3CJHA

Tim8-tim13 complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
52
structure length
52
Chain Sequence
ATELVNKISENCFEKCLTSPYATRNDACIDQCLAKYMRSWNVISKAYISRIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial import inner membrane translocase subunit TIM1
publication title The Tim8-Tim13 complex has multiple substrate binding sites and binds cooperatively to Tim23
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 17
structure length 52
sequence length 52
chains with identical sequence C, E, G, I, K
ec nomenclature
pdb deposition date 2008-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.810 Mainly Alpha Orthogonal Bundle Helix Hairpins Mitochondrial import inner membrane translocase subunit tim13 like domains 3cjhA00
2BSKA 3DXRA 3CJHB 3CJHA 2BSKB 3DXRB
chains in the Genus database with same CATH superfamily
3RYHB 1YJNV 5KAIZ 3ZMZA 3JASB 3ABMB 5H6QA 2FMLA 4NXNO 1LUWA 4D7TA 3CMEV 4DYLA 3W7SA 2HHHO 4LF8O 1N36O 3CWBH 1WA8B 4O4JB 3A0BZ 3ABLB 1YTFB 2CAZC 3CRCA 2EULA 5LL6Y 4IYIA 1RP3B 2DYRB 5CB4A 1OHHG 4FZ0A 5KMGB 3E83A 2B1IA 3KCYA 1BSMA 4P9PA 2LFRA 1RM1C 1US6A 1B04A 3Q4HA 2LGQA 4JI1O 4MVQA 3QNEA 2ZIMA 2IU3A 1JOYA 4JI0O 1K33A 4JI4O 3AK1A 4PELA 5JH7A 5IJ0A 5D5PA 2WLIB 4XDLA 3AK2A 3L74H 1D5AA 4UB6Z 1Q7YW 4JTDB 4CS4A 4P30A 3RYCA 3K5MA 1R73A 4O2AA 4ZBMA 3DXRB 4IL6Z 2Y48A 2W6JG 1KB9F 5JVDB 2HFEC 3T4DA 1GKFA 3WB2A 3L70H 3E89A 2O57A 5B1NA 4EFEA 4X20A 5KX5A 3JAKB 2ZR2A 2NNUA 3ASNC 4X64B 1IBMB 1N8RW 4OPAA 2IJKA 1GM9A 5J2UA 3I5DA 3QO5A 4WFAV 2Q8VA 4DO2A 1VQNV 2JGUA 2JJ2G 5L3FA 1PL4A 3CB2A 1E1QG 1PNKA 2Y0PA 2Q4PA 4UCOA 2N05A 4WFGA 4R8CA 3KKYA 1WPXA 2PI5A 3TGUH 1W0KG 5H5NA 3HPLC 2OCCB 3B4SA 3R66A 3H01A 2P6JA 4JTCB 4DV0B 4J7JA 5FNVB 4H33A 1B3QA 4UB8Z 4RQFA 2RMKB 2KSDA 3B8NA 5ITZB 4KXRA 1Q6UA 4I4TB 3AG4B 2GHYA 4I7ZB 4FFKA 5IYZA 2PZSA 3LDEA 3E8GA 2EINB 4LH7A 2YEVB 1YCIA 3JD0A 3OAAG 2LQTA 3OUSA 3ZHQA 1IBLO 3DC6A 4TQDA 3CCEV 5BR8O 3K03A 1GAXA 1JVMA 3W7UA 2MK3A 4D7SA 3OT7A 1I94O 2Q73A 3T1YB 3HKBB 1M56C 3CRAA 1LNQA 2FKXA 3DTUB 4UVAA 3JYCA 1F51A 1JJ2U 4HNAA 5JCOC 3W7WA 3T1HO 4YHHO 2DWEC 3U10A 4DR1B 1B6QA 2ZE8A 1GM7A 3HKDB 5J9PC 4FMTA 1QVFU 4RAIA 3G6EV 1WP7A 4L8JA 2PYLA 1QBZA 5LA6B 4JYYA 1OCCC 3IC7A 1KQSU 1GM8A 1PKXA 1VQKV 1N0NA 3J80N 4BWAA 2BSKB 3BHPA 2FYUH 4MVOA 3TETA 5KMGA 2GTAA 4OX9B 5B66Z 4DRXB 1FXVA 1VP7A 4TV9B 4CS2A 1ZAUA 2F4VB 1NVPB 4B3SB 2UUCO 3CXHF 2QTSA 1RSOB 2QWNB 1U97A 3CC4V 5EZYB 3JD4A 2ZDIC 5IY5B 1IZ3A 4H44B 1R3IC 4B3RO 3P3PA 1IBKB 3DXRA 1H2NA 5LMNO 5JVDA 3BA8A 4CBCA 3HR0A 3FX7A 5KLVH 4F6RB 4BIUA 3QG5A 1CP9A 3M7MX 4TT3G 3U11A 1OJHA 2VQFB 3ASNB 1SC5B 1XNQB 5EC1C 5FPOA 4QGPA 4X89A 4HBNA 2WA3A 3JAKA 3THOA 3T2MA 4JAAA 1XI1A 4PDVA 4I55B 2KQXA 3ZHRA 4GKJO 1XMQO 2X0LA 2Q9LA 3FYIB 4PHZA 1V9PA 4KL1A 3JD1A 4TUYA 4CZZA 4O4HA 5DEDA 2UU9O 1EM1A 1I5YA 3E8FA 3ZRWA 2QKAA 4LNUA 5CN0A 4DV6B 2WLKA 3WB1A 3BVOA 1AR1B 2IH3C 2H3OA 1S3JA 2WSSG 2IJIA 5F2VO 4AQYO 3B77A 1XL6A 2HJFC 1N34O 4DR7B 4A5UB 5LXTB 1BMFG 5FNVA 1PM9A 2ILMA 1MNGA 2QWRB 3STLC 2QA4V 4LF6O 3CJHA 1K9MW 3OD4A 4PI2A 5LGNA 3OUFA 4QPKA 3H1LH 3E86A 2YEVA 2HVJC 1Y76A 4U3JB 1YITV 1BZKA 3D36A 1M56B 4RUFA 2G38A 1TVKA 4LF9O 3UT5B 2UXDB 1L0NH 4JZ2A 3SPIA 3HB3B 4KHPB 4NTWA 3HKBA 4FLYA 4ZOLB 1CEZA 1SESA 4FM2A 5LOVA 2CGNA 4DR3O 1BL8A 5KA5A 2DJVA 2Q6AA 4JZGA 1VMGA 2YC0A 3RFRA 4IIJA 4ZHQA 3N2KA 3UM7A 2F95B 3WU2Z 4Z1MG 4LFAB 1Z5WA 4GX5A 4FLVA 2QM7A 1XUQA 1OCCB 1FD9A 3HKDA 4MTGA 3N27A 4QE9A 1COWG 4UXNA 4X8AA 3B09A 1W2BU 3J7AU 3APOA 1FFTB 2X6AA 4NB5A 4WFEA 2ZIOA 1DK1A 2F23A 4DXWA 5LP6C 4X62B 3SR2C 5B1BC 3EFFK 2CTQA 5EBMC 4W4LA 4DRXA 3I56V 1ORQC 3N2GA 4TV9A 3KCXA 1K4DC 3MHHC 3ABTA 4UFZA 1KU9A 3HKCB 2CE4A 4FLWA 1MOFA 3G80A 5L3EA 1CXZB 3JCZA 1RSOA 5GONA 1GN3A 4RO2A 4B7KA 1RPRA 1PNLA 3WFVA 1SS3A 3IJ4A 3GWKC 4PD4F 2ATKC 4F6RA 1FS0G 3OR7C 1PNMA 2GTSA 2RJZA 4H0LB 2Q67A 1FXKC 2EJ7A 3BY6A 4I55A 1VQ6V 4YY3B 1XNRO 1N32O 4IT5A 3E8BA 2VWKA 5IJ9A 2XHBA 2KKWA 4YJ2B 1YSCA 2CTPA 2DYSC 1DF4A 1FJGO 2DMXA 4E4EA 5IJ0B 1S0VA 4JI3B 2P90A 2YIDA 4LF5O 1EN5A 1J95A 3PN1A 1K92A 4JI5O 3K58A 4DV7O 4X88A 1HR0O 3SJCC 2QEXV 3RYCB 1IXBA 2RCVA 3K5NA 3JAMN 4DUYO 3A0HZ 2EIJC 4GX1A 4NYKA 2E5LB 2UUAO 2OTLV 3OTFA 4X65B 3P3NA 3OE7G 2HG5C 3J81N 4PA7A 2OTJV 4R50A 5LXTA 5B3SC 2H8PC 4QE7A 3NR7A 4NXMB 5IYDO 5KX5B 2RQ6A 3GVMA 2FB5A 1R6KA 2ADPA 4F6EA 3CCMV 5FPRA 2BTQB 4NTYA 3SPJA 4I9QA 2EILC 2D3OW 4MT8A 3A2FA 1Q90D 3UT5A 1AI7A 2QE7G 4OXSA 3VQVA 5JCOA 3B40A 2V1DA 1P7BA 1JA8A 3TK1A 3ZRSA 3UCSC 3JAWB 2EIMB 3ML0A 4U7OA 1XHXA 5KAFZ 2DN9A 1XMOB 3VQYA 1NU1H 3CYOA 3AEIA 3A0RA 2P4KA 1TUEB 4J7KA 3ZHVA 2OCHA 1SQFA 2VRZA 2HKOA 1I0HA 2A9HA 1QR9A 2JVDA 2P06A 5LGTA 5KHJA 2DWDC 3OGIB 4C7UA 2ZCEA 5KUMA 1MSWD 3ETGA 4K8XA 3KG2A 2QWPB 3OW2U 5IDJA 3HKCA 2ZDIA 2RNBA 3D36C 1OCRC 5D5QA 4D6TH 1WAZA 1KMIZ 1NZ6A 2XAFA 3QVNA 4HNAB 3PJSK 4JI8B 4NVPA 3UO3A 4X64O 1UPGA 2L35A 1QVGU 1J5EB 4MVUA 1OV9A 3B8MA 1GK9A 5FL7G 1GMGA 3C90A 1FXKB 1FXHA 1Q5OA 4IYHA 1GN4A 3ZMVA 5L3DA 4H37A 5A2QN 3D3IA 1FKAO 4JASA 3GWOA 5B5EZ 5TISZ 5B1AC 1N33O 1SERA 2DYSB 1VF6C 4FM1A 4UVCA 4YJ2A 2ZM6B 4JYAB 1G1XB 3S3XA 1NS1A 4DUZO 3CMAV 4DV0O 1SQPH 2EX3A 1Q3EA 3CRQA 2AXTZ 4FK5C 3ZJZA 2EIJB 1FFXB 2WLLA 2YDEA 3JD3A 5EYPA 4KP4A 2UXCB 2ITCC 3E8HA 3G71V 4DR4O 5JJJB 1K5SA 3K9SA 5B3SB 4XDKA 3MDSA 1KKCA 1R3LC 5EK0A 4JGSA 4PJ0Z 1QLNA 2QSAA 1HP8A 2NR5A 3IC9A 2ZE5A 4QJFB 3BPZA 2OYQA 3LUTB 1GRJA 1NT2B 3IGAC 3T1YO 4G2KA 3OM3B 1MA1A 2EILB 3ZN1A 1MZEA 5JJNB 3LNNA 2BE3A 1G6UA 4JI2O 3WG7C 4FIPC 1DGSA 4JPRA 2YXHA 2BTQA 4DR1O 4CS3A 1YJWV 1OZ0A 4J80A 4TUYB 2UXBB 4O4HB 3RVYA 3H1JH 3AG7A 3ZRWB 5IE9A 4LNUB 4U3FH 4NXNB 3O65A 3K04A 3CCJV 1SA0A 3OMAB 1YEWA 3JAWA 2Q69A 4OX9O 1KP3A 4YJ3A 5C93A 1ZSPA 2UXNA 4YXWG 4XBFA 3SGIA 2E3CA 2IJJA 1BT8A 3LDDA 3W7TA 2F4VO 1IVSA 2ETNA 2YXYA 3T1CA 5LP6A 4DR2O 3OEHG 4NKGB 1SQVH 3CJHB 4JI1B 1UJWB 3P32A 2R9RB 3HKEB 3H1HH 2IM9A 5EBWC 1AJNA 3CCLV 1Y76B 3ZIAG 4GLXA 3FAVB 4FLZA 2RN9A 1OCRB 1BE3H 4Z1VA 1YF2A 1TVKB 1HWYA 2JEUA 4G27B 1D2DA 5CA0B 5KA6A 4PI0A 2B1GA 3SPHA 3EHBB 1H2MA 2JGDA 4LCUC 2R9AA 5LOVB 1XNQO 4MTXA 1VQPV 3CCVV 2JS5A 4ZHQB 4IIJB 1CPYA 3N2KB 3BEHA 3CCQV 1KECA 3FYEB 1HDJA 2VWJA 4MVZA 1ZL8A 3SJQC 1IX9A 3E22A 5C8YB 3CS5A 2UUBB 2XNDG 3STZC 1VARA 1FXKA 4BR6A 1WJZA 4PA4A 5B1AB 5LHHA 4X9QA 1RM1B 4EB6B 5LHIA 2B9ZA 3CCRV 4I9WA 3CHXA 2PUSA 5B1OA 1EBOA 3JSLA 3CD6V 2CUGA 2ZNIA 1NTKH 1SKVA 4GKKB 1WLEA 3N2GB 2DOSA 1P4RA 2Y4TA 2AW9A 2H94A 4K35A 4DR7O 1AI4A 4UCVA 3CPWU 4PA9A 1I7FA 4FJCC 1FFXA 1H2SB 4PA3A 5GONB 3K5LA 1JMKC 1QLEC 2W0XA 1ROPA 2QM4A 2LP7A 1SQQH 1HNWB 2EIKC 4P9OA 1IURA 1BCCH 1SRYA 3CCSV 2WWWA 1FPOA 2JEXA 2MW2B 2AHZA 2UXDO 2WLMA 4KHPO 1NBMG 3WG7B 1YJ9V 4UV8A 3ETDA 3TXQA 1I5XA 1Q82W 1IBLB 4DV3B 4BW9A 3RVZA 1Q86W 4TV8A 1T5EA 5IJ9B 4R6ZA 1F4NA 2Q68A 4LFAO 4BAYA 1WN7A 3L75H 4QIWF 3TJTA 4B7EA 2QKSA 3D3QA 4TSFG 3ZHUA 2CTRA 3X2QC 3T1HB 5LGUA 3A8TA 3FFQA 1JPXA 4DV2B 2PTMA 1W59A 2LGWA 3H1IH 4MTFA 1D5NA 3SYOA 2ZKOA 2CGOA 3ZHTA 4CH6A 1Y6XA 3EXAA 2VQEO 1GTOA 3LSSA 1XL4A 3FB5C 3K79A 3RW0A 5K1PA 4DR6O 5KHHA 3OR6C 1YVWA 1M1KW 4B3MO 2X6BA 2F43G 3MD0A 3G6BA 1KYOF 3HKEA 4UCRA 5KHIA 1WP8A 1LUVA 3K0GA 2C2AA 2YICA 1YIJV 2UUCB 3FAVA 1HNZB 1M57C 2HLDG 3CC7V 3F7YC 5BXZA 1NJIW 1NTMH 1ZTEA 3OGCC 1G4YB 5CA0A 4F4LA 2CK3G 4Q20A 4B3RB 1VQMV 4MW3A 1Q6IA 4UCTA 5LBQA 1PV0A 1DF5A 1B06A 1KUQA 4UUJC 5H9CA 3OFNG 3QF7A 1TUBB 4YY3O 3SYPA 4PV1B 1AJPA 4NR1A 5CBHA 1X4TA 2LW7A 2VS0A 2K9PA 1L0LH 4LR3A 3K3WA 4NTXA 3VQWA 2XAJA 1K4CC 5C8YA 4JF3A 5J2TB 3DC5A 1URFA 2PF4E 1S5HC 1VF6A 5GTIZ 1EN6A 4EB6A 4K8ZA 4UVBA 1PP9H 4Z2WA 4RQEA 1KBHA 1VEWA 3ICXA 3IAYA 5IT9N 4MVRA 3BA9A 1MMMA 3OEEG 4X66B 1XDCA 3ZN0A 1Q6HA 2XTAA 1NR1A 4X65O 2YS8A 2X7RB 4DV1O 1JR9A 1E1RG 2QGNA 3SYAA 1QLEB 1V54C 5DM6V 1ZLZA 3CEIA 1HNXB 4N23A 4NXMO 1K97A 1N4CA 3SPCA 1YI2V 3ETQA 3T4ZA 4LF7B 2EIKB 5EBLC 1Q43A 1W0JG 3ASOC 4J9YB 2Z5UA 2XT9A 4O2BB 1A32A 3CCUV 3M8AA 4CH4A 4DV5B 4LC1A 4LF6B 4LFCB 2OIEA 2N04A 3K08A 3H1KH 5IWAB 1MSDA 2XAGA 1Y66A 4DR5B 2QWOB 2ITDC 5L3BA 4MVMA 2QJ1A 3QO8A 3E35A 3R65A 4JV5O 2FL4A 5H6RA 2EZOA 3B2EE 4ASUG 5E1AC 3X2QB 4EEQA 4LFBO 1XMOO 4DR3B 4P2ZA 4GYCB 3UKMA 1P7GA 2WLLB 5EYPB 3OTOB 2Y0IA 1H2KA 2DYRC 1SETA 4EKWA 1JX9A 3ABUA 2HEPA 3JD2A 2CDYA 3QTCA 1Q81W 3APQA 4DV4B 1M4UA 3IFXA 4JYCA 2V4DA 4I5SA 3AG2C 1JQ0A 1VQ5V 4I50A 1AROP 4N21A 4MS2A 1NTZH 4ZI7B 1Y74B 1M5IA 1VQ4V 4JAUA 1OCOC 1H38A 1M57B 5CBFA 3L72H 4JI8O 2YI9A 1KC8W 4X1KB 2ZXWC 3JARB 1RPOA 3UO2A 4MTOA 4GZRB 3SYCA 4IHJA 1MG1A 2CH7B 4CH3A 3JCUZ 4B3TB 1SA0B 1R3JC 4CC6A 2ARHA 5IYBO 2ZINA 1XQ8A 5LMUB 2QWQB 1FYJA 2P5OA 4BIOA 4YJ3B 1TUBA 4AI8A 1JFFB 2IU0A 2IJHA 1H8HG 1NQTA 2P7TC 1BHAA 4RUEA 1WB8A 2ZM6O 4JYAO 2W6IG 4O4LA 4FM0A 4FZ1A 4DW1A 2E75B 4JI6B 5LP6B 1U96A 5J2TA 1LR1A 3H9VA 4JI7B 4RWUA 5AG2A 4H13B 3UQ8A 1XNRB 3ZMTA 5B1BB 2Y4UA 3ZX6A 1NH2D 5CA3A 3OMIB 1FAFA 1IXMA 4PDLA 2JRIA 4AILC 1G8MA 1FJGB 2WAMA 1R6TA 1WPBA 4J41A 3GB7C 4K0KB 1V54B 1EZVH 1HR0B 3RYFB 4W4KA 4DUYB 5JQGB 3FKSG 2JGDB 3ASOB 1Y67A 1THZA 1R3KC 3CE2A 1JJOA 1K7DA 2YIBA 5CA1B 2X6CA 2EINC 1IBMO 3CRMA 4O2BA 1ZL8B 5LYJA 4BIZA 3E22B 2YI8A 5DN6G 1AVMA 4K3AA 2UXBO 3ZBHA 1R1BA 2Q0OC 5L3GA 2IH1C 2Q7GA 4X1YB 1AR4A 1KP2A 1K8AW 3SDLA 4E2LA 2HR3A 3TXSA 2QDOA 2IBZH 4EFBA 3FB6C 3AG3C 2JJ1G 1BGYH 1VF7A 1NI8A 2EZPA 4FLXA 3RGBA 2ZQMA 3BRCA 3L73H 2NLJC 3DGEA 1AR5A 1S72V 1AILA 2F66C 2M7WA 1AP6A 1QU7A 4LWSA 1PD3A 1VQLV 4QNHB 3AG2B 4GT1A 2YIBD 5BMVA 1SQGA 1ENVA 3I55V 1OCOB 4TQFA 2WA4A 1NR7A 3ZS8C 4MVSA 4ZI7A 1Y74A 5CBGA 4HAMA 5IY5C 2UXXA 1BQZA 2ZXWB 4TV8B 5GW7A 2D2CB 2DE0X 1O9HA 4LF4B 4X1KA 2QM8A 3DSQA 1BS3A 2ZT9B 2OWOA 4YIOA 3JARA 1VQOV 2UUBO 2KB1A 2JK5C 2CH7A 5KHGA 1ZUQA 1QCEA 2HHHB 4LF8B 1N36B 5KUKA 4TWKA 1JFFA 5EIBD 4GKKO 3EVKA 4L87A 3G4SV 4FVMA 4I0XA 3VOUA 2BCCH 3C3SA 4GUNA 1L8DA 4B3SO 4KFMA 2PY5A 1N33B 2V7QG 1R6NA 1Z5VA 3L71H 1VQ9V 3AK3A 3FD9A 1GN6A 1E79G 1MZFA 4JAVA 2KG7B 4DK1A 4JI0B 4X1IA 4DUZB 4JI4B 4JTAB 1IBKO 4BW5A 1QNMA 3K5OA 2BOBC 1HNWO 4IGGA 4ZIBA 1OCZC 3RYFA 1AJQA 2VQFO 1N0JA 5JQGA 1PPJH 4DR4B 5EC2C 5BZBA 4DV3O 3RN4A 5CA1A 4O4IB 3TCUA 1H2GA 3ABKC 2R70A 3ZHSA 1XHZA 1SZTA 1S5LZ 1NKDA 2YIAA 3JSNA 1KKDA 1PL0A 4LH6A 3RYHA 4JI2B 3LSUA 3CX5F 4X1YA 3O9OA 3JASA 2AZ0A 1L1FA 4DV6O 3K06A 3ZRVA 2GUZB 3AG3B 2WPDG 4DV2O 4WFFA 1P84F 2XOKG 3G67A 5A9GA 1WA8A 4O4JA 1JCHA 4LP8A 3BFRA 1GO3F 5K1XA 4MW8A 1M90W 3VQXA 1DTOA 4HYOA 3RBZA 3CXCU 1K34A 1SQBH 5L3CA 1I08A 3ZMSA 3MHSC 4FLUA 2OT5A 1SF9A 3MAQA 4DR2B 3ETEA 2WLIA 1HNZO 1AP5A 2QR4A 3K0DA 1K5QA 3LDCA 3CP1A 2WLJA 1YHQV 1EN4A 1TAEA 2ZD9A 3CRRA 1VQ8V 4KUMA 4FPPA 5BR8B 1QR8A 2R9IA 3M99B 5HFMA 3C3TA 2K1EA 2P22C 1I94B 1S77D 1IDSA 4GCZA 2B5UA 4HZ3A 2A0LA 2LO1A 1EFRG 1YTFD 2M6YA 2ADQB 4WCEV 2E74B 3F7VC 4YHHB 1RFYA 2FTKA 4X62O 3AG1C 5CMUA 2Q5ZA 3FB8C 1P49A 1YDXA 2XUMA 3F5WC 5EIBC 3WB0A 4X66O 3BAAA 2Z0AA 3U0ZA 5DECA 1NH2B 4I50B 4LBEC 5BY1A 1HNXO 3RYIB 1H8EG 2R72A 1AI5A 4LF7O 2KG7A 1OCZB 2XAHA 2EBOA 1S76D 3JALB 4OPHA 4J10A 3KZIZ 1TA8A 5ITZA 4DV5O 2YUAA 4LFCO 1XBLA 4IHJB 4FFBB 4I4TA 2YXLA 5IWAO 4DR5O 3SJBC 5LMNB 1QQCA 2OIGA 3ABKB 2GBOA 2AZ2A 1X59A 1SZXA 4O4IA 5HFLA 3ZRXA 3OMNB 2HJDA 1S5JA 2WLHA 1V55C 4R7CA 4O4LB 4WBNB 4JYBA 4JI3O 1Q8IA 4GKJB 4WFHA 1XMQB 2NN4A 3OTOO 3JATB 4DW0A 2GUZA 4MSWC 2EIMC 3K59A 3ZEDA 2UU9B 2E5LO 4UV9A 2ZE6A 5LA6A 3CC2V 4DV4O 2F93B 2ZE7A 2BSKA 3QO7A 2BOCC 3K57A 2Y69C 2Z3YA 1K73W 1M93A 2QTOA 4AQYB 1YXBA 3RWRD 4PDMA 1N34B 2JIZG 2VQEB 4G28B 5LYJB 2LJ2A 3W7XA 4DR6B 2HP8A 2GDSA 2BTOA 4B3MB 1ZWIC 5EZYA 4DK0A 1QHTA 4B3TO 4J42A 2LW1A 1WB7A 2AGAA 2N74A 2DQ0A 3LSQA 3ABMC 1HW7A 5LMUO 4LF9B 4UCUA 1F7YA 2PYJA 2PI4A 1H2LA 5CB4B 4JI6O 3ABLC 4WF9V 1GH6A 2RDCA 2GV9A 1TGOA 2A7WA 3E2EA 3AG1B 1GN2A 4JI7O 1O9GA 3Q4HB 3SJAC 4XDJA 5JJEB 1BQ0A 1VIBA 3LNMB 4LWSB 1YZBA 3L9DA 5JH7B 3VBBA 3K9AA 5BMVB 3BCCH 4K0KO 4Q6GA 4U7NA 3RT3C 2Q0AA 1NVPD 1XREA 4YIPA 4ABMA 2P67A 5H2FZ 4O2AB 4ICGA 1XILA 3RYIA 3F5TA 4J7ZA 2A3QA 2EJRA 2LFSA 4DV1B 1J5EO 1WNSA 2XAQA 2YSUB 2WLNA 5FLXN 3S3WA 3NXSA 3JALA 4J11A 3CSXA 1XEQA 4X20B 1Y4MA 3P30A 4FFBA 5LHGA 2DQ3A 1DLBA 5KHKA 4J9ZB 2GSMB 1MABG 4PDRA 2IW5A 4CC5A 3SPGA 5GTHZ 2ODMA 5J2UB 4U3JA 1V55B 1AB3A 2QKCA 4TOIA 1BHBA 2JS3A 4WFBV 4GX0A 1XOUA 4I0XB 2Q7EA 1SQXH 5IYCO 4ZOLA 1AI6A 2E76B 4B08A 4WBNA 2DW4A 1VF5B 2PGGA 4JV5B 2F1MA 4ZKIA 1N32B 1F23A 1Z2GA 1K3EA 2UXCO 4FLTA 3JATA 2JDIG 2A06H 2HVKC 4LFBB 4X1IB 2CTWA 2OCCC 2L6LA 4LF5B 1ZX3A 4JI5B 4DV7B 2Y69B 2XASA 4QPJA 1KD1W 2ZNJA 5JWPA 3ZCCA 2W0FC 2ZR3A 1EZJA 3SYQA 5IYZB 2AHYA 3BABA 3D8CA 2UUAB 4GX2A 3AG4C 2A79B 2P4VA 4OGQB 4UCSA 4AHCA 4PA6A 3ZMUA 1F4MA 4CH5A 1VQ7V 5E79Z 3FB7C 1UFIA 2Q7HA 4LF4O 1M9NA
chains in the Genus database with same CATH topology
2BSKA 3DXRA 3CJHB 3CJHA 2BSKB 3DXRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BSK A;  3DXR A;  3CJH B;  3CJH A;  2BSK B;  3DXR B; 
#chains in the Genus database with same CATH topology
 3RYH B;  1YJN V;  5KAI Z;  3ZMZ A;  3JAS B;  3ABM B;  5H6Q A;  2FML A;  4NXN O;  1LUW A;  4D7T A;  3CME V;  4DYL A;  3W7S A;  2HHH O;  4LF8 O;  1N36 O;  3CWB H;  1WA8 B;  4O4J B;  3A0B Z;  3ABL B;  1YTF B;  2CAZ C;  3CRC A;  2EUL A;  5LL6 Y;  4IYI A;  1RP3 B;  2DYR B;  5CB4 A;  1OHH G;  4FZ0 A;  5KMG B;  3E83 A;  2B1I A;  3KCY A;  1BSM A;  4P9P A;  2LFR A;  1RM1 C;  1US6 A;  1B04 A;  3Q4H A;  2LGQ A;  4JI1 O;  4MVQ A;  3QNE A;  2ZIM A;  2IU3 A;  1JOY A;  4JI0 O;  1K33 A;  4JI4 O;  3AK1 A;  4PEL A;  5JH7 A;  5IJ0 A;  5D5P A;  2WLI B;  4XDL A;  3AK2 A;  3L74 H;  1D5A A;  4UB6 Z;  1Q7Y W;  4JTD B;  4CS4 A;  4P30 A;  3RYC A;  3K5M A;  1R73 A;  4O2A A;  4ZBM A;  3DXR B;  4IL6 Z;  2Y48 A;  2W6J G;  1KB9 F;  5JVD B;  2HFE C;  3T4D A;  1GKF A;  3WB2 A;  3L70 H;  3E89 A;  2O57 A;  5B1N A;  4EFE A;  4X20 A;  5KX5 A;  3JAK B;  2ZR2 A;  2NNU A;  3ASN C;  4X64 B;  1IBM B;  1N8R W;  4OPA A;  2IJK A;  1GM9 A;  5J2U A;  3I5D A;  3QO5 A;  4WFA V;  2Q8V A;  4DO2 A;  1VQN V;  2JGU A;  2JJ2 G;  5L3F A;  1PL4 A;  3CB2 A;  1E1Q G;  1PNK A;  2Y0P A;  2Q4P A;  4UCO A;  2N05 A;  4WFG A;  4R8C A;  3KKY A;  1WPX A;  2PI5 A;  3TGU H;  1W0K G;  5H5N A;  3HPL C;  2OCC B;  3B4S A;  3R66 A;  3H01 A;  2P6J A;  4JTC B;  4DV0 B;  4J7J A;  5FNV B;  4H33 A;  1B3Q A;  4UB8 Z;  4RQF A;  2RMK B;  2KSD A;  3B8N A;  5ITZ B;  4KXR A;  1Q6U A;  4I4T B;  3AG4 B;  2GHY A;  4I7Z B;  4FFK A;  5IYZ A;  2PZS A;  3LDE A;  3E8G A;  2EIN B;  4LH7 A;  2YEV B;  1YCI A;  3JD0 A;  3OAA G;  2LQT A;  3OUS A;  3ZHQ A;  1IBL O;  3DC6 A;  4TQD A;  3CCE V;  5BR8 O;  3K03 A;  1GAX A;  1JVM A;  3W7U A;  2MK3 A;  4D7S A;  3OT7 A;  1I94 O;  2Q73 A;  3T1Y B;  3HKB B;  1M56 C;  3CRA A;  1LNQ A;  2FKX A;  3DTU B;  4UVA A;  3JYC A;  1F51 A;  1JJ2 U;  4HNA A;  5JCO C;  3W7W A;  3T1H O;  4YHH O;  2DWE C;  3U10 A;  4DR1 B;  1B6Q A;  2ZE8 A;  1GM7 A;  3HKD B;  5J9P C;  4FMT A;  1QVF U;  4RAI A;  3G6E V;  1WP7 A;  4L8J A;  2PYL A;  1QBZ A;  5LA6 B;  4JYY A;  1OCC C;  3IC7 A;  1KQS U;  1GM8 A;  1PKX A;  1VQK V;  1N0N A;  3J80 N;  4BWA A;  2BSK B;  3BHP A;  2FYU H;  4MVO A;  3TET A;  5KMG A;  2GTA A;  4OX9 B;  5B66 Z;  4DRX B;  1FXV A;  1VP7 A;  4TV9 B;  4CS2 A;  1ZAU A;  2F4V B;  1NVP B;  4B3S B;  2UUC O;  3CXH F;  2QTS A;  1RSO B;  2QWN B;  1U97 A;  3CC4 V;  5EZY B;  3JD4 A;  2ZDI C;  5IY5 B;  1IZ3 A;  4H44 B;  1R3I C;  4B3R O;  3P3P A;  1IBK B;  3DXR A;  1H2N A;  5LMN O;  5JVD A;  3BA8 A;  4CBC A;  3HR0 A;  3FX7 A;  5KLV H;  4F6R B;  4BIU A;  3QG5 A;  1CP9 A;  3M7M X;  4TT3 G;  3U11 A;  1OJH A;  2VQF B;  3ASN B;  1SC5 B;  1XNQ B;  5EC1 C;  5FPO A;  4QGP A;  4X89 A;  4HBN A;  2WA3 A;  3JAK A;  3THO A;  3T2M A;  4JAA A;  1XI1 A;  4PDV A;  4I55 B;  2KQX A;  3ZHR A;  4GKJ O;  1XMQ O;  2X0L A;  2Q9L A;  3FYI B;  4PHZ A;  1V9P A;  4KL1 A;  3JD1 A;  4TUY A;  4CZZ A;  4O4H A;  5DED A;  2UU9 O;  1EM1 A;  1I5Y A;  3E8F A;  3ZRW A;  2QKA A;  4LNU A;  5CN0 A;  4DV6 B;  2WLK A;  3WB1 A;  3BVO A;  1AR1 B;  2IH3 C;  2H3O A;  1S3J A;  2WSS G;  2IJI A;  5F2V O;  4AQY O;  3B77 A;  1XL6 A;  2HJF C;  1N34 O;  4DR7 B;  4A5U B;  5LXT B;  1BMF G;  5FNV A;  1PM9 A;  2ILM A;  1MNG A;  2QWR B;  3STL C;  2QA4 V;  4LF6 O;  3CJH A;  1K9M W;  3OD4 A;  4PI2 A;  5LGN A;  3OUF A;  4QPK A;  3H1L H;  3E86 A;  2YEV A;  2HVJ C;  1Y76 A;  4U3J B;  1YIT V;  1BZK A;  3D36 A;  1M56 B;  4RUF A;  2G38 A;  1TVK A;  4LF9 O;  3UT5 B;  2UXD B;  1L0N H;  4JZ2 A;  3SPI A;  3HB3 B;  4KHP B;  4NTW A;  3HKB A;  4FLY A;  4ZOL B;  1CEZ A;  1SES A;  4FM2 A;  5LOV A;  2CGN A;  4DR3 O;  1BL8 A;  5KA5 A;  2DJV A;  2Q6A A;  4JZG A;  1VMG A;  2YC0 A;  3RFR A;  4IIJ A;  4ZHQ A;  3N2K A;  3UM7 A;  2F95 B;  3WU2 Z;  4Z1M G;  4LFA B;  1Z5W A;  4GX5 A;  4FLV A;  2QM7 A;  1XUQ A;  1OCC B;  1FD9 A;  3HKD A;  4MTG A;  3N27 A;  4QE9 A;  1COW G;  4UXN A;  4X8A A;  3B09 A;  1W2B U;  3J7A U;  3APO A;  1FFT B;  2X6A A;  4NB5 A;  4WFE A;  2ZIO A;  1DK1 A;  2F23 A;  4DXW A;  5LP6 C;  4X62 B;  3SR2 C;  5B1B C;  3EFF K;  2CTQ A;  5EBM C;  4W4L A;  4DRX A;  3I56 V;  1ORQ C;  3N2G A;  4TV9 A;  3KCX A;  1K4D C;  3MHH C;  3ABT A;  4UFZ A;  1KU9 A;  3HKC B;  2CE4 A;  4FLW A;  1MOF A;  3G80 A;  5L3E A;  1CXZ B;  3JCZ A;  1RSO A;  5GON A;  1GN3 A;  4RO2 A;  4B7K A;  1RPR A;  1PNL A;  3WFV A;  1SS3 A;  3IJ4 A;  3GWK C;  4PD4 F;  2ATK C;  4F6R A;  1FS0 G;  3OR7 C;  1PNM A;  2GTS A;  2RJZ A;  4H0L B;  2Q67 A;  1FXK C;  2EJ7 A;  3BY6 A;  4I55 A;  1VQ6 V;  4YY3 B;  1XNR O;  1N32 O;  4IT5 A;  3E8B A;  2VWK A;  5IJ9 A;  2XHB A;  2KKW A;  4YJ2 B;  1YSC A;  2CTP A;  2DYS C;  1DF4 A;  1FJG O;  2DMX A;  4E4E A;  5IJ0 B;  1S0V A;  4JI3 B;  2P90 A;  2YID A;  4LF5 O;  1EN5 A;  1J95 A;  3PN1 A;  1K92 A;  4JI5 O;  3K58 A;  4DV7 O;  4X88 A;  1HR0 O;  3SJC C;  2QEX V;  3RYC B;  1IXB A;  2RCV A;  3K5N A;  3JAM N;  4DUY O;  3A0H Z;  2EIJ C;  4GX1 A;  4NYK A;  2E5L B;  2UUA O;  2OTL V;  3OTF A;  4X65 B;  3P3N A;  3OE7 G;  2HG5 C;  3J81 N;  4PA7 A;  2OTJ V;  4R50 A;  5LXT A;  5B3S C;  2H8P C;  4QE7 A;  3NR7 A;  4NXM B;  5IYD O;  5KX5 B;  2RQ6 A;  3GVM A;  2FB5 A;  1R6K A;  2ADP A;  4F6E A;  3CCM V;  5FPR A;  2BTQ B;  4NTY A;  3SPJ A;  4I9Q A;  2EIL C;  2D3O W;  4MT8 A;  3A2F A;  1Q90 D;  3UT5 A;  1AI7 A;  2QE7 G;  4OXS A;  3VQV A;  5JCO A;  3B40 A;  2V1D A;  1P7B A;  1JA8 A;  3TK1 A;  3ZRS A;  3UCS C;  3JAW B;  2EIM B;  3ML0 A;  4U7O A;  1XHX A;  5KAF Z;  2DN9 A;  1XMO B;  3VQY A;  1NU1 H;  3CYO A;  3AEI A;  3A0R A;  2P4K A;  1TUE B;  4J7K A;  3ZHV A;  2OCH A;  1SQF A;  2VRZ A;  2HKO A;  1I0H A;  2A9H A;  1QR9 A;  2JVD A;  2P06 A;  5LGT A;  5KHJ A;  2DWD C;  3OGI B;  4C7U A;  2ZCE A;  5KUM A;  1MSW D;  3ETG A;  4K8X A;  3KG2 A;  2QWP B;  3OW2 U;  5IDJ A;  3HKC A;  2ZDI A;  2RNB A;  3D36 C;  1OCR C;  5D5Q A;  4D6T H;  1WAZ A;  1KMI Z;  1NZ6 A;  2XAF A;  3QVN A;  4HNA B;  3PJS K;  4JI8 B;  4NVP A;  3UO3 A;  4X64 O;  1UPG A;  2L35 A;  1QVG U;  1J5E B;  4MVU A;  1OV9 A;  3B8M A;  1GK9 A;  5FL7 G;  1GMG A;  3C90 A;  1FXK B;  1FXH A;  1Q5O A;  4IYH A;  1GN4 A;  3ZMV A;  5L3D A;  4H37 A;  5A2Q N;  3D3I A;  1FKA O;  4JAS A;  3GWO A;  5B5E Z;  5TIS Z;  5B1A C;  1N33 O;  1SER A;  2DYS B;  1VF6 C;  4FM1 A;  4UVC A;  4YJ2 A;  2ZM6 B;  4JYA B;  1G1X B;  3S3X A;  1NS1 A;  4DUZ O;  3CMA V;  4DV0 O;  1SQP H;  2EX3 A;  1Q3E A;  3CRQ A;  2AXT Z;  4FK5 C;  3ZJZ A;  2EIJ B;  1FFX B;  2WLL A;  2YDE A;  3JD3 A;  5EYP A;  4KP4 A;  2UXC B;  2ITC C;  3E8H A;  3G71 V;  4DR4 O;  5JJJ B;  1K5S A;  3K9S A;  5B3S B;  4XDK A;  3MDS A;  1KKC A;  1R3L C;  5EK0 A;  4JGS A;  4PJ0 Z;  1QLN A;  2QSA A;  1HP8 A;  2NR5 A;  3IC9 A;  2ZE5 A;  4QJF B;  3BPZ A;  2OYQ A;  3LUT B;  1GRJ A;  1NT2 B;  3IGA C;  3T1Y O;  4G2K A;  3OM3 B;  1MA1 A;  2EIL B;  3ZN1 A;  1MZE A;  5JJN B;  3LNN A;  2BE3 A;  1G6U A;  4JI2 O;  3WG7 C;  4FIP C;  1DGS A;  4JPR A;  2YXH A;  2BTQ A;  4DR1 O;  4CS3 A;  1YJW V;  1OZ0 A;  4J80 A;  4TUY B;  2UXB B;  4O4H B;  3RVY A;  3H1J H;  3AG7 A;  3ZRW B;  5IE9 A;  4LNU B;  4U3F H;  4NXN B;  3O65 A;  3K04 A;  3CCJ V;  1SA0 A;  3OMA B;  1YEW A;  3JAW A;  2Q69 A;  4OX9 O;  1KP3 A;  4YJ3 A;  5C93 A;  1ZSP A;  2UXN A;  4YXW G;  4XBF A;  3SGI A;  2E3C A;  2IJJ A;  1BT8 A;  3LDD A;  3W7T A;  2F4V O;  1IVS A;  2ETN A;  2YXY A;  3T1C A;  5LP6 A;  4DR2 O;  3OEH G;  4NKG B;  1SQV H;  3CJH B;  4JI1 B;  1UJW B;  3P32 A;  2R9R B;  3HKE B;  3H1H H;  2IM9 A;  5EBW C;  1AJN A;  3CCL V;  1Y76 B;  3ZIA G;  4GLX A;  3FAV B;  4FLZ A;  2RN9 A;  1OCR B;  1BE3 H;  4Z1V A;  1YF2 A;  1TVK B;  1HWY A;  2JEU A;  4G27 B;  1D2D A;  5CA0 B;  5KA6 A;  4PI0 A;  2B1G A;  3SPH A;  3EHB B;  1H2M A;  2JGD A;  4LCU C;  2R9A A;  5LOV B;  1XNQ O;  4MTX A;  1VQP V;  3CCV V;  2JS5 A;  4ZHQ B;  4IIJ B;  1CPY A;  3N2K B;  3BEH A;  3CCQ V;  1KEC A;  3FYE B;  1HDJ A;  2VWJ A;  4MVZ A;  1ZL8 A;  3SJQ C;  1IX9 A;  3E22 A;  5C8Y B;  3CS5 A;  2UUB B;  2XND G;  3STZ C;  1VAR A;  1FXK A;  4BR6 A;  1WJZ A;  4PA4 A;  5B1A B;  5LHH A;  4X9Q A;  1RM1 B;  4EB6 B;  5LHI A;  2B9Z A;  3CCR V;  4I9W A;  3CHX A;  2PUS A;  5B1O A;  1EBO A;  3JSL A;  3CD6 V;  2CUG A;  2ZNI A;  1NTK H;  1SKV A;  4GKK B;  1WLE A;  3N2G B;  2DOS A;  1P4R A;  2Y4T A;  2AW9 A;  2H94 A;  4K35 A;  4DR7 O;  1AI4 A;  4UCV A;  3CPW U;  4PA9 A;  1I7F A;  4FJC C;  1FFX A;  1H2S B;  4PA3 A;  5GON B;  3K5L A;  1JMK C;  1QLE C;  2W0X A;  1ROP A;  2QM4 A;  2LP7 A;  1SQQ H;  1HNW B;  2EIK C;  4P9O A;  1IUR A;  1BCC H;  1SRY A;  3CCS V;  2WWW A;  1FPO A;  2JEX A;  2MW2 B;  2AHZ A;  2UXD O;  2WLM A;  4KHP O;  1NBM G;  3WG7 B;  1YJ9 V;  4UV8 A;  3ETD A;  3TXQ A;  1I5X A;  1Q82 W;  1IBL B;  4DV3 B;  4BW9 A;  3RVZ A;  1Q86 W;  4TV8 A;  1T5E A;  5IJ9 B;  4R6Z A;  1F4N A;  2Q68 A;  4LFA O;  4BAY A;  1WN7 A;  3L75 H;  4QIW F;  3TJT A;  4B7E A;  2QKS A;  3D3Q A;  4TSF G;  3ZHU A;  2CTR A;  3X2Q C;  3T1H B;  5LGU A;  3A8T A;  3FFQ A;  1JPX A;  4DV2 B;  2PTM A;  1W59 A;  2LGW A;  3H1I H;  4MTF A;  1D5N A;  3SYO A;  2ZKO A;  2CGO A;  3ZHT A;  4CH6 A;  1Y6X A;  3EXA A;  2VQE O;  1GTO A;  3LSS A;  1XL4 A;  3FB5 C;  3K79 A;  3RW0 A;  5K1P A;  4DR6 O;  5KHH A;  3OR6 C;  1YVW A;  1M1K W;  4B3M O;  2X6B A;  2F43 G;  3MD0 A;  3G6B A;  1KYO F;  3HKE A;  4UCR A;  5KHI A;  1WP8 A;  1LUV A;  3K0G A;  2C2A A;  2YIC A;  1YIJ V;  2UUC B;  3FAV A;  1HNZ B;  1M57 C;  2HLD G;  3CC7 V;  3F7Y C;  5BXZ A;  1NJI W;  1NTM H;  1ZTE A;  3OGC C;  1G4Y B;  5CA0 A;  4F4L A;  2CK3 G;  4Q20 A;  4B3R B;  1VQM V;  4MW3 A;  1Q6I A;  4UCT A;  5LBQ A;  1PV0 A;  1DF5 A;  1B06 A;  1KUQ A;  4UUJ C;  5H9C A;  3OFN G;  3QF7 A;  1TUB B;  4YY3 O;  3SYP A;  4PV1 B;  1AJP A;  4NR1 A;  5CBH A;  1X4T A;  2LW7 A;  2VS0 A;  2K9P A;  1L0L H;  4LR3 A;  3K3W A;  4NTX A;  3VQW A;  2XAJ A;  1K4C C;  5C8Y A;  4JF3 A;  5J2T B;  3DC5 A;  1URF A;  2PF4 E;  1S5H C;  1VF6 A;  5GTI Z;  1EN6 A;  4EB6 A;  4K8Z A;  4UVB A;  1PP9 H;  4Z2W A;  4RQE A;  1KBH A;  1VEW A;  3ICX A;  3IAY A;  5IT9 N;  4MVR A;  3BA9 A;  1MMM A;  3OEE G;  4X66 B;  1XDC A;  3ZN0 A;  1Q6H A;  2XTA A;  1NR1 A;  4X65 O;  2YS8 A;  2X7R B;  4DV1 O;  1JR9 A;  1E1R G;  2QGN A;  3SYA A;  1QLE B;  1V54 C;  5DM6 V;  1ZLZ A;  3CEI A;  1HNX B;  4N23 A;  4NXM O;  1K97 A;  1N4C A;  3SPC A;  1YI2 V;  3ETQ A;  3T4Z A;  4LF7 B;  2EIK B;  5EBL C;  1Q43 A;  1W0J G;  3ASO C;  4J9Y B;  2Z5U A;  2XT9 A;  4O2B B;  1A32 A;  3CCU V;  3M8A A;  4CH4 A;  4DV5 B;  4LC1 A;  4LF6 B;  4LFC B;  2OIE A;  2N04 A;  3K08 A;  3H1K H;  5IWA B;  1MSD A;  2XAG A;  1Y66 A;  4DR5 B;  2QWO B;  2ITD C;  5L3B A;  4MVM A;  2QJ1 A;  3QO8 A;  3E35 A;  3R65 A;  4JV5 O;  2FL4 A;  5H6R A;  2EZO A;  3B2E E;  4ASU G;  5E1A C;  3X2Q B;  4EEQ A;  4LFB O;  1XMO O;  4DR3 B;  4P2Z A;  4GYC B;  3UKM A;  1P7G A;  2WLL B;  5EYP B;  3OTO B;  2Y0I A;  1H2K A;  2DYR C;  1SET A;  4EKW A;  1JX9 A;  3ABU A;  2HEP A;  3JD2 A;  2CDY A;  3QTC A;  1Q81 W;  3APQ A;  4DV4 B;  1M4U A;  3IFX A;  4JYC A;  2V4D A;  4I5S A;  3AG2 C;  1JQ0 A;  1VQ5 V;  4I50 A;  1ARO P;  4N21 A;  4MS2 A;  1NTZ H;  4ZI7 B;  1Y74 B;  1M5I A;  1VQ4 V;  4JAU A;  1OCO C;  1H38 A;  1M57 B;  5CBF A;  3L72 H;  4JI8 O;  2YI9 A;  1KC8 W;  4X1K B;  2ZXW C;  3JAR B;  1RPO A;  3UO2 A;  4MTO A;  4GZR B;  3SYC A;  4IHJ A;  1MG1 A;  2CH7 B;  4CH3 A;  3JCU Z;  4B3T B;  1SA0 B;  1R3J C;  4CC6 A;  2ARH A;  5IYB O;  2ZIN A;  1XQ8 A;  5LMU B;  2QWQ B;  1FYJ A;  2P5O A;  4BIO A;  4YJ3 B;  1TUB A;  4AI8 A;  1JFF B;  2IU0 A;  2IJH A;  1H8H G;  1NQT A;  2P7T C;  1BHA A;  4RUE A;  1WB8 A;  2ZM6 O;  4JYA O;  2W6I G;  4O4L A;  4FM0 A;  4FZ1 A;  4DW1 A;  2E75 B;  4JI6 B;  5LP6 B;  1U96 A;  5J2T A;  1LR1 A;  3H9V A;  4JI7 B;  4RWU A;  5AG2 A;  4H13 B;  3UQ8 A;  1XNR B;  3ZMT A;  5B1B B;  2Y4U A;  3ZX6 A;  1NH2 D;  5CA3 A;  3OMI B;  1FAF A;  1IXM A;  4PDL A;  2JRI A;  4AIL C;  1G8M A;  1FJG B;  2WAM A;  1R6T A;  1WPB A;  4J41 A;  3GB7 C;  4K0K B;  1V54 B;  1EZV H;  1HR0 B;  3RYF B;  4W4K A;  4DUY B;  5JQG B;  3FKS G;  2JGD B;  3ASO B;  1Y67 A;  1THZ A;  1R3K C;  3CE2 A;  1JJO A;  1K7D A;  2YIB A;  5CA1 B;  2X6C A;  2EIN C;  1IBM O;  3CRM A;  4O2B A;  1ZL8 B;  5LYJ A;  4BIZ A;  3E22 B;  2YI8 A;  5DN6 G;  1AVM A;  4K3A A;  2UXB O;  3ZBH A;  1R1B A;  2Q0O C;  5L3G A;  2IH1 C;  2Q7G A;  4X1Y B;  1AR4 A;  1KP2 A;  1K8A W;  3SDL A;  4E2L A;  2HR3 A;  3TXS A;  2QDO A;  2IBZ H;  4EFB A;  3FB6 C;  3AG3 C;  2JJ1 G;  1BGY H;  1VF7 A;  1NI8 A;  2EZP A;  4FLX A;  3RGB A;  2ZQM A;  3BRC A;  3L73 H;  2NLJ C;  3DGE A;  1AR5 A;  1S72 V;  1AIL A;  2F66 C;  2M7W A;  1AP6 A;  1QU7 A;  4LWS A;  1PD3 A;  1VQL V;  4QNH B;  3AG2 B;  4GT1 A;  2YIB D;  5BMV A;  1SQG A;  1ENV A;  3I55 V;  1OCO B;  4TQF A;  2WA4 A;  1NR7 A;  3ZS8 C;  4MVS A;  4ZI7 A;  1Y74 A;  5CBG A;  4HAM A;  5IY5 C;  2UXX A;  1BQZ A;  2ZXW B;  4TV8 B;  5GW7 A;  2D2C B;  2DE0 X;  1O9H A;  4LF4 B;  4X1K A;  2QM8 A;  3DSQ A;  1BS3 A;  2ZT9 B;  2OWO A;  4YIO A;  3JAR A;  1VQO V;  2UUB O;  2KB1 A;  2JK5 C;  2CH7 A;  5KHG A;  1ZUQ A;  1QCE A;  2HHH B;  4LF8 B;  1N36 B;  5KUK A;  4TWK A;  1JFF A;  5EIB D;  4GKK O;  3EVK A;  4L87 A;  3G4S V;  4FVM A;  4I0X A;  3VOU A;  2BCC H;  3C3S A;  4GUN A;  1L8D A;  4B3S O;  4KFM A;  2PY5 A;  1N33 B;  2V7Q G;  1R6N A;  1Z5V A;  3L71 H;  1VQ9 V;  3AK3 A;  3FD9 A;  1GN6 A;  1E79 G;  1MZF A;  4JAV A;  2KG7 B;  4DK1 A;  4JI0 B;  4X1I A;  4DUZ B;  4JI4 B;  4JTA B;  1IBK O;  4BW5 A;  1QNM A;  3K5O A;  2BOB C;  1HNW O;  4IGG A;  4ZIB A;  1OCZ C;  3RYF A;  1AJQ A;  2VQF O;  1N0J A;  5JQG A;  1PPJ H;  4DR4 B;  5EC2 C;  5BZB A;  4DV3 O;  3RN4 A;  5CA1 A;  4O4I B;  3TCU A;  1H2G A;  3ABK C;  2R70 A;  3ZHS A;  1XHZ A;  1SZT A;  1S5L Z;  1NKD A;  2YIA A;  3JSN A;  1KKD A;  1PL0 A;  4LH6 A;  3RYH A;  4JI2 B;  3LSU A;  3CX5 F;  4X1Y A;  3O9O A;  3JAS A;  2AZ0 A;  1L1F A;  4DV6 O;  3K06 A;  3ZRV A;  2GUZ B;  3AG3 B;  2WPD G;  4DV2 O;  4WFF A;  1P84 F;  2XOK G;  3G67 A;  5A9G A;  1WA8 A;  4O4J A;  1JCH A;  4LP8 A;  3BFR A;  1GO3 F;  5K1X A;  4MW8 A;  1M90 W;  3VQX A;  1DTO A;  4HYO A;  3RBZ A;  3CXC U;  1K34 A;  1SQB H;  5L3C A;  1I08 A;  3ZMS A;  3MHS C;  4FLU A;  2OT5 A;  1SF9 A;  3MAQ A;  4DR2 B;  3ETE A;  2WLI A;  1HNZ O;  1AP5 A;  2QR4 A;  3K0D A;  1K5Q A;  3LDC A;  3CP1 A;  2WLJ A;  1YHQ V;  1EN4 A;  1TAE A;  2ZD9 A;  3CRR A;  1VQ8 V;  4KUM A;  4FPP A;  5BR8 B;  1QR8 A;  2R9I A;  3M99 B;  5HFM A;  3C3T A;  2K1E A;  2P22 C;  1I94 B;  1S77 D;  1IDS A;  4GCZ A;  2B5U A;  4HZ3 A;  2A0L A;  2LO1 A;  1EFR G;  1YTF D;  2M6Y A;  2ADQ B;  4WCE V;  2E74 B;  3F7V C;  4YHH B;  1RFY A;  2FTK A;  4X62 O;  3AG1 C;  5CMU A;  2Q5Z A;  3FB8 C;  1P49 A;  1YDX A;  2XUM A;  3F5W C;  5EIB C;  3WB0 A;  4X66 O;  3BAA A;  2Z0A A;  3U0Z A;  5DEC A;  1NH2 B;  4I50 B;  4LBE C;  5BY1 A;  1HNX O;  3RYI B;  1H8E G;  2R72 A;  1AI5 A;  4LF7 O;  2KG7 A;  1OCZ B;  2XAH A;  2EBO A;  1S76 D;  3JAL B;  4OPH A;  4J10 A;  3KZI Z;  1TA8 A;  5ITZ A;  4DV5 O;  2YUA A;  4LFC O;  1XBL A;  4IHJ B;  4FFB B;  4I4T A;  2YXL A;  5IWA O;  4DR5 O;  3SJB C;  5LMN B;  1QQC A;  2OIG A;  3ABK B;  2GBO A;  2AZ2 A;  1X59 A;  1SZX A;  4O4I A;  5HFL A;  3ZRX A;  3OMN B;  2HJD A;  1S5J A;  2WLH A;  1V55 C;  4R7C A;  4O4L B;  4WBN B;  4JYB A;  4JI3 O;  1Q8I A;  4GKJ B;  4WFH A;  1XMQ B;  2NN4 A;  3OTO O;  3JAT B;  4DW0 A;  2GUZ A;  4MSW C;  2EIM C;  3K59 A;  3ZED A;  2UU9 B;  2E5L O;  4UV9 A;  2ZE6 A;  5LA6 A;  3CC2 V;  4DV4 O;  2F93 B;  2ZE7 A;  2BSK A;  3QO7 A;  2BOC C;  3K57 A;  2Y69 C;  2Z3Y A;  1K73 W;  1M93 A;  2QTO A;  4AQY B;  1YXB A;  3RWR D;  4PDM A;  1N34 B;  2JIZ G;  2VQE B;  4G28 B;  5LYJ B;  2LJ2 A;  3W7X A;  4DR6 B;  2HP8 A;  2GDS A;  2BTO A;  4B3M B;  1ZWI C;  5EZY A;  4DK0 A;  1QHT A;  4B3T O;  4J42 A;  2LW1 A;  1WB7 A;  2AGA A;  2N74 A;  2DQ0 A;  3LSQ A;  3ABM C;  1HW7 A;  5LMU O;  4LF9 B;  4UCU A;  1F7Y A;  2PYJ A;  2PI4 A;  1H2L A;  5CB4 B;  4JI6 O;  3ABL C;  4WF9 V;  1GH6 A;  2RDC A;  2GV9 A;  1TGO A;  2A7W A;  3E2E A;  3AG1 B;  1GN2 A;  4JI7 O;  1O9G A;  3Q4H B;  3SJA C;  4XDJ A;  5JJE B;  1BQ0 A;  1VIB A;  3LNM B;  4LWS B;  1YZB A;  3L9D A;  5JH7 B;  3VBB A;  3K9A A;  5BMV B;  3BCC H;  4K0K O;  4Q6G A;  4U7N A;  3RT3 C;  2Q0A A;  1NVP D;  1XRE A;  4YIP A;  4ABM A;  2P67 A;  5H2F Z;  4O2A B;  4ICG A;  1XIL A;  3RYI A;  3F5T A;  4J7Z A;  2A3Q A;  2EJR A;  2LFS A;  4DV1 B;  1J5E O;  1WNS A;  2XAQ A;  2YSU B;  2WLN A;  5FLX N;  3S3W A;  3NXS A;  3JAL A;  4J11 A;  3CSX A;  1XEQ A;  4X20 B;  1Y4M A;  3P30 A;  4FFB A;  5LHG A;  2DQ3 A;  1DLB A;  5KHK A;  4J9Z B;  2GSM B;  1MAB G;  4PDR A;  2IW5 A;  4CC5 A;  3SPG A;  5GTH Z;  2ODM A;  5J2U B;  4U3J A;  1V55 B;  1AB3 A;  2QKC A;  4TOI A;  1BHB A;  2JS3 A;  4WFB V;  4GX0 A;  1XOU A;  4I0X B;  2Q7E A;  1SQX H;  5IYC O;  4ZOL A;  1AI6 A;  2E76 B;  4B08 A;  4WBN A;  2DW4 A;  1VF5 B;  2PGG A;  4JV5 B;  2F1M A;  4ZKI A;  1N32 B;  1F23 A;  1Z2G A;  1K3E A;  2UXC O;  4FLT A;  3JAT A;  2JDI G;  2A06 H;  2HVK C;  4LFB B;  4X1I B;  2CTW A;  2OCC C;  2L6L A;  4LF5 B;  1ZX3 A;  4JI5 B;  4DV7 B;  2Y69 B;  2XAS A;  4QPJ A;  1KD1 W;  2ZNJ A;  5JWP A;  3ZCC A;  2W0F C;  2ZR3 A;  1EZJ A;  3SYQ A;  5IYZ B;  2AHY A;  3BAB A;  3D8C A;  2UUA B;  4GX2 A;  3AG4 C;  2A79 B;  2P4V A;  4OGQ B;  4UCS A;  4AHC A;  4PA6 A;  3ZMU A;  1F4M A;  4CH5 A;  1VQ7 V;  5E79 Z;  3FB7 C;  1UFI A;  2Q7H A;  4LF4 O;  1M9N A; 
#chains in the Genus database with same CATH homology
 2BSK A;  3DXR A;  3CJH B;  3CJH A;  2BSK B;  3DXR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...