3CJHA

Tim8-tim13 complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
52
structure length
52
Chain Sequence
b'ATELVNKISENCFEKCLTSPYATRNDACIDQCLAKYMRSWNVISKAYISRIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial import inner membrane translocase subunit TIM1
publication title The Tim8-Tim13 complex has multiple substrate binding sites and binds cooperatively to Tim23
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 17
structure length 52
sequence length 52
chains with identical sequence C, E, G, I, K
ec nomenclature
pdb deposition date 2008-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.810 Mainly Alpha Orthogonal Bundle Helix Hairpins Mitochondrial import inner membrane translocase subunit tim13 like domains 3cjhA00
3DXRB 3DXRA 3CJHB 2BSKB 3CJHA 2BSKA
chains in the Genus database with same CATH superfamily
2WPDG 2JEXA 2WLLB 2ETNA 2BTOA 2KB1A 4JV5B 1XQ8A 5A2QN 3K9AA 4AHCA 4PDRA 2D2CB 1S3JA 4EFEA 1BZKA 5B1BC 5IYZB 4DUYB 3ZBHA 5KLVH 2GHYA 2ITDC 5EBLC 3TCUA 3SDLA 4FLVA 1R3JC 4JYAB 3BABA 5IDJA 1WPXA 4MVUA 4YJ2A 4LFBO 2ZXWB 2B5UA 3QO8A 4TSFG 2VQFB 2FYUH 4WBNB 1BHAA 2W6IG 4JI0O 1AVMA 3B8NA 4B3SB 4PA6A 3FYEB 4QPKA 3MHHC 4D7TA 1SZTA 2CTPA 2F4VB 2HEPA 1WA8B 1GH6A 2ZNIA 1HNXB 3E22A 5B66Z 1CEZA 4DK1A 4BIZA 1QCEA 1KP3A 3OTOB 5LMUO 2YDEA 4CH5A 3SYCA 2ZM6B 3HKDB 4MVRA 2UUAO 4G2KA 4U7OA 1KP2A 3CJHB 3X2QB 3W7SA 2QTSA 4O4HB 1EFRG 3S3XA 4K8XA 1N33O 2BOCC 4HAMA 3BEHA 2ZDIC 2GBOA 2E3CA 4U3JB 5B3SB 4LC1A 1R6KA 4ZOLA 3HPLC 3H1HH 4EB6A 1VF6C 4H0LB 2OCCC 3TJTA 3AG7A 2UUCB 2Q6AA 5JVDB 3QNEA 1HNWB 2Q0AA 1IVSA 4I9QA 1YTFB 2RQ6A 3ETQA 5KX5B 1MMMA 3C3SA 1WP7A 2EIJB 4C7UA 2CTWA 2QEXV 4FJCC 1JJ2U 5KAFZ 2AHZA 1AI6A 4NXNB 1GM8A 1MA1A 3C3TA 3JD2A 1P7GA 1AI7A 2Q7GA 4G28B 4LR3A 2AGAA 3TETA 3HB3B 2PYLA 4QPJA 4MTFA 1IDSA 3ZHRA 3I56V 4Z1VA 5BY1A 5IY5B 3JSNA 1M56B 3ML0A 1K4CC 2PZSA 2XNDG 1LNQA 4X1YA 3ZS8C 4JI3B 4NVPA 4UV8A 1LR1A 3SJAC 5K1PA 4FFKA 2DQ0A 3F5WC 2ATKC 3B40A 3K5OA 1KD1W 4GUNA 3ABLB 1Q6HA 2HR3A 2X0LA 1XUQA 3AG4C 2WSSG 4YJ2B 2XTAA 1XREA 1BE3H 2F43G 3JASA 4Q20A 3IC7A 3G67A 2HLDG 5HFMA 5LGUA 5LGNA 1JPXA 1IBLB 1RM1B 4DR2B 3K5MA 4KHPB 2P6JA 2Q4PA 1I5XA 4I55A 2QSAA 4GZRB 1XNRO 5LBQA 1VQOV 3E22B 2YXYA 3WG7B 1YVWA 1GRJA 3PN1A 4E4EA 3OMAB 3FAVB 2FB5A 3A8TA 2XASA 1F4MA 1N0JA 4N21A 4IIJA 5KUMA 4OX9B 2N05A 2ZKOA 5GW7A 3W7WA 1FXHA 3K59A 1VQNV 3JARA 3LDCA 4ZHQB 1NVPB 3VQXA 1OCZC 3RYIA 4FFBA 1Q6UA 3HKEA 3U0ZA 4K35A 1KKCA 2D3OW 1U96A 4ZOLB 3UO3A 1IZ3A 3KCYA 4EB6B 5CB4B 1N8RW 4JI6O 1I0HA 4DV6B 4IYHA 2CH7A 3M8AA 4UUJC 2CTQA 1SZXA 3I5DA 2JDIG 4DUYO 1VEWA 1WJZA 2ODMA 4O4IA 3G4SV 5L3EA 1BQ0A 4K0KO 1HW7A 5DEDA 4O2AA 1OHHG 4TV8A 1FJGB 3MHSC 1HDJA 3G71V 1VQKV 1I94B 5GTHZ 2UXCO 3STLC 3G6BA 3FX7A 3LDEA 4GYCB 4X1YB 1FKAO 1ZX3A 4F6RA 1Q43A 4LWSA 3JYCA 5LMNB 2M7WA 4ZIBA 2JVDA 3K79A 1FD9A 4ASUG 3LSQA 4QE9A 3RVZA 5LHHA 3AG2C 3VQWA 2YXLA 4B3TB 2JIZG 4NXMO 5KMGA 1K34A 4X66B 2QR4A 4U3FH 2C2AA 4AILC 3THOA 2UXDO 1QU7A 4DRXA 1KBHA 4X64B 1MSWD 3JCZA 3W7TA 4I55B 4FPPA 3A2FA 3BY6A 3CHXA 5F2VO 4JTDB 2EINC 5CA1A 1HNWO 2ZR3A 1N4CA 2RNBA 4YIOA 2EIKB 4TWKA 5JQGA 2CAZC 3G80A 1YTFD 5L3CA 1Q90D 3RYIB 3HKEB 2JS3A 3OFNG 4G27B 3K04A 1S77D 3J80N 1PNLA 4U7NA 1U97A 4JI4O 3E8HA 2P90A 1OCRC 1NI8A 3K03A 4FIPC 1I08A 3OE7G 3J81N 3CC7V 3APQA 1LUVA 1AP5A 2CH7B 1MZEA 3P3NA 2CE4A 2HVJC 4X1KA 2OCHA 4X1IA 1JJOA 4R6ZA 4D7SA 4GKKB 1V54B 1ORQC 2Q5ZA 5LXTA 2NLJC 3FB7C 4LF9B 3BA9A 1P84F 2QWNB 4DV5O 1AJNA 4O2AB 2WA3A 1Y6XA 4IHJA 2V7QG 4TV8B 2Y69B 4J41A 1D5NA 1E1RG 1I5YA 3D3QA 1GM9A 3MAQA 4CS3A 1VARA 2VQEO 3UO2A 2QA4V 2QM8A 3SPIA 3DC5A 4F6RB 2UUBB 1WLEA 4FM0A 5JH7A 2XAQA 2QM7A 1GAXA 4PHZA 2JJ1G 1GN6A 4JI5B 3JATA 5JJNB 1SQXH 2VWKA 1VQLV 1GN4A 1RFYA 5KMGB 1B06A 2R9AA 1JOYA 4DO2A 1S5LZ 5IWAB 5J9PC 1M9NA 2EILC 3BHPA 4DR4B 2UU9O 3OGCC 1MNGA 2WLLA 2YUAA 4LF8O 5C93A 3HR0A 2IU3A 2L35A 1VQMV 4CBCA 4EEQA 1YEWA 4O4JA 5FL7G 3ABUA 2Q7EA 4YHHO 3OR6C 4L87A 4J80A 2EIMB 3OUFA 4DV7B 3QG5A 2NN4A 5CA1B 1QBZA 1XMQB 2KG7A 4MT8A 3ZMZA 1HR0O 1VQ8V 1AILA 1TVKB 5LYJA 1XNQO 5JQGB 4FM2A 2Q8VA 1WB7A 4Z1MG 1W0JG 1MSDA 1K5SA 1SC5B 5LHGA 2K1EA 2P06A 1NKDA 3BA8A 2N04A 2XHBA 1K97A 3WFVA 1HWYA 1EM1A 4ICGA 4I50A 3G6EV 1ZL8B 2K9PA 2XT9A 2HHHB 1SS3A 4UCTA 4X8AA 3AG1B 4DK0A 1WP8A 1NZ6A 3ABKB 3HKDA 1GKFA 2X6AA 4X1KB 3OMNB 4J7JA 4X1IB 2YS8A 4CC6A 1SESA 2P7TC 2QKCA 1A32A 5LXTB 1XMOO 4DV3O 1M5IA 4GKJB 4QJFB 4X62B 3SYOA 5B1BB 4FLUA 4UCVA 4DV2B 2BSKA 3N2GA 4IHJB 2A06H 3TK1A 3FB6C 4WF9V 4D6TH 3OW2U 2P22C 4JGSA 4OGQB 3RWRD 4WFGA 1PNKA 4LF7O 4JI2B 1SQPH 1PP9H 3JSLA 5JH7B 3EXAA 5KX5A 4TQDA 3R65A 1DF4A 2Y48A 3JATB 4WCEV 1G4YB 4LF4B 4QNHB 3K5NA 4MSWC 2KSDA 2AXTZ 3BCCH 3NXSA 3UKMA 4WFEA 1M1KW 3JAKA 3CCLV 3SR2C 4BIOA 4I4TA 4AQYO 3OM3B 4UVBA 3JD3A 1QVGU 3ASNC 1RP3B 1VP7A 1IBKO 2EJRA 1VQ4V 5DM6V 1IBMB 2RJZA 4LF6B 4YIPA 4WFFA 1XHXA 2Y4TA 1N34B 2DQ3A 2ZE8A 1QHTA 3A0HZ 4XDLA 4O4JB 3OEHG 4K8ZA 3T4ZA 2PY5A 3L9DA 4EFBA 1NT2B 3KG2A 2KG7B 3FYIB 2OCCB 4X88A 5LYJB 1B3QA 3OT7A 3B4SA 5KAIZ 2P4KA 1Q8IA 5KUKA 1Y66A 4FLTA 1L0LH 1N36B 3CB2A 4I50B 5L3GA 1M90W 2JGUA 4BW9A 4YY3B 4DR7O 2PYJA 2A9HA 3FAVA 2DYSC 1YITV 5JJEB 2YI9A 3DGEA 4I7ZB 2GTSA 2YIAA 2E5LB 3L70H 3F7VC 2GUZB 4ZHQA 1FPOA 1Y4MA 2OIEA 1Y74A 1IX9A 2LW1A 2BSKB 2IJIA 2NR5A 3N2GB 3ZMVA 4DV0B 4P2ZA 4DV4O 3AG4B 3IGAC 2QWRB 1J5EO 5CB4A 2H94A 3UCSC 3KZIZ 4DR4O 1OCOC 3D36C 4LF5O 1SKVA 1AJQA 3ZIAG 3U11A 3UM7A 1SERA 4CS2A 1BSMA 4UXNA 5LHIA 2IBZH 2RN9A 2QKSA 5EK0A 5LA6A 5DN6G 3K0DA 4DR5B 4OXSA 3QO5A 3ZMUA 4UB6Z 3JAKB 3LSUA 1F4NA 1WNSA 5EIBC 5L3BA 1TAEA 4I4TB 3CXHF 3QF7A 4H37A 5E79Z 1FFTB 4XDKA 1NQTA 1GN2A 4Q6GA 1YI2V 5D5QA 1R3IC 1H2LA 2JEUA 2N74A 2PI5A 4FLZA 4ZI7A 1OCZB 1TA8A 3N2KA 3CMAV 3OUSA 1EN5A 4JASA 1HNZB 1KB9F 2P5OA 4W4KA 1BCCH 2HHHO 1AR4A 3KKYA 3CC2V 2ZD9A 3T4DA 4JI7O 2EULA 1YJNV 2F95B 3SYAA 1QVFU 3AK1A 5JCOA 3T1YO 2LQTA 1COWG 2UXBB 3ZHUA 3KCXA 3AK3A 4HZ3A 3RYHA 5J2UA 3SPGA 1T5EA 2ZE6A 1QR8A 2E75B 3Q4HA 5FPOA 2R72A 5FNVA 3ZX6A 5BXZA 2ZINA 1R6TA 2QGNA 5EBWC 3CXCU 5H2FZ 4BIUA 1N0NA 3JD4A 2Q73A 4JI8B 3T1HB 4DR6B 3OMIB 2FMLA 1QR9A 3ZRSA 3P3PA 3U10A 2IM9A 1KC8W 2YEVA 1TUEB 1S76D 4JI1B 1Y74B 3CRAA 4CZZA 3GVMA 3CC4V 4WFBV 4KFMA 3ZRWB 5IYDO 2PTMA 3JD0A 3AG2B 4RUEA 3HKCA 4LFAB 2WLHA 1S5HC 2HJFC 3QVNA 2GTAA 5D5PA 2KQXA 1W2BU 1E79G 4JV5O 1XL4A 3L71H 3EHBB 1L0NH 4F6EA 3RGBA 4DV1B 2LJ2A 1ZAUA 3ABLC 4DR1B 5LA6B 2LFRA 5B5EZ 2A0LA 2RMKB 1OCCC 4HNAA 2DOSA 4JYAO 3B8MA 2ZT9B 1JR9A 4FZ1A 1NH2B 2VQFO 3LNMB 1K73W 1SQFA 2EINB 5IT9N 1XEQA 5FLXN 5BR8B 1AR1B 4NKGB 2X7RB 2EBOA 3B2EE 4IYIA 2QWOB 4HYOA 4B3SO 2WLNA 4KXRA 3CCQV 3RYFA 3P32A 2JJ2G 4ZI7B 3IAYA 2F4VO 3GB7C 3N2KB 1ZSPA 2CK3G 5J2TA 2Q67A 4DR3B 1VMGA 3JD1A 4PJ0Z 4B3MB 1HNXO 5B1NA 1PNMA 1OCRB 4KP4A 2MK3A 3SGIA 3OTOO 1YSCA 2GDSA 2ZM6O 3HKBA 3TXSA 5BMVB 1FXKC 4KL1A 2ARHA 4MW8A 1W0KG 4TV9A 4LFCB 5CMUA 2ADPA 1PL4A 4QIWF 4PA4A 1SA0A 1W59A 2Q7HA 5KHKA 3DTUB 1NBMG 3RYHB 5J2UB 3RYCB 1SRYA 3JAWA 3Q4HB 1DGSA 5GONA 1S72V 4TOIA 2UUCO 1Y67A 5FNVB 1DTOA 1DK1A 2Z3YA 1H2NA 3M99B 1TVKA 1TGOA 4X65B 3E8FA 1FAFA 1EZVH 2ADQB 1SF9A 3SPJA 2YEVB 1UJWB 4J10A 3UQ8A 4JYYA 3ZRXA 4NXNO 5KHGA 5EYPA 3VQYA 3CCRV 3O9OA 2WWWA 1H2MA 3H01A 3K3WA 4OPHA 1JCHA 3CE2A 3HKCB 2E76B 1ZL8A 2P67A 2LFSA 1F23A 4J7KA 2YIBA 2ZE7A 4IGGA 4MTXA 1P49A 4JI3O 3M7MX 2LP7A 2OTJV 1X59A 3CCMV 4HNAB 2XAHA 3CEIA 3FFQA 4CH4A 4X9QA 2AHYA 3OD4A 3STZC 1J95A 4EKWA 4XDJA 4P9PA 5H6QA 1KKDA 4R7CA 4YXWG 3WB0A 4JI0B 4RQEA 2EZOA 3JCUZ 4DW1A 4B08A 1RPOA 4DYLA 3NR7A 1AB3A 1WPBA 2IJJA 3JALA 1WAZA 3EVKA 4I5SA 5TISZ 3RYFB 1IBLO 1K9MW 4DR2O 4KHPO 1P4RA 5J2TB 3H1KH 4NTXA 4NR1A 3OGIB 4MS2A 5DECA 2QJ1A 4MTGA 5LMUB 4J9YB 4AI8A 1WN7A 3ZHTA 4MTOA 1US6A 1F7YA 1TUBB 2UUAB 4OX9O 1ZWIC 2WLIA 3HKBB 4PELA 4MVQA 4UV9A 4JI8O 1EN4A 4TV9B 3K57A 1MG1A 3O65A 5KHIA 1N33B 1O9HA 1IURA 5LP6C 4PA9A 2Q68A 1SA0B 1R3KC 5KHJA 1K8AW 1PV0A 1S5JA 1NVPD 3UT5A 4MVZA 3BAAA 1XBLA 2ZDIA 3RN4A 3JAWB 1KECA 2UXNA 1BQZA 1NU1H 4LFAO 2DW4A 5GONB 3OAAG 4A5UB 4DV6O 1UPGA 2NNUA 1VF6A 1AI4A 2RDCA 1XILA 4WFHA 3A0RA 4J42A 2WAMA 2ZE5A 1MABG 1M57C 4B7KA 2DWDC 1SQGA 1YXBA 2ZQMA 5EYPB 2AW9A 3TXQA 3CD6V 2Q0OC 1EZJA 3OTFA 2XAGA 2BOBC 3ABMB 1NR1A 1YIJV 1FXVA 3E8GA 1FJGO 4TUYA 5KA5A 2OIGA 1I94O 5IJ9A 1AR5A 1NH2D 2CGOA 2HG5C 2QWPB 4R50A 1JFFA 3ASNB 5LMNO 4MW3A 2VRZA 4CC5A 2ILMA 3R66A 2GUZA 1BT8A 4UCRA 3E89A 3ZCCA 3ETDA 4MVSA 3E35A 1THZA 4B3TO 3L73H 1KQSU 1R6NA 4PI0A 1MZFA 4PD4F 3DC6A 3E86A 1VIBA 1NJIW 4X66O 1YF2A 4Z2WA 2JK5C 3SYPA 4X20A 3IFXA 2PI4A 1FFXA 4JZGA 3JALB 1Y76A 3CRRA 4H33A 4PDLA 1URFA 1VQ6V 2DYRC 4X89A 4X64O 3E83A 1X4TA 3MD0A 1XNRB 4K3AA 1XDCA 2BTQA 3WB2A 2PF4E 2ZIOA 4DUZB 5CBFA 2EZPA 2WLIB 3TGUH 2WA4A 2DYSB 4FK5C 3AK2A 1H38A 2JRIA 5EC1C 3H1LH 2IU0A 4QGPA 2DE0X 3UT5B 5IYCO 1PL0A 3ASOC 3ZJZA 4GX0A 2MW2B 2R9RB 4P9OA 2X6CA 1YCIA 3ZMSA 1V55C 1NR7A 4JI6B 1B04A 1M4UA 4R8CA 2CTRA 2DMXA 2W0FC 5ITZB 5CN0A 1QLEC 1OCOB 4GKKO 1H8EG 2IH1C 4O4LA 2OT5A 3K06A 5B1AC 4LF9O 4K0KB 2XOKG 1ZTEA 3AG3C 3ZMTA 4CH6A 4TUYB 3QTCA 1K5QA 5IJ9B 3D3IA 1DLBA 2UXCB 4RQFA 4RWUA 3T2MA 2R9IA 4ZKIA 4GX2A 1IXMA 1N32B 5GTIZ 2UUBO 1JFFB 5IYBO 4JI5O 4UCSA 3B09A 5FPRA 2V1DA 5KA6A 1SQVH 2Y0IA 2G38A 3ZRWA 4NXMB 1SQBH 2F23A 4UVCA 5CBHA 3SYQA 5IWAO 3LNNA 4LNUA 1BMFG 4FLWA 1XI1A 3CP1A 5CBGA 2JS5A 4X20B 4UFZA 1FXKA 3MDSA 4BAYA 1FFXB 2H3OA 1JX9A 4FLYA 5H9CA 2UXDB 4J11A 2OWOA 1Y76B 1K4DC 1GM7A 4JAAA 2EJ7A 3BPZA 3ZHVA 3CCSV 3D8CA 2FTKA 2BTQB 1CXZB 4B3RB 2ZXWC 3JAMN 1RSOA 2F1MA 1D2DA 2YSUB 2QTOA 4JTAB 1PD3A 4DV7O 1XMQO 1SQQH 1L1FA 3K5LA 1GK9A 3CCUV 4JYCA 2ZCEA 2A79B 4JAVA 1BS3A 3SJCC 1GMGA 3WB1A 1M93A 4FZ0A 4JI4B 2HVKC 4I9WA 1VQPV 1Q6IA 1H2KA 3RT3C 4WFAV 1AROP 2FKXA 2PUSA 4UCOA 3S3WA 3X2QC 1H2GA 4FLXA 2YIBD 2A3QA 2BE3A 1VF7A 5BMVA 4MVOA 3RBZA 2A7WA 4O4LB 2QE7G 5B3SC 3SPCA 3VBBA 1R3LC 4GKJO 2Z5UA 3P30A 4X62O 4DV5B 4PV1B 1P7BA 4JF3A 3RVYA 4DV2O 4L8JA 3RYCA 1KMIZ 4PA7A 1OCCB 2LW7A 1I7FA 5C8YA 2VQEB 4PDVA 4UB8Z 3CCEV 5HFLA 2EIJC 4JI2O 3CPWU 1G6UA 1FS0G 2IJHA 3FD9A 5H5NA 2ZNJA 3ETGA 1D5AA 1CP9A 3L74H 4LF4O 2B1IA 3OR7C 1R1BA 3N27A 5LGTA 4BR6A 4XBFA 4DUZO 3LSSA 2B1GA 2Q69A 1AI5A 5IY5C 4H13B 5EC2C 3ZHQA 1M56C 4BWAA 3CS5A 3RFRA 2AZ2A 4LNUB 1EBOA 3GWOA 3BFRA 4GLXA 2UU9B 1R73A 1K3EA 2JGDA 1FXKB 2OTLV 4LF8B 1IBMO 5CA0A 4W4LA 4LF6O 2Q9LA 1JMKC 3K08A 3QO7A 5LP6A 1N34O 2PGGA 3H1JH 3FB8C 4YHHB 1RSOB 3CRQA 1Q86W 1K33A 2DWEC 3EFFK 1Q82W 1HR0B 3E8BA 2WLKA 1V9PA 4TT3G 1XNQB 2QKAA 1RM1C 1CPYA 5B1OA 2V4DA 4LP8A 2YIDA 1JA8A 3E2EA 4B7EA 4HBNA 3WG7C 1XL6A 4GT1A 1N36O 1LUWA 3OEEG 1QQCA 2WLMA 3BVOA 3DXRA 4CS4A 4RO2A 4YY3O 4YJ3A 3CYOA 1BHBA 1OV9A 4JAUA 3LDDA 2YC0A 1TUBA 2AZ0A 1N32O 1Q3EA 3CX5F 5EIBD 2E5LO 1WB8A 4RUFA 1XMOB 4DV3B 1GTOA 5H6RA 5JWPA 3WU2Z 3PJSK 4GCZA 3CMEV 2OYQA 5LOVA 1MOFA 1AJPA 2IJKA 1KUQA 3CWBH 2VS0A 2RCVA 4UCUA 2W6JG 1NS1A 4LBEC 3JASB 3SJBC 1FYJA 4DV0O 4O2BA 4UVAA 2O57A 5C8YB 1AP6A 1OZ0A 4LF7B 2IH3C 3T1CA 5IE9A 2Y4UA 4ABMA 4QE7A 4RAIA 1HP8A 4IT5A 1NTKH 1VQ7V 2XAJA 3CCJV 2L6LA 5IJ0A 3J7AU 4NTWA 4DR5O 1XHZA 4B3RO 2DJVA 4IIJB 2LGQA 1ENVA 4NB5A 4AQYB 4CH3A 3H9VA 1PM9A 2EX3A 3IC9A 3JARB 2Z0AA 2XAFA 1VF5B 5KHHA 2JGDB 3ETEA 4FFBB 1IBKB 4DW0A 4DXWA 2EILB 2ZIMA 5CA0B 5L3DA 3CCVV 4MVMA 5LP6B 1BL8A 3F7YC 5BZBA 1HNZO 1EN6A 3SJQC 3ICXA 4FM1A 3DSQA 4LFBB 5JCOC 1NTZH 1YJ9V 2LO1A 2X6BA 2F93B 4JZ2A 4O4IB 3F5TA 5A9GA 1QLNA 2UXBO 2Y0PA 4GX1A 1PPJH 2P4VA 1BGYH 4FVMA 1M57B 1QNMA 1K92A 2YI8A 3DXRB 1KU9A 4DR7B 3SPHA 4YJ3B 1XOUA 2EIKC 2DN9A 3W7XA 4JYBA 3LUTB 4LWSB 3K58A 3CRMA 3T1HO 4PDMA 4DR6O 5CA3A 1YJWV 4J9ZB 4P30A 2QM4A 4I0XA 1UFIA 1IXBA 4JI1O 2YICA 5LOVB 3C90A 2VWJA 3K9SA 4TQFA 3W7UA 5EZYA 4DV4B 1H8HG 4O2BB 1J5EB 1GN3A 1DF5A 4LF5B 1OJHA 2HFEC 1V54C 2YXHA 3GWKC 4E2LA 4KUMA 2CUGA 3I55V 4DRXB 3B77A 5ITZA 1F51A 4DV1O 3D36A 1ZUQA 5IYZA 3A0BZ 2IW5A 3APOA 4DR1O 5IJ0B 2XUMA 1SETA 3ZN0A 1GO3F 4H44B 2B9ZA 2H8PC 2Y69C 1NTMH 5EBMC 4OPAA 2DYRB 3ZEDA 1G1XB 2HP8A 1Q7YW 1S0VA 5JJJB 3FKSG 1Z5WA 2HJDA 4WBNA 2CDYA 5LL6Y 2E74B 4GX5A 2ITCC 3RW0A 4FMTA 2QDOA 1L8DA 5BR8O 2GSMB 1VQ9V 2BCCH 5AG2A 1KYOF 3L72H 1WA8A 1Z2GA 4JTCB 4DR3O 4B3MO 2QWQB 4PI2A 3ASOB 3L75H 1YHQV 4PA3A 4NTYA 1H2SB 3ZHSA 5K1XA 5E1AC 4JI7B 1ROPA 3K0GA 1V55B 3CJHA 2CGNA 4LFCO 4O4HA 2M6YA 3T1YB 3AEIA 3ZRVA 1JVMA 1O9GA 1YZBA 2WLJA 4NYKA 1QLEB 3VQVA 2F66C 4LH6A 3CRCA 4U3JA 1PKXA 5B1AB 3ZN1A 3H1IH 1E1QG 1YDXA 2EIMC 1K7DA 4JPRA 2HKOA 3VOUA 2R70A 4N23A 3AG3B 5JVDA 2ZR2A 4J7ZA 4LH7A 4X65O 1Q5OA 1Q81W 4F4LA 4IL6Z 1Z5VA 4BW5A 1VQ5V 4ZBMA 2GV9A 2W0XA 1JQ0A 4I0XB 3ABMC 2LGWA 3ABTA 2FL4A 3FB5C 3BRCA 5L3FA 2KKWA 3AG1C 1B6QA 4LCUC 5EZYB 2UXXA 1ZLZA 3ABKC 1G8MA 3CSXA 3IJ4A 1RPRA
chains in the Genus database with same CATH topology
3DXRB 3DXRA 3CJHB 2BSKB 3CJHA 2BSKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXR B;  3DXR A;  3CJH B;  2BSK B;  3CJH A;  2BSK A; 
#chains in the Genus database with same CATH topology
 2WPD G;  2JEX A;  2WLL B;  2ETN A;  2BTO A;  2KB1 A;  4JV5 B;  1XQ8 A;  5A2Q N;  3K9A A;  4AHC A;  4PDR A;  2D2C B;  1S3J A;  4EFE A;  1BZK A;  5B1B C;  5IYZ B;  4DUY B;  3ZBH A;  5KLV H;  2GHY A;  2ITD C;  5EBL C;  3TCU A;  3SDL A;  4FLV A;  1R3J C;  4JYA B;  3BAB A;  5IDJ A;  1WPX A;  4MVU A;  4YJ2 A;  4LFB O;  2ZXW B;  2B5U A;  3QO8 A;  4TSF G;  2VQF B;  2FYU H;  4WBN B;  1BHA A;  2W6I G;  4JI0 O;  1AVM A;  3B8N A;  4B3S B;  4PA6 A;  3FYE B;  4QPK A;  3MHH C;  4D7T A;  1SZT A;  2CTP A;  2F4V B;  2HEP A;  1WA8 B;  1GH6 A;  2ZNI A;  1HNX B;  3E22 A;  5B66 Z;  1CEZ A;  4DK1 A;  4BIZ A;  1QCE A;  1KP3 A;  3OTO B;  5LMU O;  2YDE A;  4CH5 A;  3SYC A;  2ZM6 B;  3HKD B;  4MVR A;  2UUA O;  4G2K A;  4U7O A;  1KP2 A;  3CJH B;  3X2Q B;  3W7S A;  2QTS A;  4O4H B;  1EFR G;  3S3X A;  4K8X A;  1N33 O;  2BOC C;  4HAM A;  3BEH A;  2ZDI C;  2GBO A;  2E3C A;  4U3J B;  5B3S B;  4LC1 A;  1R6K A;  4ZOL A;  3HPL C;  3H1H H;  4EB6 A;  1VF6 C;  4H0L B;  2OCC C;  3TJT A;  3AG7 A;  2UUC B;  2Q6A A;  5JVD B;  3QNE A;  1HNW B;  2Q0A A;  1IVS A;  4I9Q A;  1YTF B;  2RQ6 A;  3ETQ A;  5KX5 B;  1MMM A;  3C3S A;  1WP7 A;  2EIJ B;  4C7U A;  2CTW A;  2QEX V;  4FJC C;  1JJ2 U;  5KAF Z;  2AHZ A;  1AI6 A;  4NXN B;  1GM8 A;  1MA1 A;  3C3T A;  3JD2 A;  1P7G A;  1AI7 A;  2Q7G A;  4G28 B;  4LR3 A;  2AGA A;  3TET A;  3HB3 B;  2PYL A;  4QPJ A;  4MTF A;  1IDS A;  3ZHR A;  3I56 V;  4Z1V A;  5BY1 A;  5IY5 B;  3JSN A;  1M56 B;  3ML0 A;  1K4C C;  2PZS A;  2XND G;  1LNQ A;  4X1Y A;  3ZS8 C;  4JI3 B;  4NVP A;  4UV8 A;  1LR1 A;  3SJA C;  5K1P A;  4FFK A;  2DQ0 A;  3F5W C;  2ATK C;  3B40 A;  3K5O A;  1KD1 W;  4GUN A;  3ABL B;  1Q6H A;  2HR3 A;  2X0L A;  1XUQ A;  3AG4 C;  2WSS G;  4YJ2 B;  2XTA A;  1XRE A;  1BE3 H;  2F43 G;  3JAS A;  4Q20 A;  3IC7 A;  3G67 A;  2HLD G;  5HFM A;  5LGU A;  5LGN A;  1JPX A;  1IBL B;  1RM1 B;  4DR2 B;  3K5M A;  4KHP B;  2P6J A;  2Q4P A;  1I5X A;  4I55 A;  2QSA A;  4GZR B;  1XNR O;  5LBQ A;  1VQO V;  3E22 B;  2YXY A;  3WG7 B;  1YVW A;  1GRJ A;  3PN1 A;  4E4E A;  3OMA B;  3FAV B;  2FB5 A;  3A8T A;  2XAS A;  1F4M A;  1N0J A;  4N21 A;  4IIJ A;  5KUM A;  4OX9 B;  2N05 A;  2ZKO A;  5GW7 A;  3W7W A;  1FXH A;  3K59 A;  1VQN V;  3JAR A;  3LDC A;  4ZHQ B;  1NVP B;  3VQX A;  1OCZ C;  3RYI A;  4FFB A;  1Q6U A;  3HKE A;  3U0Z A;  4K35 A;  1KKC A;  2D3O W;  1U96 A;  4ZOL B;  3UO3 A;  1IZ3 A;  3KCY A;  4EB6 B;  5CB4 B;  1N8R W;  4JI6 O;  1I0H A;  4DV6 B;  4IYH A;  2CH7 A;  3M8A A;  4UUJ C;  2CTQ A;  1SZX A;  3I5D A;  2JDI G;  4DUY O;  1VEW A;  1WJZ A;  2ODM A;  4O4I A;  3G4S V;  5L3E A;  1BQ0 A;  4K0K O;  1HW7 A;  5DED A;  4O2A A;  1OHH G;  4TV8 A;  1FJG B;  3MHS C;  1HDJ A;  3G71 V;  1VQK V;  1I94 B;  5GTH Z;  2UXC O;  3STL C;  3G6B A;  3FX7 A;  3LDE A;  4GYC B;  4X1Y B;  1FKA O;  1ZX3 A;  4F6R A;  1Q43 A;  4LWS A;  3JYC A;  5LMN B;  2M7W A;  4ZIB A;  2JVD A;  3K79 A;  1FD9 A;  4ASU G;  3LSQ A;  4QE9 A;  3RVZ A;  5LHH A;  3AG2 C;  3VQW A;  2YXL A;  4B3T B;  2JIZ G;  4NXM O;  5KMG A;  1K34 A;  4X66 B;  2QR4 A;  4U3F H;  2C2A A;  4AIL C;  3THO A;  2UXD O;  1QU7 A;  4DRX A;  1KBH A;  4X64 B;  1MSW D;  3JCZ A;  3W7T A;  4I55 B;  4FPP A;  3A2F A;  3BY6 A;  3CHX A;  5F2V O;  4JTD B;  2EIN C;  5CA1 A;  1HNW O;  2ZR3 A;  1N4C A;  2RNB A;  4YIO A;  2EIK B;  4TWK A;  5JQG A;  2CAZ C;  3G80 A;  1YTF D;  5L3C A;  1Q90 D;  3RYI B;  3HKE B;  2JS3 A;  3OFN G;  4G27 B;  3K04 A;  1S77 D;  3J80 N;  1PNL A;  4U7N A;  1U97 A;  4JI4 O;  3E8H A;  2P90 A;  1OCR C;  1NI8 A;  3K03 A;  4FIP C;  1I08 A;  3OE7 G;  3J81 N;  3CC7 V;  3APQ A;  1LUV A;  1AP5 A;  2CH7 B;  1MZE A;  3P3N A;  2CE4 A;  2HVJ C;  4X1K A;  2OCH A;  4X1I A;  1JJO A;  4R6Z A;  4D7S A;  4GKK B;  1V54 B;  1ORQ C;  2Q5Z A;  5LXT A;  2NLJ C;  3FB7 C;  4LF9 B;  3BA9 A;  1P84 F;  2QWN B;  4DV5 O;  1AJN A;  4O2A B;  2WA3 A;  1Y6X A;  4IHJ A;  2V7Q G;  4TV8 B;  2Y69 B;  4J41 A;  1D5N A;  1E1R G;  1I5Y A;  3D3Q A;  1GM9 A;  3MAQ A;  4CS3 A;  1VAR A;  2VQE O;  3UO2 A;  2QA4 V;  2QM8 A;  3SPI A;  3DC5 A;  4F6R B;  2UUB B;  1WLE A;  4FM0 A;  5JH7 A;  2XAQ A;  2QM7 A;  1GAX A;  4PHZ A;  2JJ1 G;  1GN6 A;  4JI5 B;  3JAT A;  5JJN B;  1SQX H;  2VWK A;  1VQL V;  1GN4 A;  1RFY A;  5KMG B;  1B06 A;  2R9A A;  1JOY A;  4DO2 A;  1S5L Z;  5IWA B;  5J9P C;  1M9N A;  2EIL C;  3BHP A;  4DR4 B;  2UU9 O;  3OGC C;  1MNG A;  2WLL A;  2YUA A;  4LF8 O;  5C93 A;  3HR0 A;  2IU3 A;  2L35 A;  1VQM V;  4CBC A;  4EEQ A;  1YEW A;  4O4J A;  5FL7 G;  3ABU A;  2Q7E A;  4YHH O;  3OR6 C;  4L87 A;  4J80 A;  2EIM B;  3OUF A;  4DV7 B;  3QG5 A;  2NN4 A;  5CA1 B;  1QBZ A;  1XMQ B;  2KG7 A;  4MT8 A;  3ZMZ A;  1HR0 O;  1VQ8 V;  1AIL A;  1TVK B;  5LYJ A;  1XNQ O;  5JQG B;  4FM2 A;  2Q8V A;  1WB7 A;  4Z1M G;  1W0J G;  1MSD A;  1K5S A;  1SC5 B;  5LHG A;  2K1E A;  2P06 A;  1NKD A;  3BA8 A;  2N04 A;  2XHB A;  1K97 A;  3WFV A;  1HWY A;  1EM1 A;  4ICG A;  4I50 A;  3G6E V;  1ZL8 B;  2K9P A;  2XT9 A;  2HHH B;  1SS3 A;  4UCT A;  4X8A A;  3AG1 B;  4DK0 A;  1WP8 A;  1NZ6 A;  3ABK B;  3HKD A;  1GKF A;  2X6A A;  4X1K B;  3OMN B;  4J7J A;  4X1I B;  2YS8 A;  4CC6 A;  1SES A;  2P7T C;  2QKC A;  1A32 A;  5LXT B;  1XMO O;  4DV3 O;  1M5I A;  4GKJ B;  4QJF B;  4X62 B;  3SYO A;  5B1B B;  4FLU A;  4UCV A;  4DV2 B;  2BSK A;  3N2G A;  4IHJ B;  2A06 H;  3TK1 A;  3FB6 C;  4WF9 V;  4D6T H;  3OW2 U;  2P22 C;  4JGS A;  4OGQ B;  3RWR D;  4WFG A;  1PNK A;  4LF7 O;  4JI2 B;  1SQP H;  1PP9 H;  3JSL A;  5JH7 B;  3EXA A;  5KX5 A;  4TQD A;  3R65 A;  1DF4 A;  2Y48 A;  3JAT B;  4WCE V;  1G4Y B;  4LF4 B;  4QNH B;  3K5N A;  4MSW C;  2KSD A;  2AXT Z;  3BCC H;  3NXS A;  3UKM A;  4WFE A;  1M1K W;  3JAK A;  3CCL V;  3SR2 C;  4BIO A;  4I4T A;  4AQY O;  3OM3 B;  4UVB A;  3JD3 A;  1QVG U;  3ASN C;  1RP3 B;  1VP7 A;  1IBK O;  2EJR A;  1VQ4 V;  5DM6 V;  1IBM B;  2RJZ A;  4LF6 B;  4YIP A;  4WFF A;  1XHX A;  2Y4T A;  1N34 B;  2DQ3 A;  2ZE8 A;  1QHT A;  3A0H Z;  4XDL A;  4O4J B;  3OEH G;  4K8Z A;  3T4Z A;  2PY5 A;  3L9D A;  4EFB A;  1NT2 B;  3KG2 A;  2KG7 B;  3FYI B;  2OCC B;  4X88 A;  5LYJ B;  1B3Q A;  3OT7 A;  3B4S A;  5KAI Z;  2P4K A;  1Q8I A;  5KUK A;  1Y66 A;  4FLT A;  1L0L H;  1N36 B;  3CB2 A;  4I50 B;  5L3G A;  1M90 W;  2JGU A;  4BW9 A;  4YY3 B;  4DR7 O;  2PYJ A;  2A9H A;  3FAV A;  2DYS C;  1YIT V;  5JJE B;  2YI9 A;  3DGE A;  4I7Z B;  2GTS A;  2YIA A;  2E5L B;  3L70 H;  3F7V C;  2GUZ B;  4ZHQ A;  1FPO A;  1Y4M A;  2OIE A;  1Y74 A;  1IX9 A;  2LW1 A;  2BSK B;  2IJI A;  2NR5 A;  3N2G B;  3ZMV A;  4DV0 B;  4P2Z A;  4DV4 O;  3AG4 B;  3IGA C;  2QWR B;  1J5E O;  5CB4 A;  2H94 A;  3UCS C;  3KZI Z;  4DR4 O;  1OCO C;  3D36 C;  4LF5 O;  1SKV A;  1AJQ A;  3ZIA G;  3U11 A;  3UM7 A;  1SER A;  4CS2 A;  1BSM A;  4UXN A;  5LHI A;  2IBZ H;  2RN9 A;  2QKS A;  5EK0 A;  5LA6 A;  5DN6 G;  3K0D A;  4DR5 B;  4OXS A;  3QO5 A;  3ZMU A;  4UB6 Z;  3JAK B;  3LSU A;  1F4N A;  1WNS A;  5EIB C;  5L3B A;  1TAE A;  4I4T B;  3CXH F;  3QF7 A;  4H37 A;  5E79 Z;  1FFT B;  4XDK A;  1NQT A;  1GN2 A;  4Q6G A;  1YI2 V;  5D5Q A;  1R3I C;  1H2L A;  2JEU A;  2N74 A;  2PI5 A;  4FLZ A;  4ZI7 A;  1OCZ B;  1TA8 A;  3N2K A;  3CMA V;  3OUS A;  1EN5 A;  4JAS A;  1HNZ B;  1KB9 F;  2P5O A;  4W4K A;  1BCC H;  2HHH O;  1AR4 A;  3KKY A;  3CC2 V;  2ZD9 A;  3T4D A;  4JI7 O;  2EUL A;  1YJN V;  2F95 B;  3SYA A;  1QVF U;  3AK1 A;  5JCO A;  3T1Y O;  2LQT A;  1COW G;  2UXB B;  3ZHU A;  3KCX A;  3AK3 A;  4HZ3 A;  3RYH A;  5J2U A;  3SPG A;  1T5E A;  2ZE6 A;  1QR8 A;  2E75 B;  3Q4H A;  5FPO A;  2R72 A;  5FNV A;  3ZX6 A;  5BXZ A;  2ZIN A;  1R6T A;  2QGN A;  5EBW C;  3CXC U;  5H2F Z;  4BIU A;  1N0N A;  3JD4 A;  2Q73 A;  4JI8 B;  3T1H B;  4DR6 B;  3OMI B;  2FML A;  1QR9 A;  3ZRS A;  3P3P A;  3U10 A;  2IM9 A;  1KC8 W;  2YEV A;  1TUE B;  1S76 D;  4JI1 B;  1Y74 B;  3CRA A;  4CZZ A;  3GVM A;  3CC4 V;  4WFB V;  4KFM A;  3ZRW B;  5IYD O;  2PTM A;  3JD0 A;  3AG2 B;  4RUE A;  3HKC A;  4LFA B;  2WLH A;  1S5H C;  2HJF C;  3QVN A;  2GTA A;  5D5P A;  2KQX A;  1W2B U;  1E79 G;  4JV5 O;  1XL4 A;  3L71 H;  3EHB B;  1L0N H;  4F6E A;  3RGB A;  4DV1 B;  2LJ2 A;  1ZAU A;  3ABL C;  4DR1 B;  5LA6 B;  2LFR A;  5B5E Z;  2A0L A;  2RMK B;  1OCC C;  4HNA A;  2DOS A;  4JYA O;  3B8M A;  2ZT9 B;  1JR9 A;  4FZ1 A;  1NH2 B;  2VQF O;  3LNM B;  1K73 W;  1SQF A;  2EIN B;  5IT9 N;  1XEQ A;  5FLX N;  5BR8 B;  1AR1 B;  4NKG B;  2X7R B;  2EBO A;  3B2E E;  4IYI A;  2QWO B;  4HYO A;  4B3S O;  2WLN A;  4KXR A;  3CCQ V;  3RYF A;  3P32 A;  2JJ2 G;  4ZI7 B;  3IAY A;  2F4V O;  3GB7 C;  3N2K B;  1ZSP A;  2CK3 G;  5J2T A;  2Q67 A;  4DR3 B;  1VMG A;  3JD1 A;  4PJ0 Z;  4B3M B;  1HNX O;  5B1N A;  1PNM A;  1OCR B;  4KP4 A;  2MK3 A;  3SGI A;  3OTO O;  1YSC A;  2GDS A;  2ZM6 O;  3HKB A;  3TXS A;  5BMV B;  1FXK C;  4KL1 A;  2ARH A;  4MW8 A;  1W0K G;  4TV9 A;  4LFC B;  5CMU A;  2ADP A;  1PL4 A;  4QIW F;  4PA4 A;  1SA0 A;  1W59 A;  2Q7H A;  5KHK A;  3DTU B;  1NBM G;  3RYH B;  5J2U B;  3RYC B;  1SRY A;  3JAW A;  3Q4H B;  1DGS A;  5GON A;  1S72 V;  4TOI A;  2UUC O;  1Y67 A;  5FNV B;  1DTO A;  1DK1 A;  2Z3Y A;  1H2N A;  3M99 B;  1TVK A;  1TGO A;  4X65 B;  3E8F A;  1FAF A;  1EZV H;  2ADQ B;  1SF9 A;  3SPJ A;  2YEV B;  1UJW B;  4J10 A;  3UQ8 A;  4JYY A;  3ZRX A;  4NXN O;  5KHG A;  5EYP A;  3VQY A;  3CCR V;  3O9O A;  2WWW A;  1H2M A;  3H01 A;  3K3W A;  4OPH A;  1JCH A;  3CE2 A;  3HKC B;  2E76 B;  1ZL8 A;  2P67 A;  2LFS A;  1F23 A;  4J7K A;  2YIB A;  2ZE7 A;  4IGG A;  4MTX A;  1P49 A;  4JI3 O;  3M7M X;  2LP7 A;  2OTJ V;  1X59 A;  3CCM V;  4HNA B;  2XAH A;  3CEI A;  3FFQ A;  4CH4 A;  4X9Q A;  2AHY A;  3OD4 A;  3STZ C;  1J95 A;  4EKW A;  4XDJ A;  4P9P A;  5H6Q A;  1KKD A;  4R7C A;  4YXW G;  3WB0 A;  4JI0 B;  4RQE A;  2EZO A;  3JCU Z;  4DW1 A;  4B08 A;  1RPO A;  4DYL A;  3NR7 A;  1AB3 A;  1WPB A;  2IJJ A;  3JAL A;  1WAZ A;  3EVK A;  4I5S A;  5TIS Z;  3RYF B;  1IBL O;  1K9M W;  4DR2 O;  4KHP O;  1P4R A;  5J2T B;  3H1K H;  4NTX A;  4NR1 A;  3OGI B;  4MS2 A;  5DEC A;  2QJ1 A;  4MTG A;  5LMU B;  4J9Y B;  4AI8 A;  1WN7 A;  3ZHT A;  4MTO A;  1US6 A;  1F7Y A;  1TUB B;  2UUA B;  4OX9 O;  1ZWI C;  2WLI A;  3HKB B;  4PEL A;  4MVQ A;  4UV9 A;  4JI8 O;  1EN4 A;  4TV9 B;  3K57 A;  1MG1 A;  3O65 A;  5KHI A;  1N33 B;  1O9H A;  1IUR A;  5LP6 C;  4PA9 A;  2Q68 A;  1SA0 B;  1R3K C;  5KHJ A;  1K8A W;  1PV0 A;  1S5J A;  1NVP D;  3UT5 A;  4MVZ A;  3BAA A;  1XBL A;  2ZDI A;  3RN4 A;  3JAW B;  1KEC A;  2UXN A;  1BQZ A;  1NU1 H;  4LFA O;  2DW4 A;  5GON B;  3OAA G;  4A5U B;  4DV6 O;  1UPG A;  2NNU A;  1VF6 A;  1AI4 A;  2RDC A;  1XIL A;  4WFH A;  3A0R A;  4J42 A;  2WAM A;  2ZE5 A;  1MAB G;  1M57 C;  4B7K A;  2DWD C;  1SQG A;  1YXB A;  2ZQM A;  5EYP B;  2AW9 A;  3TXQ A;  3CD6 V;  2Q0O C;  1EZJ A;  3OTF A;  2XAG A;  2BOB C;  3ABM B;  1NR1 A;  1YIJ V;  1FXV A;  3E8G A;  1FJG O;  4TUY A;  5KA5 A;  2OIG A;  1I94 O;  5IJ9 A;  1AR5 A;  1NH2 D;  2CGO A;  2HG5 C;  2QWP B;  4R50 A;  1JFF A;  3ASN B;  5LMN O;  4MW3 A;  2VRZ A;  4CC5 A;  2ILM A;  3R66 A;  2GUZ A;  1BT8 A;  4UCR A;  3E89 A;  3ZCC A;  3ETD A;  4MVS A;  3E35 A;  1THZ A;  4B3T O;  3L73 H;  1KQS U;  1R6N A;  4PI0 A;  1MZF A;  4PD4 F;  3DC6 A;  3E86 A;  1VIB A;  1NJI W;  4X66 O;  1YF2 A;  4Z2W A;  2JK5 C;  3SYP A;  4X20 A;  3IFX A;  2PI4 A;  1FFX A;  4JZG A;  3JAL B;  1Y76 A;  3CRR A;  4H33 A;  4PDL A;  1URF A;  1VQ6 V;  2DYR C;  4X89 A;  4X64 O;  3E83 A;  1X4T A;  3MD0 A;  1XNR B;  4K3A A;  1XDC A;  2BTQ A;  3WB2 A;  2PF4 E;  2ZIO A;  4DUZ B;  5CBF A;  2EZP A;  2WLI B;  3TGU H;  2WA4 A;  2DYS B;  4FK5 C;  3AK2 A;  1H38 A;  2JRI A;  5EC1 C;  3H1L H;  2IU0 A;  4QGP A;  2DE0 X;  3UT5 B;  5IYC O;  1PL0 A;  3ASO C;  3ZJZ A;  4GX0 A;  2MW2 B;  2R9R B;  4P9O A;  2X6C A;  1YCI A;  3ZMS A;  1V55 C;  1NR7 A;  4JI6 B;  1B04 A;  1M4U A;  4R8C A;  2CTR A;  2DMX A;  2W0F C;  5ITZ B;  5CN0 A;  1QLE C;  1OCO B;  4GKK O;  1H8E G;  2IH1 C;  4O4L A;  2OT5 A;  3K06 A;  5B1A C;  4LF9 O;  4K0K B;  2XOK G;  1ZTE A;  3AG3 C;  3ZMT A;  4CH6 A;  4TUY B;  3QTC A;  1K5Q A;  5IJ9 B;  3D3I A;  1DLB A;  2UXC B;  4RQF A;  4RWU A;  3T2M A;  2R9I A;  4ZKI A;  4GX2 A;  1IXM A;  1N32 B;  5GTI Z;  2UUB O;  1JFF B;  5IYB O;  4JI5 O;  4UCS A;  3B09 A;  5FPR A;  2V1D A;  5KA6 A;  1SQV H;  2Y0I A;  2G38 A;  3ZRW A;  4NXM B;  1SQB H;  2F23 A;  4UVC A;  5CBH A;  3SYQ A;  5IWA O;  3LNN A;  4LNU A;  1BMF G;  4FLW A;  1XI1 A;  3CP1 A;  5CBG A;  2JS5 A;  4X20 B;  4UFZ A;  1FXK A;  3MDS A;  4BAY A;  1FFX B;  2H3O A;  1JX9 A;  4FLY A;  5H9C A;  2UXD B;  4J11 A;  2OWO A;  1Y76 B;  1K4D C;  1GM7 A;  4JAA A;  2EJ7 A;  3BPZ A;  3ZHV A;  3CCS V;  3D8C A;  2FTK A;  2BTQ B;  1CXZ B;  4B3R B;  2ZXW C;  3JAM N;  1RSO A;  2F1M A;  1D2D A;  2YSU B;  2QTO A;  4JTA B;  1PD3 A;  4DV7 O;  1XMQ O;  1SQQ H;  1L1F A;  3K5L A;  1GK9 A;  3CCU V;  4JYC A;  2ZCE A;  2A79 B;  4JAV A;  1BS3 A;  3SJC C;  1GMG A;  3WB1 A;  1M93 A;  4FZ0 A;  4JI4 B;  2HVK C;  4I9W A;  1VQP V;  1Q6I A;  1H2K A;  3RT3 C;  4WFA V;  1ARO P;  2FKX A;  2PUS A;  4UCO A;  3S3W A;  3X2Q C;  1H2G A;  4FLX A;  2YIB D;  2A3Q A;  2BE3 A;  1VF7 A;  5BMV A;  4MVO A;  3RBZ A;  2A7W A;  4O4L B;  2QE7 G;  5B3S C;  3SPC A;  3VBB A;  1R3L C;  4GKJ O;  2Z5U A;  3P30 A;  4X62 O;  4DV5 B;  4PV1 B;  1P7B A;  4JF3 A;  3RVY A;  4DV2 O;  4L8J A;  3RYC A;  1KMI Z;  4PA7 A;  1OCC B;  2LW7 A;  1I7F A;  5C8Y A;  2VQE B;  4PDV A;  4UB8 Z;  3CCE V;  5HFL A;  2EIJ C;  4JI2 O;  3CPW U;  1G6U A;  1FS0 G;  2IJH A;  3FD9 A;  5H5N A;  2ZNJ A;  3ETG A;  1D5A A;  1CP9 A;  3L74 H;  4LF4 O;  2B1I A;  3OR7 C;  1R1B A;  3N27 A;  5LGT A;  4BR6 A;  4XBF A;  4DUZ O;  3LSS A;  2B1G A;  2Q69 A;  1AI5 A;  5IY5 C;  4H13 B;  5EC2 C;  3ZHQ A;  1M56 C;  4BWA A;  3CS5 A;  3RFR A;  2AZ2 A;  4LNU B;  1EBO A;  3GWO A;  3BFR A;  4GLX A;  2UU9 B;  1R73 A;  1K3E A;  2JGD A;  1FXK B;  2OTL V;  4LF8 B;  1IBM O;  5CA0 A;  4W4L A;  4LF6 O;  2Q9L A;  1JMK C;  3K08 A;  3QO7 A;  5LP6 A;  1N34 O;  2PGG A;  3H1J H;  3FB8 C;  4YHH B;  1RSO B;  3CRQ A;  1Q86 W;  1K33 A;  2DWE C;  3EFF K;  1Q82 W;  1HR0 B;  3E8B A;  2WLK A;  1V9P A;  4TT3 G;  1XNQ B;  2QKA A;  1RM1 C;  1CPY A;  5B1O A;  2V4D A;  4LP8 A;  2YID A;  1JA8 A;  3E2E A;  4B7E A;  4HBN A;  3WG7 C;  1XL6 A;  4GT1 A;  1N36 O;  1LUW A;  3OEE G;  1QQC A;  2WLM A;  3BVO A;  3DXR A;  4CS4 A;  4RO2 A;  4YY3 O;  4YJ3 A;  3CYO A;  1BHB A;  1OV9 A;  4JAU A;  3LDD A;  2YC0 A;  1TUB A;  2AZ0 A;  1N32 O;  1Q3E A;  3CX5 F;  5EIB D;  2E5L O;  1WB8 A;  4RUF A;  1XMO B;  4DV3 B;  1GTO A;  5H6R A;  5JWP A;  3WU2 Z;  3PJS K;  4GCZ A;  3CME V;  2OYQ A;  5LOV A;  1MOF A;  1AJP A;  2IJK A;  1KUQ A;  3CWB H;  2VS0 A;  2RCV A;  4UCU A;  2W6J G;  1NS1 A;  4LBE C;  3JAS B;  3SJB C;  1FYJ A;  4DV0 O;  4O2B A;  4UVA A;  2O57 A;  5C8Y B;  1AP6 A;  1OZ0 A;  4LF7 B;  2IH3 C;  3T1C A;  5IE9 A;  2Y4U A;  4ABM A;  4QE7 A;  4RAI A;  1HP8 A;  4IT5 A;  1NTK H;  1VQ7 V;  2XAJ A;  3CCJ V;  2L6L A;  5IJ0 A;  3J7A U;  4NTW A;  4DR5 O;  1XHZ A;  4B3R O;  2DJV A;  4IIJ B;  2LGQ A;  1ENV A;  4NB5 A;  4AQY B;  4CH3 A;  3H9V A;  1PM9 A;  2EX3 A;  3IC9 A;  3JAR B;  2Z0A A;  2XAF A;  1VF5 B;  5KHH A;  2JGD B;  3ETE A;  4FFB B;  1IBK B;  4DW0 A;  4DXW A;  2EIL B;  2ZIM A;  5CA0 B;  5L3D A;  3CCV V;  4MVM A;  5LP6 B;  1BL8 A;  3F7Y C;  5BZB A;  1HNZ O;  1EN6 A;  3SJQ C;  3ICX A;  4FM1 A;  3DSQ A;  4LFB B;  5JCO C;  1NTZ H;  1YJ9 V;  2LO1 A;  2X6B A;  2F93 B;  4JZ2 A;  4O4I B;  3F5T A;  5A9G A;  1QLN A;  2UXB O;  2Y0P A;  4GX1 A;  1PPJ H;  2P4V A;  1BGY H;  4FVM A;  1M57 B;  1QNM A;  1K92 A;  2YI8 A;  3DXR B;  1KU9 A;  4DR7 B;  3SPH A;  4YJ3 B;  1XOU A;  2EIK C;  2DN9 A;  3W7X A;  4JYB A;  3LUT B;  4LWS B;  3K58 A;  3CRM A;  3T1H O;  4PDM A;  4DR6 O;  5CA3 A;  1YJW V;  4J9Z B;  4P30 A;  2QM4 A;  4I0X A;  1UFI A;  1IXB A;  4JI1 O;  2YIC A;  5LOV B;  3C90 A;  2VWJ A;  3K9S A;  4TQF A;  3W7U A;  5EZY A;  4DV4 B;  1H8H G;  4O2B B;  1J5E B;  1GN3 A;  1DF5 A;  4LF5 B;  1OJH A;  2HFE C;  1V54 C;  2YXH A;  3GWK C;  4E2L A;  4KUM A;  2CUG A;  3I55 V;  4DRX B;  3B77 A;  5ITZ A;  1F51 A;  4DV1 O;  3D36 A;  1ZUQ A;  5IYZ A;  3A0B Z;  2IW5 A;  3APO A;  4DR1 O;  5IJ0 B;  2XUM A;  1SET A;  3ZN0 A;  1GO3 F;  4H44 B;  2B9Z A;  2H8P C;  2Y69 C;  1NTM H;  5EBM C;  4OPA A;  2DYR B;  3ZED A;  1G1X B;  2HP8 A;  1Q7Y W;  1S0V A;  5JJJ B;  3FKS G;  1Z5W A;  2HJD A;  4WBN A;  2CDY A;  5LL6 Y;  2E74 B;  4GX5 A;  2ITC C;  3RW0 A;  4FMT A;  2QDO A;  1L8D A;  5BR8 O;  2GSM B;  1VQ9 V;  2BCC H;  5AG2 A;  1KYO F;  3L72 H;  1WA8 A;  1Z2G A;  4JTC B;  4DR3 O;  4B3M O;  2QWQ B;  4PI2 A;  3ASO B;  3L75 H;  1YHQ V;  4PA3 A;  4NTY A;  1H2S B;  3ZHS A;  5K1X A;  5E1A C;  4JI7 B;  1ROP A;  3K0G A;  1V55 B;  3CJH A;  2CGN A;  4LFC O;  4O4H A;  2M6Y A;  3T1Y B;  3AEI A;  3ZRV A;  1JVM A;  1O9G A;  1YZB A;  2WLJ A;  4NYK A;  1QLE B;  3VQV A;  2F66 C;  4LH6 A;  3CRC A;  4U3J A;  1PKX A;  5B1A B;  3ZN1 A;  3H1I H;  1E1Q G;  1YDX A;  2EIM C;  1K7D A;  4JPR A;  2HKO A;  3VOU A;  2R70 A;  4N23 A;  3AG3 B;  5JVD A;  2ZR2 A;  4J7Z A;  4LH7 A;  4X65 O;  1Q5O A;  1Q81 W;  4F4L A;  4IL6 Z;  1Z5V A;  4BW5 A;  1VQ5 V;  4ZBM A;  2GV9 A;  2W0X A;  1JQ0 A;  4I0X B;  3ABM C;  2LGW A;  3ABT A;  2FL4 A;  3FB5 C;  3BRC A;  5L3F A;  2KKW A;  3AG1 C;  1B6Q A;  4LCU C;  5EZY B;  2UXX A;  1ZLZ A;  3ABK C;  1G8M A;  3CSX A;  3IJ4 A;  1RPR A; 
#chains in the Genus database with same CATH homology
 3DXR B;  3DXR A;  3CJH B;  2BSK B;  3CJH A;  2BSK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...