3CJHA

Tim8-tim13 complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
52
structure length
52
Chain Sequence
ATELVNKISENCFEKCLTSPYATRNDACIDQCLAKYMRSWNVISKAYISRIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Tim8-Tim13 complex has multiple substrate binding sites and binds cooperatively to Tim23
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords Mitochondrial import inner membrane translocase subunit TIM1
total genus 17
structure length 52
sequence length 52
chains with identical sequence C, E, G, I, K
ec nomenclature
pdb deposition date 2008-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.810 Mainly Alpha Orthogonal Bundle Helix Hairpins Mitochondrial import inner membrane translocase subunit tim13 like domains 3cjhA00
3CJHB 2BSKA 3DXRB 3CJHA 3DXRA 2BSKB
chains in the Genus database with same CATH superfamily
1BZKA 2CH7B 5KHGA 3QVNA 1M90W 3B8NA 4UV8A 1TVKA 1E79G 2YI8A 4B3RO 1JVMA 4R7CA 3ETEA 1D2DA 2R72A 1YJWV 4FLXA 1BQZA 1XHXA 3CX5F 1IBMO 2Y0IA 2ZD9A 2HVKC 1TUBB 1S5HC 4BW9A 4TV9A 4X65O 5GTHZ 1OCRB 1S77D 3B2EE 4JI1O 3G4SV 1N33B 3ZX6A 4DV3B 1M93A 2QKCA 4BWAA 2YI9A 3HKCB 2UXXA 3OTOB 4B3SO 1M5IA 1ZLZA 4UCOA 5BR8B 4DW1A 3RVZA 2GTAA 2YXHA 1NR7A 1SKVA 3K57A 5FNVB 3L70H 3K58A 2AHYA 5CA1B 5CMUA 2OCCC 1M56C 1XMOO 4G28B 3SJCC 3D3IA 5JVDB 5CA0B 4A5UB 4JTAB 5B1BB 1H2MA 5IJ0B 2PI4A 4DUYO 2QKAA 1SQBH 2Z3YA 1PNKA 3JALA 5J9PC 1XNQO 2QA4V 1SA0B 2EIJB 5B1NA 5LHGA 3C3TA 3N27A 3RVYA 1IX9A 5C93A 5EIBD 4TSFG 4EB6B 4RQFA 3FFQA 1FXVA 1GAXA 1WAZA 2VQEO 1XMOB 4LC1A 3JD3A 4WBNA 4I4TB 4F6EA 3JD0A 3F5TA 5GW7A 2AZ2A 4YXWG 4X1YA 3BPZA 1VARA 2CH7A 1HWYA 4X66O 2W6JG 4X20B 3G67A 1OV9A 2LP7A 1FFXA 1YEWA 1NTMH 1K5QA 2YIAA 1OCCC 3BRCA 2UUAO 4OGQB 2MW2B 4DV6B 4O2AB 1N34O 3QF7A 4JI4O 1U96A 4MT8A 3STZC 1IDSA 2BOBC 2WLLA 4YIOA 1EN6A 2M6YA 4LF8O 1RPOA 5B5EZ 2E76B 5J2TB 1XNRO 1RPRA 1XL4A 2CUGA 2WLJA 2LGWA 2JGDB 5JCOC 1GM9A 4YY3B 3ZHVA 3UCSC 1I5YA 4DV5O 4DUZB 3RYIB 3ZRVA 2PYLA 4FIPC 5L3DA 2ZM6B 2DYSB 5KAIZ 4J11A 4XBFA 1VQMV 1GM7A 2QE7G 4LF9B 1K8AW 1H2GA 1XEQA 5CA1A 4PA6A 2XAQA 1ZX3A 3JCZA 1I94O 1S76D 4BAYA 1QVFU 4DV7B 2VRZA 3CCLV 4GKJB 4X9QA 2MK3A 5CA3A 1UFIA 3OM3B 4JI5O 2XTAA 5IYDO 4QIWF 3HR0A 1JR9A 5KA5A 4TQFA 1VQ5V 4DRXB 1H2LA 1QBZA 3U10A 2XT9A 3JD2A 2FMLA 2YXLA 1KC8W 1R3KC 5LL6Y 2EULA 3RT3C 4J7ZA 2B1GA 3H1HH 2UUBB 4J42A 1NZ6A 3B77A 3CC2V 5IYBO 3SDLA 1OZ0A 3EFFK 4DK1A 3TCUA 4PJ0Z 2QGNA 1K9MW 3C90A 3CWBH 4JV5B 2Q7HA 3N2GB 1AR5A 1M56B 1P4RA 3C3SA 5IYZA 4B7KA 4Z2WA 2HJFC 2ZE7A 3L75H 3K06A 4B7EA 4B3SB 4JI1B 2VS0A 4R6ZA 4FZ0A 1JJOA 3ZHTA 4CC5A 4DV0O 1YIJV 1IBKO 3CRRA 3OMIB 3WG7C 1F51A 1JA8A 2L35A 4GZRB 1Q6IA 2F66C 5LMUB 2LJ2A 3EXAA 4L8JA 1QLNA 1OCOC 2BOCC 5B1OA 1NH2D 2JVDA 4FMTA 1P49A 5EYPB 3T2MA 1XREA 2BTOA 5LYJA 4CZZA 4I50A 3ZIAG 3Q4HA 2ZE5A 3UM7A 1E1RG 4E4EA 3CMEV 4OX9O 1W0JG 3SR2C 4NTWA 3WU2Z 1IBKB 3KCYA 4UCSA 1QNMA 4IIJB 3UQ8A 1LUWA 4X65B 1VF5B 3IC7A 4PHZA 5B1AB 4LF5B 1F7YA 2ZR3A 2K1EA 3JARB 1SQXH 4H0LB 1Y74B 2WLMA 3HKBB 3P3NA 4DUYB 4DR3O 4DRXA 1GN3A 2XHBA 1BMFG 4WFBV 2YDEA 1I94B 3N2KB 2ATKC 1NJIW 1GTOA 3CCUV 4OX9B 2LW7A 3T1YB 2ZKOA 1YHQV 1COWG 2HLDG 4N23A 2Q6AA 5E79Z 4LF4B 3ZCCA 1R1BA 3W7UA 1UJWB 1I08A 2ZXWB 4IHJA 3ZMVA 4CC6A 3JAMN 2HFEC 5LMNO 4UB6Z 4LFAB 1KP2A 2N74A 5IYZB 3T4ZA 5JJNB 4LF8B 4LNUA 3K5NA 4DR5B 2RQ6A 1SERA 5LP6C 1KU9A 3LDDA 1CEZA 4FK5C 2UXCO 3ZMUA 2NLJC 1Q81W 3WB0A 1Y67A 2DYRB 3OMNB 4JAAA 5KLVH 1SRYA 4H37A 3JAWA 3SYCA 1P7GA 3RN4A 2HJDA 2FB5A 3CRMA 3D36A 2UUCO 1EBOA 4MSWC 1K73W 1G8MA 2QWNB 1OCZB 3HKEA 1KB9F 4TUYA 4MVMA 2RNBA 2A9HA 4LR3A 2UXBO 3ZRXA 2EZOA 1HNXB 4NXMB 2P5OA 1N34B 1FS0G 1PP9H 1KP3A 4MVUA 4O2BA 1H2KA 3E8BA 3CCMV 2P67A 2HHHO 3ETQA 2OTJV 3AG4B 4X62O 4PA4A 3MD0A 2BSKA 5B1BC 3H1IH 3BY6A 3HKBA 2AGAA 5JQGB 4O4JA 4H33A 4JASA 2H8PC 4DR1O 4ZI7A 4MTGA 2HVJC 2LFRA 1LNQA 1QHTA 2ILMA 4PDMA 5F2VO 1IVSA 4JF3A 2WA4A 1VQLV 1J95A 3GVMA 4QNHB 4JZ2A 5BZBA 2QWQB 3ASOB 1XOUA 5CBGA 4IHJB 1E1QG 3H1KH 4DR6B 2HHHB 4DV2B 1GN6A 3RYHB 3CCSV 1HNWO 1W0KG 1WA8B 4DV3O 2Q4PA 4G27B 4J9ZB 2P4KA 1VQ9V 3CEIA 4GT1A 1HR0B 4ZOLB 3RGBA 4JI0B 1TA8A 2ZT9B 5EC1C 4J7JA 3OEHG 3JASA 2WLKA 1F23A 2Z5UA 3SJQC 1QR9A 1XMQB 4F6RB 4P9PA 1L1FA 4ZKIA 3OE7G 2FTKA 4WF9V 1AVMA 4K0KO 1MZFA 1Q5OA 3BFRA 3CS5A 3HKEB 5EC2C 5IWAO 3QO7A 3QNEA 1IXBA 3L73H 1HR0O 1ZWIC 1QU7A 3CPWU 1M57C 2OCHA 3DC6A 1SQPH 1FYJA 4L87A 3K9SA 3H1LH 5IJ0A 3J81N 4LF7O 3ABKC 3AG1C 3RFRA 1KKCA 1AR4A 1T5EA 3APQA 1TAEA 3UKMA 3IJ4A 2OT5A 5CBHA 4WFAV 5EZYA 2PGGA 3ZHSA 5LGNA 3BCCH 4I0XA 2YEVB 2CTWA 2LQTA 3D8CA 1N0JA 2QSAA 4FLWA 2HKOA 4O4HA 3ZRWA 3J7AU 4ZHQB 1K4DC 3CCRV 4MVQA 3CJHA 3SYAA 5CN0A 2Q67A 3IC9A 1VQ8V 1Y76A 1YCIA 2LO1A 4UFZA 1AI7A 3IFXA 3SJAC 1XILA 4X64O 2E5LB 3BA9A 4X88A 4I55A 2ZDIA 3H01A 1VQOV 3TJTA 1MABG 3I55V 4PI0A 3RYHA 5K1PA 2DWEC 4AQYO 2X7RB 1H38A 4GX2A 4CS4A 4Q6GA 1VF6C 2RCVA 4O2AA 1YSCA 2ZE6A 4W4KA 1UPGA 4TV8B 4LF6B 4DR5O 2PY5A 1NR1A 1SQFA 5IWAB 4LFAO 5JH7A 3E8HA 2JGDA 4JTCB 3SPJA 2IJIA 2DQ3A 4UCVA 1ZL8B 4YHHB 1HNZB 1V55C 1JFFB 3AK2A 4DV1O 2A0LA 1PV0A 4JI4B 1DF5A 3FB5C 1WPXA 4AILC 1QQCA 4NYKA 1DK1A 4MTOA 4DR1B 4X1KA 3BA8A 3NR7A 4KFMA 4LFBO 4GUNA 2E74B 1BGYH 2R70A 1ZTEA 1B3QA 3VQXA 2EIKC 4O4LB 1ZUQA 2XAJA 4X64B 4BIUA 2E5LO 2Z0AA 5IJ9B 2ARHA 4KUMA 2RDCA 5EZYB 4LFCB 4YJ2A 2UXDB 3GWKC 4WFEA 3OD4A 3T1CA 3VOUA 2YEVA 3WB2A 4WFGA 3K5MA 2VQEB 3KKYA 3EVKA 1US6A 1SQQH 1N36O 4RUFA 3OUSA 1Y66A 2D2CB 2KG7B 1F4NA 1FXKA 1V54C 4QPJA 1VQPV 1RP3B 3TK1A 3E83A 4DK0A 1GN2A 1Q90D 3ABKB 3AG1B 4HBNA 4GCZA 3MHHC 3ZMZA 1MSWD 1SS3A 4GLXA 1BCCH 4P2ZA 4RUEA 2HG5C 4D7SA 1XUQA 4Z1VA 2P4VA 3SYPA 2X6CA 3RBZA 1SZXA 3ZMTA 2JK5C 4NXNB 2EIMC 2FKXA 4PA9A 4ASUG 2QWPB 3ZJZA 3ASNC 5KX5B 1AILA 2D3OW 1AI4A 3A0BZ 1CP9A 4CBCA 2ZCEA 3P3PA 3DC5A 1BS3A 4TV8A 1Q3EA 2WLHA 1ORQC 4FM1A 2DOSA 1MNGA 1R3IC 4CH5A 1K33A 4D7TA 5LA6A 3UT5A 1IURA 1J5EB 4GKKO 3AG3C 4PD4F 2GTSA 4I50B 2O57A 1ZL8A 4XDKA 3A0RA 1KECA 5B1AC 1O9HA 1OCCB 2GBOA 5AG2A 1V55B 2Y4UA 2IH3C 5IT9N 5LMUO 1NVPB 4LWSB 1Q43A 2Y69C 3MHSC 3E35A 4LFCO 1RSOA 1YDXA 3M8AA 3QG5A 1DLBA 4CH4A 4NTXA 4FZ1A 5H2FZ 1QVGU 3ZEDA 3B40A 4GYCB 5IE9A 5JWPA 1WP7A 5L3BA 3WB1A 4YJ3B 3N2KA 1I5XA 1K97A 3CYOA 1VQ6V 3ABTA 1FAFA 4IL6Z 1FXKB 4JI8B 2EJRA 5DM6V 4JI6B 3P32A 1NI8A 3ABMC 4HAMA 1TVKB 3M99B 1FFXB 4CH6A 4QJFB 4ABMA 1F4MA 4GX0A 4XDLA 3STLC 2XNDG 2VWJA 3BVOA 1Q82W 1GH6A 4CH3A 2CAZC 1VQ4V 2C2AA 3R66A 1OCOB 1N32O 3E22B 4DO2A 1M57B 5KMGA 3G6BA 3K3WA 1RFYA 2OTLV 4G2KA 3K79A 4JI2O 2X0LA 2DYRC 4K0KB 3OGIB 1J5EO 2EIMB 3M7MX 5BXZA 2V1DA 2CE4A 4X8AA 4BIOA 3HKCA 2YIBD 3HKDB 3JAWB 4MVRA 4PDVA 1VQKV 1OCRC 1KD1W 3OW2U 5FNVA 2AZ0A 3PN1A 2F23A 2YC0A 4PV1B 3OEEG 4J10A 4PA7A 4RAIA 1AB3A 3SPIA 3ETGA 5HFMA 4FLTA 2DYSC 4DR3B 1WP8A 1AI6A 3FKSG 4ICGA 2Q73A 5GTIZ 4PDLA 4NKGB 2BCCH 3CC4V 1N0NA 3CXHF 3DTUB 5D5PA 1SZTA 3ABUA 3WFVA 3LSQA 3AK1A 4Q20A 1FJGB 4TQDA 2V7QG 2B9ZA 1R6TA 3F7YC 4XDJA 4U7NA 5IY5C 2ZDIC 4IYIA 3X2QB 1NKDA 5H9CA 3CE2A 3BEHA 1AP5A 1JPXA 4X1IB 3AG3B 5BR8O 2WSSG 1L8DA 5CBFA 3FAVB 2Q0AA 5H6QA 2JDIG 3K59A 4X62B 2A7WA 4X20A 3A0HZ 3JD1A 4K8XA 1W2BU 3VBBA 1VQNV 5JCOA 2CK3G 4FLZA 4FVMA 4UVAA 2PUSA 1QLEC 4U3JA 4UCRA 5TISZ 3LNNA 2FL4A 3F7VC 3FD9A 4JYAO 2XAGA 2ZE8A 2EZPA 2KQXA 5EYPA 5A2QN 3OFNG 3D36C 4H44B 4DV5B 3ZHQA 3Q4HB 1BHAA 4YY3O 1CXZB 4TWKA 3ZHUA 1NTKH 4OPHA 1Z2GA 3HKDA 1JCHA 3RWRD 3CCEV 4PDRA 3ZRSA 1GO3F 1P7BA 2K9PA 3IGAC 3RYCB 1BQ0A 2CDYA 4DR7B 4QPKA 1M4UA 1R6KA 5K1XA 5LGUA 4JI0O 5CB4A 3THOA 5H6RA 1HP8A 1VMGA 2DE0X 1YTFD 4HZ3A 3SYOA 1GK9A 2EILC 2VWKA 2R9AA 3L74H 4UVCA 2GUZB 1MG1A 3W7TA 1S72V 3E89A 3B09A 2RN9A 2DW4A 4JTDB 4WFHA 1RM1C 5GONA 2DQ0A 4LH6A 2JIZG 2A79B 4MVOA 4JZGA 1R6NA 2XAHA 1HW7A 4JI3O 4FM2A 3E8FA 3CJHB 3T1HO 4HYOA 1ROPA 2PTMA 4NR1A 1Y76B 4X1IA 1AROP 1FFTB 1JX9A 1XI1A 1Z5WA 4CS3A 2YICA 4LNUB 3ZS8C 4D6TH 2QKSA 4MS2A 5IDJA 2Q69A 2WWWA 3O65A 4HNAA 4BW5A 5KHKA 1YVWA 3KZIZ 2IH1C 3G71V 2IJJA 1H8EG 3TETA 4J80A 1GM8A 4LF9O 4KXRA 5JH7B 4C7UA 5LXTA 1Q7YW 1S5LZ 4JYYA 4RWUA 1EZJA 1GMGA 1B04A 3LDEA 1M1KW 2F4VO 1BSMA 4IT5A 1FJGO 4B3MO 2UU9O 1EM1A 4JYBA 2UXCB 4O2BB 1R3LC 5J2UA 4IIJA 4B3TO 4OPAA 2JEXA 4X1KB 2YSUB 3T1HB 3OMAB 1IBMB 2ZNIA 4LBEC 3JARA 1I7FA 1IXMA 1IZ3A 1EZVH 2QWRB 4EB6A 2UU9B 4UB8Z 5LBQA 2ZIOA 4WBNB 2IM9A 1SQGA 1PNLA 4IYHA 4YJ2B 5KHJA 1X59A 1WB7A 2E75B 2NNUA 4J41A 4K8ZA 4FPPA 3CC7V 2AXTZ 3QTCA 1KMIZ 2FYUH 4DR2O 1XHZA 2X6BA 2EINC 3ZMSA 3CD6V 4JI7B 2GSMB 3JSLA 1NTZH 1S5JA 1DGSA 4FLYA 4LF7B 1WA8A 2ITCC 3JAKB 1NS1A 3RW0A 5B66Z 1XNQB 4EKWA 4ZOLA 4CS2A 2QM7A 4FJCC 5KA6A 4TV9B 3JASB 1NBMG 1YJ9V 3P30A 3UO2A 2AW9A 1WN7A 3RYIA 5ITZA 4OXSA 3W7XA 2Y4TA 5DEDA 1K5SA 1Y4MA 4JI7O 2E3CA 4MW3A 1S3JA 4UCTA 5FPOA 5LXTB 3L9DA 5L3EA 3DSQA 3ZN1A 2VQFB 3HB3B 5A9GA 5JVDA 2PYJA 4JYCA 3S3WA 4DW0A 3K0GA 2W6IG 1SETA 2Q9LA 2QM8A 3B8MA 1PL0A 3T4DA 1PM9A 3LSSA 1RSOB 1XL6A 4JI8O 3R65A 2CGNA 2EBOA 4FLVA 2BTQB 3ZRWB 1NVPD 3JD4A 2QDOA 1M9NA 1WJZA 2IJHA 4O4JB 4RQEA 2Q5ZA 4B3MB 5FLXN 3CCJV 5JJEB 3K9AA 4UXNA 1B06A 3B4SA 4YHHO 2VQFO 4DV1B 4EEQA 2M7WA 3BHPA 3ICXA 1KKDA 4PA3A 2ZM6O 1SESA 4I55B 4NTYA 1ENVA 4JI5B 1D5NA 1H2SB 1PD3A 3I5DA 4I9QA 4EFBA 1X4TA 2PZSA 3J80N 3JAKA 4WCEV 1L0NH 3GWOA 3E22A 1O9GA 2WPDG 4J9YB 4DV6O 1FD9A 3K5OA 2Q0OC 1RM1B 1R73A 3F5WC 5BMVB 3RYFA 5LYJB 3L71H 1N4CA 2ODMA 4JV5O 1V9PA 3K03A 5LMNB 2EIKB 3FX7A 3JATB 3CCVV 3SPCA 2F95B 1AR1B 1KQSU 4ZIBA 4JYAB 4R8CA 3QO8A 2W0XA 4KHPO 1Q6UA 3LNMB 3SJBC 1DTOA 1YF2A 1K4CC 2JJ1G 3KG2A 4UCUA 3BABA 4DV0B 2ZQMA 3BAAA 2Y69B 4DR6O 2ZXWC 3UO3A 5EBMC 3U0ZA 1VIBA 1LUVA 4RO2A 1CPYA 2OIEA 2AHZA 4JAVA 2Y0PA 4B3TB 1D5AA 3PJSK 2W0FC 3SPGA 4MW8A 4BIZA 2LW1A 1DF4A 2YIDA 3CCQV 3IAYA 4DR7O 4E2LA 2KG7A 3AG4C 5LOVA 4U3FH 1HDJA 3L72H 3JCUZ 1PPJH 2IW5A 3ZHRA 1TGOA 3TXSA 2L6LA 3ZBHA 2DWDC 2ZR2A 1PL4A 3AK3A 4MVZA 3ABLC 3TXQA 3NXSA 2GHYA 1TUBA 1EN5A 4JI2B 4GKJO 1THZA 4R50A 3VQWA 1H2NA 1QLEB 3AEIA 1N32B 5C8YB 5E1AC 3SGIA 1Z5VA 3FYIB 1JMKC 3E8GA 4PI2A 4UVBA 3VQYA 2R9RB 2Q7EA 4DR2B 2YUAA 3UT5B 3OUFA 2GDSA 3FB7C 3RYFB 3SPHA 4LF4O 3U11A 4JAUA 1YTFB 2UUCB 1Q86W 4KP4A 5H5NA 5IY5B 2X6AA 3JATA 5CA0A 1BHBA 1YZBA 3K5LA 2JS5A 2QTSA 5FPRA 4WFFA 2EILB 1AJQA 1LR1A 2PF4E 3ZN0A 3RYCA 3OTFA 3GB7C 4MTFA 1PNMA 2LFSA 2IU0A 4FFKA 4X66B 4LFBB 3SYQA 3QO5A 4I7ZB 4IGGA 1FPOA 2KKWA 3OT7A 1GRJA 3EHBB 4N21A 1W59A 4O4LA 2OCCB 4X89A 4DV7O 2OYQA 2GUZA 2NR5A 4W4LA 2P06A 4ZI7B 2NN4A 4I4TA 1AJNA 2HP8A 3JSNA 2Q68A 3K04A 3A2FA 1K92A 5IYCO 5GONB 2IU3A 1Y6XA 1ZAUA 5LOVB 1BT8A 1WLEA 1BL8A 2WLIB 4K35A 5KHHA 2LGQA 3OTOO 3ABMB 3LSUA 2ZINA 4DV4O 3HPLC 3OR6C 2KSDA 4AI8A 4MTXA 3TGUH 5KUKA 2EIJC 1Q8IA 2WLLB 2HR3A 1MMMA 3S3XA 2EJ7A 4B08A 4FM0A 2CGOA 3FYEB 4I9WA 1VQ7V 3A8TA 5C8YA 2XUMA 5J2TA 1P84F 4AQYB 2JRIA 2ZIMA 1VF7A 2B5UA 4QE7A 5KX5A 1NH2B 1I0HA 4GX5A 1QCEA 2F93B 4GX1A 3OAAG 5B3SC 1KUQA 1QR8A 3APOA 2RJZA 2IJKA 1XMQO 2XAFA 1OCZC 2WLNA 5LA6B 3AG2B 3AG2C 2RMKB 4DYLA 2N05A 2UUBO 3W7SA 4J7KA 2BE3A 4TUYB 2PI5A 1N36B 1XNRB 2ADQB 5LGTA 3CMAV 1WPBA 5JJJB 3D3QA 3K08A 4H13B 1FKAO 5EIBC 2A3QA 4I5SA 3VQVA 1ZSPA 1JQ0A 4DXWA 2CTPA 4F4LA 4P30A 4O4IA 1NU1H 3CB2A 4JI3B 4LF5O 2P22C 2WA3A 2Q7GA 2H3OA 1JOYA 3ML0A 2XASA 4QE9A 1WNSA 2DJVA 1AJPA 2BSKB 2OIGA 2ADPA 2QWOB 3MDSA 1N8RW 1G1XB 1U97A 4Z1MG 5BY1A 5KHIA 3X2QC 1AI5A 1OHHG 4YJ3A 5EK0A 1A32A 2ETNA 3E86A 1XQ8A 3N2GA 5LHIA 1HNZO 2ITDC 4UV9A 2DMXA 1YITV 2WLIA 4U7OA 4DUZO 1AP6A 1V54B 1PKXA 5DECA 4LCUC 1MA1A 1S0VA 1G4YB 5KMGB 3LUTB 1URFA 4TOIA 2A06H 2UUAB 2XOKG 2F4VB 3OGCC 3CRQA 2B1IA 3KCXA 4YIPA 1TUEB 2JJ2G 3CRAA 4FFBB 5ITZB 3W7WA 5EBLC 1JJ2U 3DXRA 2JS3A 4LF6O 2GV9A 2QM4A 4F6RA 3T1YO 1N33O 1YJNV 5EBWC 1WB8A 4LP8A 2HEPA 1XBLA 5CB4B 3LDCA 2JEUA 4NB5A 1K3EA 4FLUA 5L3FA 5LP6A 1YXBA 2YS8A 1MSDA 5LHHA 3CXCU 2QEXV 1Y74A 3CHXA 2P7TC 2F43G 4NXMO 1R3JC 1IBLO 1NT2B 1SF9A 1GN4A 3H9VA 5D5QA 3CP1A 1NQTA 4O4IB 2DN9A 4I0XB 2BTQA 3FB6C 3O9OA 4KHPB 4O4HB 2UXNA 4AHCA 3G6EV 4ZHQA 3ASOC 5B3SB 5KAFZ 1MZEA 2UXDO 1EFRG 3WG7B 1IBLB 2P6JA 3ASNB 2KB1A 2ZNJA 3OR7C 3K0DA 3FAVA 4TT3G 2YIBA 2EINB 5DN6G 1EN4A 1SC5B 4HNAB 1FXKC 4NXNO 2CTQA 4ZBMA 2UXBB 4QGPA 1BE3H 2YXYA 1YI2V 1HNXO 1K34A 4U3JB 4KL1A 1OJHA 5KUMA 1VF6A 1HNWB 5L3CA 3FB8C 4DV4B 2H94A 2QJ1A 1FXHA 4UUJC 4JI6O 2JGUA 5BMVA 4GKKB 1L0LH 2N04A 2R9IA 4JGSA 1K7DA 4FFBA 2G38A 1G6UA 1B6QA 3DXRB 3G80A 4DR4B 1VEWA 2P90A 4P9OA 1JFFA 4PELA 3MAQA 2EX3A 4JPRA 4LWSA 3E2EA 2QTOA 1Q6HA 5L3GA 5J2UB 3JALB 1SA0A 2CTRA 3H1JH 5LP6B 1XDCA 4MVSA 3CRCA 5HFLA 1KYOF 3I56V 3DGEA 4DV2O 2QR4A 3CSXA 1GKFA 5JQGA 2F1MA 1SQVH 2Y48A 3AG7A 1MOFA 2IBZH 4B3RB 5IJ9A 2V4DA 2Q8VA 1VP7A 3ETDA 4DR4O 3JYCA 4LH7A 1H8HG 2WAMA 4EFEA 4K3AA 2OWOA 4NVPA 4BR6A 4X1YB 3ABLB 1KBHA 5FL7G
chains in the Genus database with same CATH topology
3CJHB 2BSKA 3DXRB 3CJHA 3DXRA 2BSKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CJH B;  2BSK A;  3DXR B;  3CJH A;  3DXR A;  2BSK B; 
#chains in the Genus database with same CATH topology
 1BZK A;  2CH7 B;  5KHG A;  3QVN A;  1M90 W;  3B8N A;  4UV8 A;  1TVK A;  1E79 G;  2YI8 A;  4B3R O;  1JVM A;  4R7C A;  3ETE A;  1D2D A;  2R72 A;  1YJW V;  4FLX A;  1BQZ A;  1XHX A;  3CX5 F;  1IBM O;  2Y0I A;  2ZD9 A;  2HVK C;  1TUB B;  1S5H C;  4BW9 A;  4TV9 A;  4X65 O;  5GTH Z;  1OCR B;  1S77 D;  3B2E E;  4JI1 O;  3G4S V;  1N33 B;  3ZX6 A;  4DV3 B;  1M93 A;  2QKC A;  4BWA A;  2YI9 A;  3HKC B;  2UXX A;  3OTO B;  4B3S O;  1M5I A;  1ZLZ A;  4UCO A;  5BR8 B;  4DW1 A;  3RVZ A;  2GTA A;  2YXH A;  1NR7 A;  1SKV A;  3K57 A;  5FNV B;  3L70 H;  3K58 A;  2AHY A;  5CA1 B;  5CMU A;  2OCC C;  1M56 C;  1XMO O;  4G28 B;  3SJC C;  3D3I A;  5JVD B;  5CA0 B;  4A5U B;  4JTA B;  5B1B B;  1H2M A;  5IJ0 B;  2PI4 A;  4DUY O;  2QKA A;  1SQB H;  2Z3Y A;  1PNK A;  3JAL A;  5J9P C;  1XNQ O;  2QA4 V;  1SA0 B;  2EIJ B;  5B1N A;  5LHG A;  3C3T A;  3N27 A;  3RVY A;  1IX9 A;  5C93 A;  5EIB D;  4TSF G;  4EB6 B;  4RQF A;  3FFQ A;  1FXV A;  1GAX A;  1WAZ A;  2VQE O;  1XMO B;  4LC1 A;  3JD3 A;  4WBN A;  4I4T B;  4F6E A;  3JD0 A;  3F5T A;  5GW7 A;  2AZ2 A;  4YXW G;  4X1Y A;  3BPZ A;  1VAR A;  2CH7 A;  1HWY A;  4X66 O;  2W6J G;  4X20 B;  3G67 A;  1OV9 A;  2LP7 A;  1FFX A;  1YEW A;  1NTM H;  1K5Q A;  2YIA A;  1OCC C;  3BRC A;  2UUA O;  4OGQ B;  2MW2 B;  4DV6 B;  4O2A B;  1N34 O;  3QF7 A;  4JI4 O;  1U96 A;  4MT8 A;  3STZ C;  1IDS A;  2BOB C;  2WLL A;  4YIO A;  1EN6 A;  2M6Y A;  4LF8 O;  1RPO A;  5B5E Z;  2E76 B;  5J2T B;  1XNR O;  1RPR A;  1XL4 A;  2CUG A;  2WLJ A;  2LGW A;  2JGD B;  5JCO C;  1GM9 A;  4YY3 B;  3ZHV A;  3UCS C;  1I5Y A;  4DV5 O;  4DUZ B;  3RYI B;  3ZRV A;  2PYL A;  4FIP C;  5L3D A;  2ZM6 B;  2DYS B;  5KAI Z;  4J11 A;  4XBF A;  1VQM V;  1GM7 A;  2QE7 G;  4LF9 B;  1K8A W;  1H2G A;  1XEQ A;  5CA1 A;  4PA6 A;  2XAQ A;  1ZX3 A;  3JCZ A;  1I94 O;  1S76 D;  4BAY A;  1QVF U;  4DV7 B;  2VRZ A;  3CCL V;  4GKJ B;  4X9Q A;  2MK3 A;  5CA3 A;  1UFI A;  3OM3 B;  4JI5 O;  2XTA A;  5IYD O;  4QIW F;  3HR0 A;  1JR9 A;  5KA5 A;  4TQF A;  1VQ5 V;  4DRX B;  1H2L A;  1QBZ A;  3U10 A;  2XT9 A;  3JD2 A;  2FML A;  2YXL A;  1KC8 W;  1R3K C;  5LL6 Y;  2EUL A;  3RT3 C;  4J7Z A;  2B1G A;  3H1H H;  2UUB B;  4J42 A;  1NZ6 A;  3B77 A;  3CC2 V;  5IYB O;  3SDL A;  1OZ0 A;  3EFF K;  4DK1 A;  3TCU A;  4PJ0 Z;  2QGN A;  1K9M W;  3C90 A;  3CWB H;  4JV5 B;  2Q7H A;  3N2G B;  1AR5 A;  1M56 B;  1P4R A;  3C3S A;  5IYZ A;  4B7K A;  4Z2W A;  2HJF C;  2ZE7 A;  3L75 H;  3K06 A;  4B7E A;  4B3S B;  4JI1 B;  2VS0 A;  4R6Z A;  4FZ0 A;  1JJO A;  3ZHT A;  4CC5 A;  4DV0 O;  1YIJ V;  1IBK O;  3CRR A;  3OMI B;  3WG7 C;  1F51 A;  1JA8 A;  2L35 A;  4GZR B;  1Q6I A;  2F66 C;  5LMU B;  2LJ2 A;  3EXA A;  4L8J A;  1QLN A;  1OCO C;  2BOC C;  5B1O A;  1NH2 D;  2JVD A;  4FMT A;  1P49 A;  5EYP B;  3T2M A;  1XRE A;  2BTO A;  5LYJ A;  4CZZ A;  4I50 A;  3ZIA G;  3Q4H A;  2ZE5 A;  3UM7 A;  1E1R G;  4E4E A;  3CME V;  4OX9 O;  1W0J G;  3SR2 C;  4NTW A;  3WU2 Z;  1IBK B;  3KCY A;  4UCS A;  1QNM A;  4IIJ B;  3UQ8 A;  1LUW A;  4X65 B;  1VF5 B;  3IC7 A;  4PHZ A;  5B1A B;  4LF5 B;  1F7Y A;  2ZR3 A;  2K1E A;  3JAR B;  1SQX H;  4H0L B;  1Y74 B;  2WLM A;  3HKB B;  3P3N A;  4DUY B;  4DR3 O;  4DRX A;  1GN3 A;  2XHB A;  1BMF G;  4WFB V;  2YDE A;  1I94 B;  3N2K B;  2ATK C;  1NJI W;  1GTO A;  3CCU V;  4OX9 B;  2LW7 A;  3T1Y B;  2ZKO A;  1YHQ V;  1COW G;  2HLD G;  4N23 A;  2Q6A A;  5E79 Z;  4LF4 B;  3ZCC A;  1R1B A;  3W7U A;  1UJW B;  1I08 A;  2ZXW B;  4IHJ A;  3ZMV A;  4CC6 A;  3JAM N;  2HFE C;  5LMN O;  4UB6 Z;  4LFA B;  1KP2 A;  2N74 A;  5IYZ B;  3T4Z A;  5JJN B;  4LF8 B;  4LNU A;  3K5N A;  4DR5 B;  2RQ6 A;  1SER A;  5LP6 C;  1KU9 A;  3LDD A;  1CEZ A;  4FK5 C;  2UXC O;  3ZMU A;  2NLJ C;  1Q81 W;  3WB0 A;  1Y67 A;  2DYR B;  3OMN B;  4JAA A;  5KLV H;  1SRY A;  4H37 A;  3JAW A;  3SYC A;  1P7G A;  3RN4 A;  2HJD A;  2FB5 A;  3CRM A;  3D36 A;  2UUC O;  1EBO A;  4MSW C;  1K73 W;  1G8M A;  2QWN B;  1OCZ B;  3HKE A;  1KB9 F;  4TUY A;  4MVM A;  2RNB A;  2A9H A;  4LR3 A;  2UXB O;  3ZRX A;  2EZO A;  1HNX B;  4NXM B;  2P5O A;  1N34 B;  1FS0 G;  1PP9 H;  1KP3 A;  4MVU A;  4O2B A;  1H2K A;  3E8B A;  3CCM V;  2P67 A;  2HHH O;  3ETQ A;  2OTJ V;  3AG4 B;  4X62 O;  4PA4 A;  3MD0 A;  2BSK A;  5B1B C;  3H1I H;  3BY6 A;  3HKB A;  2AGA A;  5JQG B;  4O4J A;  4H33 A;  4JAS A;  2H8P C;  4DR1 O;  4ZI7 A;  4MTG A;  2HVJ C;  2LFR A;  1LNQ A;  1QHT A;  2ILM A;  4PDM A;  5F2V O;  1IVS A;  4JF3 A;  2WA4 A;  1VQL V;  1J95 A;  3GVM A;  4QNH B;  4JZ2 A;  5BZB A;  2QWQ B;  3ASO B;  1XOU A;  5CBG A;  4IHJ B;  1E1Q G;  3H1K H;  4DR6 B;  2HHH B;  4DV2 B;  1GN6 A;  3RYH B;  3CCS V;  1HNW O;  1W0K G;  1WA8 B;  4DV3 O;  2Q4P A;  4G27 B;  4J9Z B;  2P4K A;  1VQ9 V;  3CEI A;  4GT1 A;  1HR0 B;  4ZOL B;  3RGB A;  4JI0 B;  1TA8 A;  2ZT9 B;  5EC1 C;  4J7J A;  3OEH G;  3JAS A;  2WLK A;  1F23 A;  2Z5U A;  3SJQ C;  1QR9 A;  1XMQ B;  4F6R B;  4P9P A;  1L1F A;  4ZKI A;  3OE7 G;  2FTK A;  4WF9 V;  1AVM A;  4K0K O;  1MZF A;  1Q5O A;  3BFR A;  3CS5 A;  3HKE B;  5EC2 C;  5IWA O;  3QO7 A;  3QNE A;  1IXB A;  3L73 H;  1HR0 O;  1ZWI C;  1QU7 A;  3CPW U;  1M57 C;  2OCH A;  3DC6 A;  1SQP H;  1FYJ A;  4L87 A;  3K9S A;  3H1L H;  5IJ0 A;  3J81 N;  4LF7 O;  3ABK C;  3AG1 C;  3RFR A;  1KKC A;  1AR4 A;  1T5E A;  3APQ A;  1TAE A;  3UKM A;  3IJ4 A;  2OT5 A;  5CBH A;  4WFA V;  5EZY A;  2PGG A;  3ZHS A;  5LGN A;  3BCC H;  4I0X A;  2YEV B;  2CTW A;  2LQT A;  3D8C A;  1N0J A;  2QSA A;  4FLW A;  2HKO A;  4O4H A;  3ZRW A;  3J7A U;  4ZHQ B;  1K4D C;  3CCR V;  4MVQ A;  3CJH A;  3SYA A;  5CN0 A;  2Q67 A;  3IC9 A;  1VQ8 V;  1Y76 A;  1YCI A;  2LO1 A;  4UFZ A;  1AI7 A;  3IFX A;  3SJA C;  1XIL A;  4X64 O;  2E5L B;  3BA9 A;  4X88 A;  4I55 A;  2ZDI A;  3H01 A;  1VQO V;  3TJT A;  1MAB G;  3I55 V;  4PI0 A;  3RYH A;  5K1P A;  2DWE C;  4AQY O;  2X7R B;  1H38 A;  4GX2 A;  4CS4 A;  4Q6G A;  1VF6 C;  2RCV A;  4O2A A;  1YSC A;  2ZE6 A;  4W4K A;  1UPG A;  4TV8 B;  4LF6 B;  4DR5 O;  2PY5 A;  1NR1 A;  1SQF A;  5IWA B;  4LFA O;  5JH7 A;  3E8H A;  2JGD A;  4JTC B;  3SPJ A;  2IJI A;  2DQ3 A;  4UCV A;  1ZL8 B;  4YHH B;  1HNZ B;  1V55 C;  1JFF B;  3AK2 A;  4DV1 O;  2A0L A;  1PV0 A;  4JI4 B;  1DF5 A;  3FB5 C;  1WPX A;  4AIL C;  1QQC A;  4NYK A;  1DK1 A;  4MTO A;  4DR1 B;  4X1K A;  3BA8 A;  3NR7 A;  4KFM A;  4LFB O;  4GUN A;  2E74 B;  1BGY H;  2R70 A;  1ZTE A;  1B3Q A;  3VQX A;  2EIK C;  4O4L B;  1ZUQ A;  2XAJ A;  4X64 B;  4BIU A;  2E5L O;  2Z0A A;  5IJ9 B;  2ARH A;  4KUM A;  2RDC A;  5EZY B;  4LFC B;  4YJ2 A;  2UXD B;  3GWK C;  4WFE A;  3OD4 A;  3T1C A;  3VOU A;  2YEV A;  3WB2 A;  4WFG A;  3K5M A;  2VQE B;  3KKY A;  3EVK A;  1US6 A;  1SQQ H;  1N36 O;  4RUF A;  3OUS A;  1Y66 A;  2D2C B;  2KG7 B;  1F4N A;  1FXK A;  1V54 C;  4QPJ A;  1VQP V;  1RP3 B;  3TK1 A;  3E83 A;  4DK0 A;  1GN2 A;  1Q90 D;  3ABK B;  3AG1 B;  4HBN A;  4GCZ A;  3MHH C;  3ZMZ A;  1MSW D;  1SS3 A;  4GLX A;  1BCC H;  4P2Z A;  4RUE A;  2HG5 C;  4D7S A;  1XUQ A;  4Z1V A;  2P4V A;  3SYP A;  2X6C A;  3RBZ A;  1SZX A;  3ZMT A;  2JK5 C;  4NXN B;  2EIM C;  2FKX A;  4PA9 A;  4ASU G;  2QWP B;  3ZJZ A;  3ASN C;  5KX5 B;  1AIL A;  2D3O W;  1AI4 A;  3A0B Z;  1CP9 A;  4CBC A;  2ZCE A;  3P3P A;  3DC5 A;  1BS3 A;  4TV8 A;  1Q3E A;  2WLH A;  1ORQ C;  4FM1 A;  2DOS A;  1MNG A;  1R3I C;  4CH5 A;  1K33 A;  4D7T A;  5LA6 A;  3UT5 A;  1IUR A;  1J5E B;  4GKK O;  3AG3 C;  4PD4 F;  2GTS A;  4I50 B;  2O57 A;  1ZL8 A;  4XDK A;  3A0R A;  1KEC A;  5B1A C;  1O9H A;  1OCC B;  2GBO A;  5AG2 A;  1V55 B;  2Y4U A;  2IH3 C;  5IT9 N;  5LMU O;  1NVP B;  4LWS B;  1Q43 A;  2Y69 C;  3MHS C;  3E35 A;  4LFC O;  1RSO A;  1YDX A;  3M8A A;  3QG5 A;  1DLB A;  4CH4 A;  4NTX A;  4FZ1 A;  5H2F Z;  1QVG U;  3ZED A;  3B40 A;  4GYC B;  5IE9 A;  5JWP A;  1WP7 A;  5L3B A;  3WB1 A;  4YJ3 B;  3N2K A;  1I5X A;  1K97 A;  3CYO A;  1VQ6 V;  3ABT A;  1FAF A;  4IL6 Z;  1FXK B;  4JI8 B;  2EJR A;  5DM6 V;  4JI6 B;  3P32 A;  1NI8 A;  3ABM C;  4HAM A;  1TVK B;  3M99 B;  1FFX B;  4CH6 A;  4QJF B;  4ABM A;  1F4M A;  4GX0 A;  4XDL A;  3STL C;  2XND G;  2VWJ A;  3BVO A;  1Q82 W;  1GH6 A;  4CH3 A;  2CAZ C;  1VQ4 V;  2C2A A;  3R66 A;  1OCO B;  1N32 O;  3E22 B;  4DO2 A;  1M57 B;  5KMG A;  3G6B A;  3K3W A;  1RFY A;  2OTL V;  4G2K A;  3K79 A;  4JI2 O;  2X0L A;  2DYR C;  4K0K B;  3OGI B;  1J5E O;  2EIM B;  3M7M X;  5BXZ A;  2V1D A;  2CE4 A;  4X8A A;  4BIO A;  3HKC A;  2YIB D;  3HKD B;  3JAW B;  4MVR A;  4PDV A;  1VQK V;  1OCR C;  1KD1 W;  3OW2 U;  5FNV A;  2AZ0 A;  3PN1 A;  2F23 A;  2YC0 A;  4PV1 B;  3OEE G;  4J10 A;  4PA7 A;  4RAI A;  1AB3 A;  3SPI A;  3ETG A;  5HFM A;  4FLT A;  2DYS C;  4DR3 B;  1WP8 A;  1AI6 A;  3FKS G;  4ICG A;  2Q73 A;  5GTI Z;  4PDL A;  4NKG B;  2BCC H;  3CC4 V;  1N0N A;  3CXH F;  3DTU B;  5D5P A;  1SZT A;  3ABU A;  3WFV A;  3LSQ A;  3AK1 A;  4Q20 A;  1FJG B;  4TQD A;  2V7Q G;  2B9Z A;  1R6T A;  3F7Y C;  4XDJ A;  4U7N A;  5IY5 C;  2ZDI C;  4IYI A;  3X2Q B;  1NKD A;  5H9C A;  3CE2 A;  3BEH A;  1AP5 A;  1JPX A;  4X1I B;  3AG3 B;  5BR8 O;  2WSS G;  1L8D A;  5CBF A;  3FAV B;  2Q0A A;  5H6Q A;  2JDI G;  3K59 A;  4X62 B;  2A7W A;  4X20 A;  3A0H Z;  3JD1 A;  4K8X A;  1W2B U;  3VBB A;  1VQN V;  5JCO A;  2CK3 G;  4FLZ A;  4FVM A;  4UVA A;  2PUS A;  1QLE C;  4U3J A;  4UCR A;  5TIS Z;  3LNN A;  2FL4 A;  3F7V C;  3FD9 A;  4JYA O;  2XAG A;  2ZE8 A;  2EZP A;  2KQX A;  5EYP A;  5A2Q N;  3OFN G;  3D36 C;  4H44 B;  4DV5 B;  3ZHQ A;  3Q4H B;  1BHA A;  4YY3 O;  1CXZ B;  4TWK A;  3ZHU A;  1NTK H;  4OPH A;  1Z2G A;  3HKD A;  1JCH A;  3RWR D;  3CCE V;  4PDR A;  3ZRS A;  1GO3 F;  1P7B A;  2K9P A;  3IGA C;  3RYC B;  1BQ0 A;  2CDY A;  4DR7 B;  4QPK A;  1M4U A;  1R6K A;  5K1X A;  5LGU A;  4JI0 O;  5CB4 A;  3THO A;  5H6R A;  1HP8 A;  1VMG A;  2DE0 X;  1YTF D;  4HZ3 A;  3SYO A;  1GK9 A;  2EIL C;  2VWK A;  2R9A A;  3L74 H;  4UVC A;  2GUZ B;  1MG1 A;  3W7T A;  1S72 V;  3E89 A;  3B09 A;  2RN9 A;  2DW4 A;  4JTD B;  4WFH A;  1RM1 C;  5GON A;  2DQ0 A;  4LH6 A;  2JIZ G;  2A79 B;  4MVO A;  4JZG A;  1R6N A;  2XAH A;  1HW7 A;  4JI3 O;  4FM2 A;  3E8F A;  3CJH B;  3T1H O;  4HYO A;  1ROP A;  2PTM A;  4NR1 A;  1Y76 B;  4X1I A;  1ARO P;  1FFT B;  1JX9 A;  1XI1 A;  1Z5W A;  4CS3 A;  2YIC A;  4LNU B;  3ZS8 C;  4D6T H;  2QKS A;  4MS2 A;  5IDJ A;  2Q69 A;  2WWW A;  3O65 A;  4HNA A;  4BW5 A;  5KHK A;  1YVW A;  3KZI Z;  2IH1 C;  3G71 V;  2IJJ A;  1H8E G;  3TET A;  4J80 A;  1GM8 A;  4LF9 O;  4KXR A;  5JH7 B;  4C7U A;  5LXT A;  1Q7Y W;  1S5L Z;  4JYY A;  4RWU A;  1EZJ A;  1GMG A;  1B04 A;  3LDE A;  1M1K W;  2F4V O;  1BSM A;  4IT5 A;  1FJG O;  4B3M O;  2UU9 O;  1EM1 A;  4JYB A;  2UXC B;  4O2B B;  1R3L C;  5J2U A;  4IIJ A;  4B3T O;  4OPA A;  2JEX A;  4X1K B;  2YSU B;  3T1H B;  3OMA B;  1IBM B;  2ZNI A;  4LBE C;  3JAR A;  1I7F A;  1IXM A;  1IZ3 A;  1EZV H;  2QWR B;  4EB6 A;  2UU9 B;  4UB8 Z;  5LBQ A;  2ZIO A;  4WBN B;  2IM9 A;  1SQG A;  1PNL A;  4IYH A;  4YJ2 B;  5KHJ A;  1X59 A;  1WB7 A;  2E75 B;  2NNU A;  4J41 A;  4K8Z A;  4FPP A;  3CC7 V;  2AXT Z;  3QTC A;  1KMI Z;  2FYU H;  4DR2 O;  1XHZ A;  2X6B A;  2EIN C;  3ZMS A;  3CD6 V;  4JI7 B;  2GSM B;  3JSL A;  1NTZ H;  1S5J A;  1DGS A;  4FLY A;  4LF7 B;  1WA8 A;  2ITC C;  3JAK B;  1NS1 A;  3RW0 A;  5B66 Z;  1XNQ B;  4EKW A;  4ZOL A;  4CS2 A;  2QM7 A;  4FJC C;  5KA6 A;  4TV9 B;  3JAS B;  1NBM G;  1YJ9 V;  3P30 A;  3UO2 A;  2AW9 A;  1WN7 A;  3RYI A;  5ITZ A;  4OXS A;  3W7X A;  2Y4T A;  5DED A;  1K5S A;  1Y4M A;  4JI7 O;  2E3C A;  4MW3 A;  1S3J A;  4UCT A;  5FPO A;  5LXT B;  3L9D A;  5L3E A;  3DSQ A;  3ZN1 A;  2VQF B;  3HB3 B;  5A9G A;  5JVD A;  2PYJ A;  4JYC A;  3S3W A;  4DW0 A;  3K0G A;  2W6I G;  1SET A;  2Q9L A;  2QM8 A;  3B8M A;  1PL0 A;  3T4D A;  1PM9 A;  3LSS A;  1RSO B;  1XL6 A;  4JI8 O;  3R65 A;  2CGN A;  2EBO A;  4FLV A;  2BTQ B;  3ZRW B;  1NVP D;  3JD4 A;  2QDO A;  1M9N A;  1WJZ A;  2IJH A;  4O4J B;  4RQE A;  2Q5Z A;  4B3M B;  5FLX N;  3CCJ V;  5JJE B;  3K9A A;  4UXN A;  1B06 A;  3B4S A;  4YHH O;  2VQF O;  4DV1 B;  4EEQ A;  2M7W A;  3BHP A;  3ICX A;  1KKD A;  4PA3 A;  2ZM6 O;  1SES A;  4I55 B;  4NTY A;  1ENV A;  4JI5 B;  1D5N A;  1H2S B;  1PD3 A;  3I5D A;  4I9Q A;  4EFB A;  1X4T A;  2PZS A;  3J80 N;  3JAK A;  4WCE V;  1L0N H;  3GWO A;  3E22 A;  1O9G A;  2WPD G;  4J9Y B;  4DV6 O;  1FD9 A;  3K5O A;  2Q0O C;  1RM1 B;  1R73 A;  3F5W C;  5BMV B;  3RYF A;  5LYJ B;  3L71 H;  1N4C A;  2ODM A;  4JV5 O;  1V9P A;  3K03 A;  5LMN B;  2EIK B;  3FX7 A;  3JAT B;  3CCV V;  3SPC A;  2F95 B;  1AR1 B;  1KQS U;  4ZIB A;  4JYA B;  4R8C A;  3QO8 A;  2W0X A;  4KHP O;  1Q6U A;  3LNM B;  3SJB C;  1DTO A;  1YF2 A;  1K4C C;  2JJ1 G;  3KG2 A;  4UCU A;  3BAB A;  4DV0 B;  2ZQM A;  3BAA A;  2Y69 B;  4DR6 O;  2ZXW C;  3UO3 A;  5EBM C;  3U0Z A;  1VIB A;  1LUV A;  4RO2 A;  1CPY A;  2OIE A;  2AHZ A;  4JAV A;  2Y0P A;  4B3T B;  1D5A A;  3PJS K;  2W0F C;  3SPG A;  4MW8 A;  4BIZ A;  2LW1 A;  1DF4 A;  2YID A;  3CCQ V;  3IAY A;  4DR7 O;  4E2L A;  2KG7 A;  3AG4 C;  5LOV A;  4U3F H;  1HDJ A;  3L72 H;  3JCU Z;  1PPJ H;  2IW5 A;  3ZHR A;  1TGO A;  3TXS A;  2L6L A;  3ZBH A;  2DWD C;  2ZR2 A;  1PL4 A;  3AK3 A;  4MVZ A;  3ABL C;  3TXQ A;  3NXS A;  2GHY A;  1TUB A;  1EN5 A;  4JI2 B;  4GKJ O;  1THZ A;  4R50 A;  3VQW A;  1H2N A;  1QLE B;  3AEI A;  1N32 B;  5C8Y B;  5E1A C;  3SGI A;  1Z5V A;  3FYI B;  1JMK C;  3E8G A;  4PI2 A;  4UVB A;  3VQY A;  2R9R B;  2Q7E A;  4DR2 B;  2YUA A;  3UT5 B;  3OUF A;  2GDS A;  3FB7 C;  3RYF B;  3SPH A;  4LF4 O;  3U11 A;  4JAU A;  1YTF B;  2UUC B;  1Q86 W;  4KP4 A;  5H5N A;  5IY5 B;  2X6A A;  3JAT A;  5CA0 A;  1BHB A;  1YZB A;  3K5L A;  2JS5 A;  2QTS A;  5FPR A;  4WFF A;  2EIL B;  1AJQ A;  1LR1 A;  2PF4 E;  3ZN0 A;  3RYC A;  3OTF A;  3GB7 C;  4MTF A;  1PNM A;  2LFS A;  2IU0 A;  4FFK A;  4X66 B;  4LFB B;  3SYQ A;  3QO5 A;  4I7Z B;  4IGG A;  1FPO A;  2KKW A;  3OT7 A;  1GRJ A;  3EHB B;  4N21 A;  1W59 A;  4O4L A;  2OCC B;  4X89 A;  4DV7 O;  2OYQ A;  2GUZ A;  2NR5 A;  4W4L A;  2P06 A;  4ZI7 B;  2NN4 A;  4I4T A;  1AJN A;  2HP8 A;  3JSN A;  2Q68 A;  3K04 A;  3A2F A;  1K92 A;  5IYC O;  5GON B;  2IU3 A;  1Y6X A;  1ZAU A;  5LOV B;  1BT8 A;  1WLE A;  1BL8 A;  2WLI B;  4K35 A;  5KHH A;  2LGQ A;  3OTO O;  3ABM B;  3LSU A;  2ZIN A;  4DV4 O;  3HPL C;  3OR6 C;  2KSD A;  4AI8 A;  4MTX A;  3TGU H;  5KUK A;  2EIJ C;  1Q8I A;  2WLL B;  2HR3 A;  1MMM A;  3S3X A;  2EJ7 A;  4B08 A;  4FM0 A;  2CGO A;  3FYE B;  4I9W A;  1VQ7 V;  3A8T A;  5C8Y A;  2XUM A;  5J2T A;  1P84 F;  4AQY B;  2JRI A;  2ZIM A;  1VF7 A;  2B5U A;  4QE7 A;  5KX5 A;  1NH2 B;  1I0H A;  4GX5 A;  1QCE A;  2F93 B;  4GX1 A;  3OAA G;  5B3S C;  1KUQ A;  1QR8 A;  3APO A;  2RJZ A;  2IJK A;  1XMQ O;  2XAF A;  1OCZ C;  2WLN A;  5LA6 B;  3AG2 B;  3AG2 C;  2RMK B;  4DYL A;  2N05 A;  2UUB O;  3W7S A;  4J7K A;  2BE3 A;  4TUY B;  2PI5 A;  1N36 B;  1XNR B;  2ADQ B;  5LGT A;  3CMA V;  1WPB A;  5JJJ B;  3D3Q A;  3K08 A;  4H13 B;  1FKA O;  5EIB C;  2A3Q A;  4I5S A;  3VQV A;  1ZSP A;  1JQ0 A;  4DXW A;  2CTP A;  4F4L A;  4P30 A;  4O4I A;  1NU1 H;  3CB2 A;  4JI3 B;  4LF5 O;  2P22 C;  2WA3 A;  2Q7G A;  2H3O A;  1JOY A;  3ML0 A;  2XAS A;  4QE9 A;  1WNS A;  2DJV A;  1AJP A;  2BSK B;  2OIG A;  2ADP A;  2QWO B;  3MDS A;  1N8R W;  1G1X B;  1U97 A;  4Z1M G;  5BY1 A;  5KHI A;  3X2Q C;  1AI5 A;  1OHH G;  4YJ3 A;  5EK0 A;  1A32 A;  2ETN A;  3E86 A;  1XQ8 A;  3N2G A;  5LHI A;  1HNZ O;  2ITD C;  4UV9 A;  2DMX A;  1YIT V;  2WLI A;  4U7O A;  4DUZ O;  1AP6 A;  1V54 B;  1PKX A;  5DEC A;  4LCU C;  1MA1 A;  1S0V A;  1G4Y B;  5KMG B;  3LUT B;  1URF A;  4TOI A;  2A06 H;  2UUA B;  2XOK G;  2F4V B;  3OGC C;  3CRQ A;  2B1I A;  3KCX A;  4YIP A;  1TUE B;  2JJ2 G;  3CRA A;  4FFB B;  5ITZ B;  3W7W A;  5EBL C;  1JJ2 U;  3DXR A;  2JS3 A;  4LF6 O;  2GV9 A;  2QM4 A;  4F6R A;  3T1Y O;  1N33 O;  1YJN V;  5EBW C;  1WB8 A;  4LP8 A;  2HEP A;  1XBL A;  5CB4 B;  3LDC A;  2JEU A;  4NB5 A;  1K3E A;  4FLU A;  5L3F A;  5LP6 A;  1YXB A;  2YS8 A;  1MSD A;  5LHH A;  3CXC U;  2QEX V;  1Y74 A;  3CHX A;  2P7T C;  2F43 G;  4NXM O;  1R3J C;  1IBL O;  1NT2 B;  1SF9 A;  1GN4 A;  3H9V A;  5D5Q A;  3CP1 A;  1NQT A;  4O4I B;  2DN9 A;  4I0X B;  2BTQ A;  3FB6 C;  3O9O A;  4KHP B;  4O4H B;  2UXN A;  4AHC A;  3G6E V;  4ZHQ A;  3ASO C;  5B3S B;  5KAF Z;  1MZE A;  2UXD O;  1EFR G;  3WG7 B;  1IBL B;  2P6J A;  3ASN B;  2KB1 A;  2ZNJ A;  3OR7 C;  3K0D A;  3FAV A;  4TT3 G;  2YIB A;  2EIN B;  5DN6 G;  1EN4 A;  1SC5 B;  4HNA B;  1FXK C;  4NXN O;  2CTQ A;  4ZBM A;  2UXB B;  4QGP A;  1BE3 H;  2YXY A;  1YI2 V;  1HNX O;  1K34 A;  4U3J B;  4KL1 A;  1OJH A;  5KUM A;  1VF6 A;  1HNW B;  5L3C A;  3FB8 C;  4DV4 B;  2H94 A;  2QJ1 A;  1FXH A;  4UUJ C;  4JI6 O;  2JGU A;  5BMV A;  4GKK B;  1L0L H;  2N04 A;  2R9I A;  4JGS A;  1K7D A;  4FFB A;  2G38 A;  1G6U A;  1B6Q A;  3DXR B;  3G80 A;  4DR4 B;  1VEW A;  2P90 A;  4P9O A;  1JFF A;  4PEL A;  3MAQ A;  2EX3 A;  4JPR A;  4LWS A;  3E2E A;  2QTO A;  1Q6H A;  5L3G A;  5J2U B;  3JAL B;  1SA0 A;  2CTR A;  3H1J H;  5LP6 B;  1XDC A;  4MVS A;  3CRC A;  5HFL A;  1KYO F;  3I56 V;  3DGE A;  4DV2 O;  2QR4 A;  3CSX A;  1GKF A;  5JQG A;  2F1M A;  1SQV H;  2Y48 A;  3AG7 A;  1MOF A;  2IBZ H;  4B3R B;  5IJ9 A;  2V4D A;  2Q8V A;  1VP7 A;  3ETD A;  4DR4 O;  3JYC A;  4LH7 A;  1H8H G;  2WAM A;  4EFE A;  4K3A A;  2OWO A;  4NVP A;  4BR6 A;  4X1Y B;  3ABL B;  1KBH A;  5FL7 G; 
#chains in the Genus database with same CATH homology
 3CJH B;  2BSK A;  3DXR B;  3CJH A;  3DXR A;  2BSK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...