3CJCG

Actin dimer cross-linked by v. cholerae martx toxin and complexed with dnase i and gelsolin-segment 1
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
MVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Connecting actin monomers by iso-peptide bond is a toxicity mechanism of the Vibrio cholerae MARTX toxin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/hydrolase
molecule keywords Actin, alpha skeletal muscle
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2008-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 3cjcG00
1WFSA 5HVKB 1AK6A 1M2OA 1NPHA 1AHQA 1MDUA 5FAFA 3EGXA 4PKIG 1JHWA 1EQYS 1Q8GA 1YAGG 1M2VA 1T3YA 5KYWB 1NM1G 1T44G 2MOTA 2VACA 1V6FA 4PKGG 1SVRA 2QTVA 1M4JA 2FH1A 2W0IA 3A5NS 1C0GS 1UDMA 1SVYA 1X67A 2LLFA 3CIPG 1NMDG 1NLVG 1VFQA 2KVKA 4LIZA 1P8ZG 2MP4A 1CFYA 1T3XA 3EG9A 1D4XG 1YVNG 2FF6G 3EFOB 1C0FS 1RGIG 1VKKA 3A5LS 4Z94G 5KYUA 5DD2A 3Q2BA 3DAWB 2NUPB 1TMWA 3EGDA 2NUTB 1D0NA 2XF1A 5KYXB 4CBWG 1H1VG 2NUTA 2NUPA 3EGDB 3FG6A 2L72A 3EH1A 3L50A 4S10C 3CJCG 2XFAA 3EFOA 5HVKD 1WNJA 2FH3A 3EG9B 4BEX1 2D8BA 5IVUA 3CJBG 3A5MS 1F7SA 5KYXA 1AK7A 2MV2A 2VILA 2VIKA 1PCXA 5L6WC 2LXXA 1T2LA 5KYYB 2LJ8A 1P8XA 1PD0A 1DEJS 3CI5G 5A1MA 5KYYA 1ESVS 5FAEA 3A5OS 1SVQA 3FFKA 1QPVA 3EGXB 3FFNA 2FH4A 1COFA 1Q8XA 2HD7A 4PKHB 2I2QA 1WM4A 4CBXG 4JD2H 5KYNA 4KEEA 1CNUA 2FF3A 1TVJA 4CBUG 1HQZ1 3EH2A 4KEDA 1J72A 5KYWA 1M2VB 1PD1A 2FGHA 2FH2A 3TU5B 3FG7A 5KYUB 1KCQA 4KEFA
chains in the Genus database with same CATH superfamily
1WFSA 5HVKB 1AK6A 1M2OA 1NPHA 1AHQA 1MDUA 5FAFA 3EGXA 4PKIG 1JHWA 1EQYS 1Q8GA 1YAGG 1M2VA 1T3YA 5KYWB 1NM1G 1T44G 2MOTA 2VACA 1V6FA 4PKGG 1SVRA 2QTVA 1M4JA 2FH1A 2W0IA 3A5NS 1C0GS 1UDMA 1SVYA 1X67A 2LLFA 3CIPG 1NMDG 1NLVG 1VFQA 2KVKA 4LIZA 1P8ZG 2MP4A 1CFYA 1T3XA 3EG9A 1D4XG 1YVNG 2FF6G 3EFOB 1C0FS 1RGIG 1VKKA 3A5LS 4Z94G 5KYUA 5DD2A 3Q2BA 3DAWB 2NUPB 1TMWA 3EGDA 2NUTB 1D0NA 2XF1A 5KYXB 4CBWG 1H1VG 2NUTA 2NUPA 3EGDB 3FG6A 2L72A 3EH1A 3L50A 4S10C 3CJCG 2XFAA 3EFOA 5HVKD 1WNJA 2FH3A 3EG9B 4BEX1 2D8BA 5IVUA 3CJBG 3A5MS 1F7SA 5KYXA 1AK7A 2MV2A 2VILA 2VIKA 1PCXA 5L6WC 2LXXA 1T2LA 5KYYB 2LJ8A 1P8XA 1PD0A 1DEJS 3CI5G 5A1MA 5KYYA 1ESVS 5FAEA 3A5OS 1SVQA 3FFKA 1QPVA 3EGXB 3FFNA 2FH4A 3DA7A 1COFA 1Q8XA 2HD7A 4PKHB 2I2QA 1WM4A 4CBXG 4JD2H 5KYNA 4KEEA 1CNUA 2FF3A 1TVJA 4CBUG 1HQZ1 3EH2A 4KEDA 1J72A 5KYWA 1M2VB 1PD1A 2FGHA 2FH2A 3TU5B 3FG7A 5KYUB 1KCQA 4KEFA
chains in the Genus database with same CATH topology
1WFSA 5HVKB 1AK6A 1M2OA 1NPHA 1AHQA 1MDUA 5FAFA 3EGXA 4PKIG 1JHWA 1EQYS 1Q8GA 1YAGG 1M2VA 1T3YA 5KYWB 1NM1G 1T44G 2MOTA 2VACA 1V6FA 4PKGG 1SVRA 2QTVA 1M4JA 2FH1A 2W0IA 3A5NS 1C0GS 1UDMA 1SVYA 1X67A 2LLFA 3CIPG 1NMDG 1NLVG 1VFQA 2KVKA 4LIZA 1P8ZG 2MP4A 1CFYA 1T3XA 3EG9A 1D4XG 1YVNG 2FF6G 3EFOB 1C0FS 1RGIG 1VKKA 3A5LS 4Z94G 5KYUA 5DD2A 3Q2BA 3DAWB 2NUPB 1TMWA 3EGDA 2NUTB 1D0NA 2XF1A 5KYXB 4CBWG 1H1VG 2NUTA 2NUPA 3EGDB 3FG6A 2L72A 3EH1A 3L50A 4S10C 3CJCG 2XFAA 3EFOA 5HVKD 1WNJA 2FH3A 3EG9B 4BEX1 2D8BA 5IVUA 3CJBG 3A5MS 1F7SA 5KYXA 1AK7A 2MV2A 2VILA 2VIKA 1PCXA 5L6WC 2LXXA 1T2LA 5KYYB 2LJ8A 1P8XA 1PD0A 1DEJS 3CI5G 5A1MA 5KYYA 1ESVS 5FAEA 3A5OS 1SVQA 3FFKA 1QPVA 3EGXB 3FFNA 2FH4A 3DA7A 1COFA 1Q8XA 2HD7A 4PKHB 2I2QA 1WM4A 4CBXG 4JD2H 5KYNA 4KEEA 1CNUA 2FF3A 1TVJA 4CBUG 1HQZ1 3EH2A 4KEDA 1J72A 5KYWA 1M2VB 1PD1A 2FGHA 2FH2A 3TU5B 3FG7A 5KYUB 1KCQA 4KEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WFS A;  5HVK B;  1AK6 A;  1M2O A;  1NPH A;  1AHQ A;  1MDU A;  5FAF A;  3EGX A;  4PKI G;  1JHW A;  1EQY S;  1Q8G A;  1YAG G;  1M2V A;  1T3Y A;  5KYW B;  1NM1 G;  1T44 G;  2MOT A;  2VAC A;  1V6F A;  4PKG G;  1SVR A;  2QTV A;  1M4J A;  2FH1 A;  2W0I A;  3A5N S;  1C0G S;  1UDM A;  1SVY A;  1X67 A;  2LLF A;  3CIP G;  1NMD G;  1NLV G;  1VFQ A;  2KVK A;  4LIZ A;  1P8Z G;  2MP4 A;  1CFY A;  1T3X A;  3EG9 A;  1D4X G;  1YVN G;  2FF6 G;  3EFO B;  1C0F S;  1RGI G;  1VKK A;  3A5L S;  4Z94 G;  5KYU A;  5DD2 A;  3Q2B A;  3DAW B;  2NUP B;  1TMW A;  3EGD A;  2NUT B;  1D0N A;  2XF1 A;  5KYX B;  4CBW G;  1H1V G;  2NUT A;  2NUP A;  3EGD B;  3FG6 A;  2L72 A;  3EH1 A;  3L50 A;  4S10 C;  3CJC G;  2XFA A;  3EFO A;  5HVK D;  1WNJ A;  2FH3 A;  3EG9 B;  4BEX 1;  2D8B A;  5IVU A;  3CJB G;  3A5M S;  1F7S A;  5KYX A;  1AK7 A;  2MV2 A;  2VIL A;  2VIK A;  1PCX A;  5L6W C;  2LXX A;  1T2L A;  5KYY B;  2LJ8 A;  1P8X A;  1PD0 A;  1DEJ S;  3CI5 G;  5A1M A;  5KYY A;  1ESV S;  5FAE A;  3A5O S;  1SVQ A;  3FFK A;  1QPV A;  3EGX B;  3FFN A;  2FH4 A;  1COF A;  1Q8X A;  2HD7 A;  4PKH B;  2I2Q A;  1WM4 A;  4CBX G;  4JD2 H;  5KYN A;  4KEE A;  1CNU A;  2FF3 A;  1TVJ A;  4CBU G;  1HQZ 1;  3EH2 A;  4KED A;  1J72 A;  5KYW A;  1M2V B;  1PD1 A;  2FGH A;  2FH2 A;  3TU5 B;  3FG7 A;  5KYU B;  1KCQ A;  4KEF A; 
#chains in the Genus database with same CATH topology
 1WFS A;  5HVK B;  1AK6 A;  1M2O A;  1NPH A;  1AHQ A;  1MDU A;  5FAF A;  3EGX A;  4PKI G;  1JHW A;  1EQY S;  1Q8G A;  1YAG G;  1M2V A;  1T3Y A;  5KYW B;  1NM1 G;  1T44 G;  2MOT A;  2VAC A;  1V6F A;  4PKG G;  1SVR A;  2QTV A;  1M4J A;  2FH1 A;  2W0I A;  3A5N S;  1C0G S;  1UDM A;  1SVY A;  1X67 A;  2LLF A;  3CIP G;  1NMD G;  1NLV G;  1VFQ A;  2KVK A;  4LIZ A;  1P8Z G;  2MP4 A;  1CFY A;  1T3X A;  3EG9 A;  1D4X G;  1YVN G;  2FF6 G;  3EFO B;  1C0F S;  1RGI G;  1VKK A;  3A5L S;  4Z94 G;  5KYU A;  5DD2 A;  3Q2B A;  3DAW B;  2NUP B;  1TMW A;  3EGD A;  2NUT B;  1D0N A;  2XF1 A;  5KYX B;  4CBW G;  1H1V G;  2NUT A;  2NUP A;  3EGD B;  3FG6 A;  2L72 A;  3EH1 A;  3L50 A;  4S10 C;  3CJC G;  2XFA A;  3EFO A;  5HVK D;  1WNJ A;  2FH3 A;  3EG9 B;  4BEX 1;  2D8B A;  5IVU A;  3CJB G;  3A5M S;  1F7S A;  5KYX A;  1AK7 A;  2MV2 A;  2VIL A;  2VIK A;  1PCX A;  5L6W C;  2LXX A;  1T2L A;  5KYY B;  2LJ8 A;  1P8X A;  1PD0 A;  1DEJ S;  3CI5 G;  5A1M A;  5KYY A;  1ESV S;  5FAE A;  3A5O S;  1SVQ A;  3FFK A;  1QPV A;  3EGX B;  3FFN A;  2FH4 A;  3DA7 A;  1COF A;  1Q8X A;  2HD7 A;  4PKH B;  2I2Q A;  1WM4 A;  4CBX G;  4JD2 H;  5KYN A;  4KEE A;  1CNU A;  2FF3 A;  1TVJ A;  4CBU G;  1HQZ 1;  3EH2 A;  4KED A;  1J72 A;  5KYW A;  1M2V B;  1PD1 A;  2FGH A;  2FH2 A;  3TU5 B;  3FG7 A;  5KYU B;  1KCQ A;  4KEF A; 
#chains in the Genus database with same CATH homology
 1WFS A;  5HVK B;  1AK6 A;  1M2O A;  1NPH A;  1AHQ A;  1MDU A;  5FAF A;  3EGX A;  4PKI G;  1JHW A;  1EQY S;  1Q8G A;  1YAG G;  1M2V A;  1T3Y A;  5KYW B;  1NM1 G;  1T44 G;  2MOT A;  2VAC A;  1V6F A;  4PKG G;  1SVR A;  2QTV A;  1M4J A;  2FH1 A;  2W0I A;  3A5N S;  1C0G S;  1UDM A;  1SVY A;  1X67 A;  2LLF A;  3CIP G;  1NMD G;  1NLV G;  1VFQ A;  2KVK A;  4LIZ A;  1P8Z G;  2MP4 A;  1CFY A;  1T3X A;  3EG9 A;  1D4X G;  1YVN G;  2FF6 G;  3EFO B;  1C0F S;  1RGI G;  1VKK A;  3A5L S;  4Z94 G;  5KYU A;  5DD2 A;  3Q2B A;  3DAW B;  2NUP B;  1TMW A;  3EGD A;  2NUT B;  1D0N A;  2XF1 A;  5KYX B;  4CBW G;  1H1V G;  2NUT A;  2NUP A;  3EGD B;  3FG6 A;  2L72 A;  3EH1 A;  3L50 A;  4S10 C;  3CJC G;  2XFA A;  3EFO A;  5HVK D;  1WNJ A;  2FH3 A;  3EG9 B;  4BEX 1;  2D8B A;  5IVU A;  3CJB G;  3A5M S;  1F7S A;  5KYX A;  1AK7 A;  2MV2 A;  2VIL A;  2VIK A;  1PCX A;  5L6W C;  2LXX A;  1T2L A;  5KYY B;  2LJ8 A;  1P8X A;  1PD0 A;  1DEJ S;  3CI5 G;  5A1M A;  5KYY A;  1ESV S;  5FAE A;  3A5O S;  1SVQ A;  3FFK A;  1QPV A;  3EGX B;  3FFN A;  2FH4 A;  3DA7 A;  1COF A;  1Q8X A;  2HD7 A;  4PKH B;  2I2Q A;  1WM4 A;  4CBX G;  4JD2 H;  5KYN A;  4KEE A;  1CNU A;  2FF3 A;  1TVJ A;  4CBU G;  1HQZ 1;  3EH2 A;  4KED A;  1J72 A;  5KYW A;  1M2V B;  1PD1 A;  2FGH A;  2FH2 A;  3TU5 B;  3FG7 A;  5KYU B;  1KCQ A;  4KEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...