWG C;  1HZ5 A;  2VZK B;  2BS4 B;  2L52 A;  3W1S A;  1L6U A;  1T5X D;  5H92 C;  2JWU A;  5BYS A;  1C4C A;  1XF5 L;  4HKQ A;  3U4E G;  1YNT E;  1I4G A;  1FNV A;  3BYY B;  5MPO A;  1JML A;  1L0Y B;  1ROE A;  2H89 B;  1A70 A;  2MJ3 A;  1AN8 A;  1P7F A;  4M0W A;  1HEZ E;  3BII D;  3AE7 B;  5C2T B;  2JXT A;  1CZP A;  1HXY D;  2R61 A;  4GDK B;  1HZ6 A;  2MJE A;  2ON8 A;  3KLS X;  1H7W A;  5E6J A;  2BS3 B;  1QOF A;  2IGD A;  3KWL A;  4NAM A;  4HRS A;  2PVO D;  1IGC A;  4RFB A;  4A9A A;  4OZA A;  4REZ A;  4YT0 B;  3GS2 A;  1E7P B;  2N9L A;  3SR6 A;  1GB1 A;  1V8C A;  2RDG A;  3B9J A;  5AUK A;  2V3N A;  4IOI E;  4US9 A;  4C7Y A;  1QOB A;  3FIL B;  3N9Y C;  4JX1 C;  4KGR A;  4WWM A;  1IBX A;  4MT5 A;  5HFY A;  1TS2 A;  3LB8 C;  4ZHO A;  1FEH A;  2RMM A;  2RDH A;  4XWW A;  3ZQ4 A;  3AED B;  1QOA A;  1HQR D;  5AUI A;  4RCO A;  4KKI A;  1F0Z A;  1JQ4 A;  1IUE A;  3SFE B;  1K51 A;  2K22 A;  3HVZ A;  5D3I B;  4B0M A;  2IPK D;  2WXP A;  1JW9 D;  4HKZ E;  4YTP B;  4PT5 A;  1T6B X;  1EU3 A;  1JWM D;  1QF6 A;  2X38 A;  3NRZ A;  4J3O D;  3FIL A;  3P1M A;  1C4A A;  3BVM A;  3CIR B;  3Q69 A;  1FFU A;  1FXA A;  2KQ4 X;  2J4X A;  2QIL A;  3TUO A;  2WDQ B;  2KMM A;  1ZXI A;  4XWT A;  1XO3 A;  3BVZ A;  1C77 A;  4LTU A;  3IT4 B;  4O1N A;  3AV8 A;  1KH0 A;  5LNK 1;  3VR9 B;  3GP7 A;  3AM9 A;  2Y5C A;  4HEA 1;  2G9H D;  1AW7 A;  4TMA B;  2ZW1 A;  4YWG G;  2PKO A;  3O13 A;  1VLB A;  1ACC A;  1C4P A;  1V1P B;  3NVZ A;  1XEE A;  1D5Z C;  2E3T A;  3I57 A;  3LYY A;  1N5X A;  2JYT A;  2PVG C;  4ARC A;  1SBB B;  3AMZ A;  1FRD A;  1PGX A;  4L2Y A;  4RF0 A;  2QJL A;  3R2I A;  1YJJ A;  5GXG B;  4LK0 M;  3BK1 A;  1UWM A;  1VJK A;  1DOX A;  2XN9 C;  1FD6 A;  3IXS A;  3BZD B;  1CK1 A;  3IT6 B;  4ZRP A;  3V05 A;  1RM6 C;  2V3P A;  1SXT A;  2BT6 A;  1KTK A;  1WGK A;  1WRI A;  1EWY C;  3P4S B;  3EUB 2;  2MJD A;  1NVI D;  2W82 A;  1SE3 A;  1VZ6 A;  2HTM E;  3MJ5 A;  4JWU C;  3KQ4 A;  3SFD B;  2FBW B;  4UDU C;  4B0E A;  1STE A;  3TEY A;  1MHX A;  1ZOY B;  2V4I B;  2HDE A;  2M56 B;  2AQ3 B;  2PW9 A;  2PLP A;  4MH8 A;  3VQI A;  2J42 A;  2INP E;  5EE0 A;  3H8H A;  3OWE B;  4RF1 A;  3NZ3 A;  4ZYS A;  1ZPS A;  2I2Y A;  1I4P A;  2L32 A;  2PIA A;  1ENF A;  2BB6 A;  1YQ3 B;  3J9C A;  1GPX A;  2EEL A;  1NI3 A;  2NTT A;  3I9V 1;  1DOY A;  1QQR A;  1PDX A;  3W5U B;  5EE1 A;  4DQO C;  2AQ2 B;  4JPS A;  1JWB D;  2SAK A;  3E56 A;  4WAF A;  2N9K A;  2SEB D;  1L4D B;  3PZ7 A;  1ZDX A;  1ZP0 B;  1UUP A;  1B9R A;  1BUI C;  2J53 A;  3C8Y A;  3UI3 A;  4DXG A;  1FCC C;  1N63 A;  2WU2 B;  1PYW D;  2INN E;  2WU5 B;  4IKG A;  1E0Z A;  1ET9 A;  4TQ0 A;  1IBX B;  2VZK D;  3P63 A;  1FNU A;  2M19 A;  4ITK A;  2N0S B;  3VR8 B;  1N62 A;  1PUT A;  2WDR B;  2WDV B;  1I4X A;  1IGD A;  1TS5 A;  2KAJ A;  3AEF B;  1TS3 A;  4YTM B;  4Q2J A;  3U52 E;  3FC4 A;  3TSS A;  1TZO A;  1P7E A;  4ZOH C;  1D6E C;  1JRO A;  1WSP A;  1JRP A;  2Y5P A;  1AYF A;  1GAQ B;  2GRI A;  3BYT B;  3NVY A;  5TSS A;  3U7Z A;  1XCT L;  1K50 A;  3HRD D;  4WH4 A;  1YN5 A;  4A90 A;  4USA A;  1EU4 A;  3TEX A;  1TJE A;  2JX5 A;  1H7X A;  1C79 A;  2K9X A;  5JXV A;  1EWC A;  5BYQ A;  2LMC A;  4WQM A;  4AS1 A;  3ZJU A;  1I4Q A;  2WXH A;  1VRA B;  2LJI A;  1KF6 B;  2CJO A;  2BB5 A;  4HJG E;  4IDI A;  2FUG 1;  3AE4 B;  2LHD A;  4NAW B;  1E10 A;  5T8I A;  2QIE B;  1FO4 A;  1FIQ A;  1T3Q A;  2BS2 B;  2NTS A;  1GT8 A;  3RFZ B;  1EM7 A;  4R3D A;  3Q8A A;  1N60 A;  1V97 A;  1ESF A;  1YN3 A;  1TKG A;  4H2A A;  3P42 A;  4TSS A;  3TEW A;  1M4V A;  2XNA C;  1J7A A;  2ZW0 A;  2W3R A;  4EE2 A;  4JE3 B;  3AE9 B;  4P16 A;  3TEZ A;  3V3X A;  2WS3 B;  2E6X A;  1SJE D;  3AEG B;  3Q8E A;  3Q8B A;  4OZC A;  4C80 A;  2J52 A;  4XE0 A;  2DWQ A;  1V1O A;  4N59 A;  5I4D A;  1GTE A;  2G1E A;  1YQ4 B;  1ZDV A;  3IAM 1;  1C76 A;  1B1Z A;  2W55 A;  2WQY B;  1I4H A;  3LXF A;  1RYJ A;  2WXF A;  2JU6 X;  1QT9 A;  1OQR A;  2L1A A;  2OHF A;  1SF0 A;  4A55 A;  1CQV A;  1MPE A;  1SSN A;  5FK9 C;  3AE6 B;  4WIP A;  1QOG A;  1SB3 C;  2WLB A;  2KAC A;  1F2R I;  2AQ1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...