3CJBG

Actin dimer cross-linked by v. cholerae martx toxin and complexed with gelsolin-segment 1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
125
Chain Sequence
MVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Connecting actin monomers by iso-peptide bond is a toxicity mechanism of the Vibrio cholerae MARTX toxin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Actin, alpha skeletal muscle
total genus 36
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2008-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 3cjbG00
1P8XA 5KYWA 5KYXB 2FH2A 2NUTA 1COFA 1ESVS 2LXXA 1C0GS 4CBXG 1CNUA 1NPHA 3EGXA 3FFNA 2FH3A 1PCXA 3FG7A 1HQZ1 2FH1A 1V6FA 3TU5B 5KYUB 4KEFA 5FAEA 3DAWB 5DD2A 1H1VG 2FH4A 2MOTA 5KYWB 1NLVG 1X67A 3A5NS 3A5OS 4BEX1 1EQYS 1J72A 1SVQA 1AHQA 4PKHB 5KYYA 1M2VA 2MP4A 4LIZA 1M4JA 1WFSA 3EH2A 3EG9A 1DEJS 3EGDB 1NM1G 2XFAA 3CI5G 4Z94G 1AK7A 2XF1A 2VILA 2HD7A 3FG6A 1PD0A 5KYXA 1JHWA 4KEEA 1YAGG 4KEDA 1TMWA 3EFOB 1CFYA 1M2VB 2L72A 2D8BA 1Q8GA 2NUTB 1P8ZG 4JD2H 2LJ8A 3CJCG 1RGIG 1SVYA 3A5MS 2MV2A 5A1MA 1KCQA 5KYUA 4CBUG 1VKKA 1T3YA 3CIPG 3EH1A 5HVKD 5L6WC 1F7SA 4PKGG 4CBWG 2NUPA 3L50A 5KYNA 5IVUA 5KYYB 3CJBG 2I2QA 1T2LA 2LLFA 1M2OA 1YVNG 1AK6A 2NUPB 1UDMA 1WM4A 1PD1A 2FF3A 3EGXB 1Q8XA 1MDUA 1C0FS 5FAFA 1D4XG 3EGDA 2VIKA 4PKIG 2VACA 3FFKA 1QPVA 1T44G 3A5LS 2FGHA 3EG9B 1VFQA 2W0IA 1T3XA 1WNJA 2KVKA 1SVRA 1NMDG 3Q2BA 1D0NA 4S10C 2QTVA 3EFOA 1TVJA 2FF6G 5HVKB
chains in the Genus database with same CATH superfamily
1P8XA 5KYWA 5KYXB 2FH2A 2NUTA 1COFA 1ESVS 2LXXA 1C0GS 4CBXG 1CNUA 1NPHA 3EGXA 3FFNA 2FH3A 1PCXA 3FG7A 1HQZ1 2FH1A 1V6FA 3TU5B 5KYUB 4KEFA 5FAEA 3DAWB 5DD2A 1H1VG 2FH4A 2MOTA 5KYWB 1NLVG 1X67A 3A5NS 3A5OS 4BEX1 1EQYS 1J72A 1SVQA 1AHQA 4PKHB 5KYYA 1M2VA 2MP4A 4LIZA 1M4JA 1WFSA 3EH2A 3EG9A 1DEJS 3EGDB 1NM1G 2XFAA 3CI5G 4Z94G 1AK7A 2XF1A 2VILA 2HD7A 3FG6A 1PD0A 5KYXA 1JHWA 4KEEA 1YAGG 4KEDA 1TMWA 3EFOB 1CFYA 1M2VB 2L72A 2D8BA 1Q8GA 2NUTB 1P8ZG 3DA7A 4JD2H 2LJ8A 3CJCG 1RGIG 1SVYA 3A5MS 2MV2A 5A1MA 1KCQA 5KYUA 4CBUG 1VKKA 1T3YA 3CIPG 3EH1A 5HVKD 5L6WC 1F7SA 4PKGG 4CBWG 2NUPA 3L50A 5KYNA 5IVUA 5KYYB 3CJBG 2I2QA 1T2LA 2LLFA 1M2OA 1YVNG 1AK6A 2NUPB 1UDMA 1WM4A 1PD1A 2FF3A 3EGXB 1Q8XA 1MDUA 1C0FS 5FAFA 1D4XG 3EGDA 2VIKA 4PKIG 2VACA 3FFKA 1QPVA 1T44G 3A5LS 2FGHA 3EG9B 1VFQA 2W0IA 1T3XA 1WNJA 2KVKA 1SVRA 1NMDG 3Q2BA 1D0NA 4S10C 2QTVA 3EFOA 1TVJA 2FF6G 5HVKB
chains in the Genus database with same CATH topology
1P8XA 5KYWA 5KYXB 2FH2A 2NUTA 1COFA 1ESVS 2LXXA 1C0GS 4CBXG 1CNUA 1NPHA 3EGXA 3FFNA 2FH3A 1PCXA 3FG7A 1HQZ1 2FH1A 1V6FA 3TU5B 5KYUB 4KEFA 5FAEA 3DAWB 5DD2A 1H1VG 2FH4A 2MOTA 5KYWB 1NLVG 1X67A 3A5NS 3A5OS 4BEX1 1EQYS 1J72A 1SVQA 1AHQA 4PKHB 5KYYA 1M2VA 2MP4A 4LIZA 1M4JA 1WFSA 3EH2A 3EG9A 1DEJS 3EGDB 1NM1G 2XFAA 3CI5G 4Z94G 1AK7A 2XF1A 2VILA 2HD7A 3FG6A 1PD0A 5KYXA 1JHWA 4KEEA 1YAGG 4KEDA 1TMWA 3EFOB 1CFYA 1M2VB 2L72A 2D8BA 1Q8GA 2NUTB 1P8ZG 3DA7A 4JD2H 2LJ8A 3CJCG 1RGIG 1SVYA 3A5MS 2MV2A 5A1MA 1KCQA 5KYUA 4CBUG 1VKKA 1T3YA 3CIPG 3EH1A 5HVKD 5L6WC 1F7SA 4PKGG 4CBWG 2NUPA 3L50A 5KYNA 5IVUA 5KYYB 3CJBG 2I2QA 1T2LA 2LLFA 1M2OA 1YVNG 1AK6A 2NUPB 1UDMA 1WM4A 1PD1A 2FF3A 3EGXB 1Q8XA 1MDUA 1C0FS 5FAFA 1D4XG 3EGDA 2VIKA 4PKIG 2VACA 3FFKA 1QPVA 1T44G 3A5LS 2FGHA 3EG9B 1VFQA 2W0IA 1T3XA 1WNJA 2KVKA 1SVRA 1NMDG 3Q2BA 1D0NA 4S10C 2QTVA 3EFOA 1TVJA 2FF6G 5HVKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P8X A;  5KYW A;  5KYX B;  2FH2 A;  2NUT A;  1COF A;  1ESV S;  2LXX A;  1C0G S;  4CBX G;  1CNU A;  1NPH A;  3EGX A;  3FFN A;  2FH3 A;  1PCX A;  3FG7 A;  1HQZ 1;  2FH1 A;  1V6F A;  3TU5 B;  5KYU B;  4KEF A;  5FAE A;  3DAW B;  5DD2 A;  1H1V G;  2FH4 A;  2MOT A;  5KYW B;  1NLV G;  1X67 A;  3A5N S;  3A5O S;  4BEX 1;  1EQY S;  1J72 A;  1SVQ A;  1AHQ A;  4PKH B;  5KYY A;  1M2V A;  2MP4 A;  4LIZ A;  1M4J A;  1WFS A;  3EH2 A;  3EG9 A;  1DEJ S;  3EGD B;  1NM1 G;  2XFA A;  3CI5 G;  4Z94 G;  1AK7 A;  2XF1 A;  2VIL A;  2HD7 A;  3FG6 A;  1PD0 A;  5KYX A;  1JHW A;  4KEE A;  1YAG G;  4KED A;  1TMW A;  3EFO B;  1CFY A;  1M2V B;  2L72 A;  2D8B A;  1Q8G A;  2NUT B;  1P8Z G;  4JD2 H;  2LJ8 A;  3CJC G;  1RGI G;  1SVY A;  3A5M S;  2MV2 A;  5A1M A;  1KCQ A;  5KYU A;  4CBU G;  1VKK A;  1T3Y A;  3CIP G;  3EH1 A;  5HVK D;  5L6W C;  1F7S A;  4PKG G;  4CBW G;  2NUP A;  3L50 A;  5KYN A;  5IVU A;  5KYY B;  3CJB G;  2I2Q A;  1T2L A;  2LLF A;  1M2O A;  1YVN G;  1AK6 A;  2NUP B;  1UDM A;  1WM4 A;  1PD1 A;  2FF3 A;  3EGX B;  1Q8X A;  1MDU A;  1C0F S;  5FAF A;  1D4X G;  3EGD A;  2VIK A;  4PKI G;  2VAC A;  3FFK A;  1QPV A;  1T44 G;  3A5L S;  2FGH A;  3EG9 B;  1VFQ A;  2W0I A;  1T3X A;  1WNJ A;  2KVK A;  1SVR A;  1NMD G;  3Q2B A;  1D0N A;  4S10 C;  2QTV A;  3EFO A;  1TVJ A;  2FF6 G;  5HVK B; 
#chains in the Genus database with same CATH topology
 1P8X A;  5KYW A;  5KYX B;  2FH2 A;  2NUT A;  1COF A;  1ESV S;  2LXX A;  1C0G S;  4CBX G;  1CNU A;  1NPH A;  3EGX A;  3FFN A;  2FH3 A;  1PCX A;  3FG7 A;  1HQZ 1;  2FH1 A;  1V6F A;  3TU5 B;  5KYU B;  4KEF A;  5FAE A;  3DAW B;  5DD2 A;  1H1V G;  2FH4 A;  2MOT A;  5KYW B;  1NLV G;  1X67 A;  3A5N S;  3A5O S;  4BEX 1;  1EQY S;  1J72 A;  1SVQ A;  1AHQ A;  4PKH B;  5KYY A;  1M2V A;  2MP4 A;  4LIZ A;  1M4J A;  1WFS A;  3EH2 A;  3EG9 A;  1DEJ S;  3EGD B;  1NM1 G;  2XFA A;  3CI5 G;  4Z94 G;  1AK7 A;  2XF1 A;  2VIL A;  2HD7 A;  3FG6 A;  1PD0 A;  5KYX A;  1JHW A;  4KEE A;  1YAG G;  4KED A;  1TMW A;  3EFO B;  1CFY A;  1M2V B;  2L72 A;  2D8B A;  1Q8G A;  2NUT B;  1P8Z G;  3DA7 A;  4JD2 H;  2LJ8 A;  3CJC G;  1RGI G;  1SVY A;  3A5M S;  2MV2 A;  5A1M A;  1KCQ A;  5KYU A;  4CBU G;  1VKK A;  1T3Y A;  3CIP G;  3EH1 A;  5HVK D;  5L6W C;  1F7S A;  4PKG G;  4CBW G;  2NUP A;  3L50 A;  5KYN A;  5IVU A;  5KYY B;  3CJB G;  2I2Q A;  1T2L A;  2LLF A;  1M2O A;  1YVN G;  1AK6 A;  2NUP B;  1UDM A;  1WM4 A;  1PD1 A;  2FF3 A;  3EGX B;  1Q8X A;  1MDU A;  1C0F S;  5FAF A;  1D4X G;  3EGD A;  2VIK A;  4PKI G;  2VAC A;  3FFK A;  1QPV A;  1T44 G;  3A5L S;  2FGH A;  3EG9 B;  1VFQ A;  2W0I A;  1T3X A;  1WNJ A;  2KVK A;  1SVR A;  1NMD G;  3Q2B A;  1D0N A;  4S10 C;  2QTV A;  3EFO A;  1TVJ A;  2FF6 G;  5HVK B; 
#chains in the Genus database with same CATH homology
 1P8X A;  5KYW A;  5KYX B;  2FH2 A;  2NUT A;  1COF A;  1ESV S;  2LXX A;  1C0G S;  4CBX G;  1CNU A;  1NPH A;  3EGX A;  3FFN A;  2FH3 A;  1PCX A;  3FG7 A;  1HQZ 1;  2FH1 A;  1V6F A;  3TU5 B;  5KYU B;  4KEF A;  5FAE A;  3DAW B;  5DD2 A;  1H1V G;  2FH4 A;  2MOT A;  5KYW B;  1NLV G;  1X67 A;  3A5N S;  3A5O S;  4BEX 1;  1EQY S;  1J72 A;  1SVQ A;  1AHQ A;  4PKH B;  5KYY A;  1M2V A;  2MP4 A;  4LIZ A;  1M4J A;  1WFS A;  3EH2 A;  3EG9 A;  1DEJ S;  3EGD B;  1NM1 G;  2XFA A;  3CI5 G;  4Z94 G;  1AK7 A;  2XF1 A;  2VIL A;  2HD7 A;  3FG6 A;  1PD0 A;  5KYX A;  1JHW A;  4KEE A;  1YAG G;  4KED A;  1TMW A;  3EFO B;  1CFY A;  1M2V B;  2L72 A;  2D8B A;  1Q8G A;  2NUT B;  1P8Z G;  3DA7 A;  4JD2 H;  2LJ8 A;  3CJC G;  1RGI G;  1SVY A;  3A5M S;  2MV2 A;  5A1M A;  1KCQ A;  5KYU A;  4CBU G;  1VKK A;  1T3Y A;  3CIP G;  3EH1 A;  5HVK D;  5L6W C;  1F7S A;  4PKG G;  4CBW G;  2NUP A;  3L50 A;  5KYN A;  5IVU A;  5KYY B;  3CJB G;  2I2Q A;  1T2L A;  2LLF A;  1M2O A;  1YVN G;  1AK6 A;  2NUP B;  1UDM A;  1WM4 A;  1PD1 A;  2FF3 A;  3EGX B;  1Q8X A;  1MDU A;  1C0F S;  5FAF A;  1D4X G;  3EGD A;  2VIK A;  4PKI G;  2VAC A;  3FFK A;  1QPV A;  1T44 G;  3A5L S;  2FGH A;  3EG9 B;  1VFQ A;  2W0I A;  1T3X A;  1WNJ A;  2KVK A;  1SVR A;  1NMD G;  3Q2B A;  1D0N A;  4S10 C;  2QTV A;  3EFO A;  1TVJ A;  2FF6 G;  5HVK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...