3CJQB

Ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 in space group p212121
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
140
structure length
121
Chain Sequence
b'KKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVAAFNAATANMGDAIVPVEITIYADRSFTFVTKTPPASYLIRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVVGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein L11 methyltransferase
publication title Multiple-Site Trimethylation of Ribosomal Protein L11 by the PrmA Methyltransferase.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase/ribosomal protein
total genus 22
structure length 121
sequence length 140
chains with identical sequence E, H
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2720 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3cjqB02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 3cjqB01
5DM7F 2ZJPF 2E36A 3J7ZI 2K3FA 3CJRB 5GAGJ 3EGVB 2NXNB 3CJTB 3CF5F 2JQ7A 5GADJ 2E34A 2E35A 3CJQB 4UY8I 1MMSA 2ZJQF 3J7YJ 4V19K 5DM6F 2H8WA 5GAHJ 3CJSB 1WIBA
chains in the Genus database with same CATH superfamily
2ZJPF 4HX4A 3EUHA 3K1NA 2HU9A 2V1DA 2K9SA 4RAZA 1MJAA 1VQ9I 2NOJB 2D1HA 4AVZA 4M3BA 4RGSA 3J81Z 3EUHC 2VKVA 2K85A 4KN4X 4WX9A 4HSTA 2LBFB 1N75A 4FX0A 5FFZA 1SANA 4E4HA 2UXNA 3IKVA 2HQRA 3T0YA 3QYEA 2V1NA 2PG4A 3HXLA 4BQQA 4ZYGA 1Y39A 3ESWB 3MQ0A 1YHQI 4KMFA 1JTYA 5BPDA 1VQ4I 1UG2A 1UMQA 2BE5F 3G73A 1UELB 1V5GA 3LSMA 3FXJA 4D5CA 1GDTA 2R7ZJ 3K70D 2KKOA 4M3EA 3O8GA 1RETA 1WWXA 1X3UA 2DI3A 5F0FA 1VQKI 2ECBA 1OCCH 4GYIA 1LJ9A 4A0YA 1OCPA 3TP0A 5CPRB 1HLVA 1K4SA 4XRFA 4CICA 2VJ4A 3CQZJ 4HV6A 1ODDA 2KT0A 2HNHA 3MWMA 5GTIC 3AKZA 2P7CB 2CRGA 3VYUB 2DDBA 2EZHA 4GXOA 2EIJH 2XGEA 4X1EA 3OYAA 4ESBA 2VC0A 3OYFA 3PQKA 4O5VA 4FX4A 1ON2A 1MH4A 4XORA 3PNYA 2NAZA 3ZQHA 2V1XA 1BW5A 1CF7B 1OYYA 2K40A 5M3FJ 3C18A 4YIRX 1AKHA 2EK5A 2NVYJ 1SVLA 5KAFC 2PI0A 5DV5A 1AWCA 1FYLA 4PK4A 3KYLA 5IPAA 2Y9ZA 1O3SA 1TBXA 2Z33A 2K27A 1ZYRF 3K69A 2X1DA 3FXMA 3PFIA 3A01B 2E60A 1TLHB 3BG9A 2C6YA 2K7LA 4BJTA 1W0TA 1BI2A 2CQXA 4FASD 3IWZA 2GOMA 2G7HA 2VJJA 3VEPA 1I5ZA 3ECHA 2HR3A 2BOLA 2F48A 3HOZJ 4HZFA 2ELHA 1RPWA 3HSRA 1N25A 1G3SA 1K79A 3E5QA 3TKYA 3OYDA 2Z9OA 3OMYA 2WAQN 1MBGA 1KQ8A 2E1NA 2PMZN 1E3HA 3JTGA 3CC7I 5ED4A 2XAQA 5AONA 4QLCU 3JRFA 3FXKA 3BR6A 2OTLI 1P6RA 1EJ9A 3WHCA 1X1BA 1ZH5A 2Y2ZA 2WADA 5D6FA 1MBEA 4HW0A 5F27A 3OYEA 4MTDA 2LH9A 2QSFX 3OYJA 2JA7J 3IAS2 4PJNA 1VQMI 1J59A 2NVTJ 1MMGA 4S04A 1T2KA 3DQVC 3PIOF 2HKOA 2AXTC 2RREA 2WC2A 2M7BA 2DMPA 2VN2A 4DYQA 3FX3A 3DXJF 2PN6A 2DOFA 1PUFB 4HF2A 3ZMTA 2A5WA 4JOMA 4HA8A 2BBYA 2R7TA 2EFOA 1FT9A 1APLC 3ABLH 3GFIA 2H09A 3KZYA 1K61A 2O03A 5D8KB 1JKRC 1TTYA 1XD7A 1HKTA 4CCNA 2WV1A 1TQIA 3PNTA 2KIFA 4LG0A 2GIVA 3ONQA 5IP6A 2Y48A 2TDXA 1GHCA 1RR7A 2FXAA 4I98B 3X2QH 4Q5SF 2DTZA 4DZPA 3IV5A 4U0VA 5FKMA 2HQ5A 3B6AA 5HDGA 3MZ8A 4CO8A 2LK2A 1O7FA 4L9JA 1S7OA 1XGSA 3P9IA 2XROA 2NYXA 2TRTA 4UNOA 2EZIA 5D4SA 1PYVA 1Y8RB 3MVPA 1GVDA 3TO9A 3K4LA 2Y0SA 5B5EC 4FT8A 2W4SA 4NUBA 3M4OJ 2E19A 2XKPA 2VXZA 3WTWC 1U6GA 5EF6A 4KDPA 2QQ9A 3I59A 4EJTA 4LITA 5DYMA 2DMUA 1YJWI 3D1NI 4HLXA 4DYCA 4ZYEA 5JFRA 9ANTA 2F6CA 3F23A 1X2MA 1PDNC 3WU1B 1OFCX 2H6BA 1YRNB 5BPIA 3MKLA 3PJRA 2OUMA 1ETKA 1FPQA 4A3IJ 3RZOJ 1I39A 1R22A 1W4MA 2AHQA 1IRFA 5FKLA 5JHUA 2IS6A 4HDUA 3QU3A 4U7BA 1Y56A 2B9SA 2VPRA 4XLAA 2D45A 1FWZA 3ERMA 2LLKA 3GF2A 2DYSH 3OV8A 4AU7A 5B3SH 1GXQA 3LA3A 3R0JA 1T08B 3HTSB 3TW6A 1WCMJ 2L01A 1MDMA 1JUSA 1MSEC 3NAUA 3PUFA 4QPOA 5DTDA 3GBGA 2EH3A 4I01A 4QIWN 5LHIA 4ZTFA 1WGXA 4A0XA 1LE8B 3J7YJ 2LP0A 1OCZH 5LHHA 2Y69H 5FO5A 1UHWA 1VI0A 3H9GA 5FLXZ 2QQBA 3V4GA 1QA6A 4EGYA 4F52A 2DFIA 3BC8A 3FISA 1I50J 2A6HF 1O3TA 2X0LA 1W36D 2HDWA 2G0EA 4PGHA 2COBA 1ZLJA 4BHPA 5FLVA 4B43A 1V3FA 1R23A 5HNFA 2FE3A 4XL9A 1IRZA 2OF7A 3B6CA 2XDVA 4UXNA 1R1UA 1PJRA 4Z6YA 3HSEA 3HBLA 4N9IA 3J7AY 2H8RA 3U9GA 1ETWA 4L9VA 2ZCWA 4BS9A 1YTYA 3PSIA 1R9TJ 1IG7A 3BCBA 4NQWA 2R7FA 4ZZDA 2AO9A 1YS7A 1H9GA 1OMIA 4Y52J 3PQJA 1FZPB 2KQRA 1W1WE 1XPXA 4ABZA 1U9OA 3N97A 1WH5A 3PM1A 1JHFA 5LRRA 1ZG5A 2L0KA 4M74A 2FU4A 2M5WA 4FCYA 2VQGA 2OZUA 2QSGX 1BA5A 4S05A 3ECOA 2W48A 2XC7A 1HKSA 2M87A 4PGGA 1YITI 3JRBA 2HWVA 5EG0B 3J80Z 1U3EM 4Y33A 5F08A 1X1DA 3DTEA 3DBRB 4UUSB 4G6DA 5EEGA 1MKMA 3HGYA 2EWNA 5ILUA 2K4BA 1H0MA 3GTMJ 5KK1A 2F5DA 4AUXA 5L3GA 2WBMA 5FGMA 2CFOA 2DN0A 2DTRA 2JMWA 3OYIA 1J2XA 3HB9A 3GZNB 4E7IA 5JLWA 4ENNA 3E7LA 3F6VA 1P4XA 1AKHB 2MBFA 1LVAA 4ZZLA 2VONA 4DIQA 3G3ZA 2HTJA 3OYLA 1RESA 2R7QA 4J01A 3F3XA 3V8LA 4CYCA 4IHYA 1RI7A 2V6EA 3TP3A 2MFZA 1A6QA 3VYRB 2DMQA 4JBAA 1YFHA 3TMOA 3FXUA 2I5UA 1N77A 2ZB9A 2EINH 3P9CA 3ZMSA 2CG4A 1QPMA 2ZNYA 4BQOA 3GO5A 3OSFA 1ZRCA 3C7JA 4HRIA 2VIXA 1HSJA 3Q0WA 1XS9A 2VQHA 4G6QA 1HDDC 4C3JJ 4BXFA 3ULQB 1MBFA 2H6CA 5GP9A 4IO9F 4A3EJ 3M8FA 2QBYA 4K2EA 3K4JA 4Q48A 2DMNA 2IA0A 3BTCA 1QBJA 1ZRFA 4QPQA 3HTUA 4CCKA 5K5RA 3LL7A 1R00A 3AFHA 3AG3H 5LGUA 4PJMA 2VUMJ 1G2HA 4BBRJ 3C3WA 3GX4X 5J8CA 1M1EB 3NEUA 1R5ID 3MN2A 3DCFA 2JZYA 5HOOA 3WTZA 1HQCA 4I09A 5ICFA 2CQKA 5FKKA 5D5WB 2R5YA 2CUFA 3HOYJ 4AYBA 3I4NJ 2GZWA 2Z1DA 4YELA 4DW6A 2RN7A 1OR7A 3KE2A 1QQIA 4PZJA 4L18B 4EEFG 1G59A 3ABMH 3P9KA 5EDNA 2D1VA 1OR7C 2DT7B 1B8IB 2Y0MA 5KNLA 4R79A 2BGCA 5TISC 5E79C 2WAFA 4M3DA 4DJAA 1D1AA 4MQ9F 3G6EI 4BNCA 1QZYA 2K9NA 3R0AA 4BHCA 1MD0A 1KZHA 2HOTA 2IP2A 2Z16A 1I27A 2XAHA 3VSLA 2LC2A 1JKQC 4A3KJ 3DPUA 2IGKA 3GUDA 1JTXA 4DQ2A 5ILVA 2DA6A 1XMAA 3I54A 1JUPA 2Y31A 4XICA 1F5TA 4MFDA 1IGNA 3TO6A 2CMPA 2HDCA 2VOPA 2DCEA 2HOAA 2R7XA 4KUMA 1SMTA 4ON0A 1GUUA 3OS2A 3BP8A 3H1CA 4BJ6C 2DO7A 3J81K 3CTAA 2XB5A 3DU6A 4AD9A 2XPUA 3OYNA 4XKVA 1RZ4A 2KDOA 2F5CA 2NS7A 3H3ZA 2GLOA 1J5YA 5E1WA 2D5VA 3ZRGA 2EA4A 1XCVA 1VQNI 3FDYA 2DPDA 1LEAA 2V9PA 5K7HA 2JUGA 3S1NJ 3ABKH 1ETYA 1KQ0A 2XF7A 3MMYB 2OD5A 4LGWA 4UHTA 3S3OA 2LD5A 4G7OF 1ORKA 2Z3YA 3BG6A 1RUOA 1WRJA 3W2VA 3M3YJ 3HG9A 4U0YA 3IAM2 3DPTA 4KIBA 2WAQA 3DLAA 5J4VA 2ISZA 2LRDA 2CQ7A 3DTKA 3LNQA 4AC0A 3LWFA 2ZFWA 1TT5B 3TOAA 4E7SA 3O8HA 4AIJA 4IL6C 4RGUA 1ZARA 1J75A 2J5OA 3FHZA 3KYCB 2A07F 3BDDA 1BL0A 1SFUA 4NC8A 4W1UA 5HVQC 4ZTJA 2EZKA 2VC1A 3JW4A 5IOYA 1X19A 2K9QA 1FIAA 2MA3A 1BI3A 5L3DA 4RLFA 4MGRA 2VL8A 5BNGA 3MKYB 1MDMB 3DF8A 5F1RA 4GRIA 4A5MA 2QVOA 4IEJA 5J1UA 4E70A 5F1JA 3VFZA 1ERDA 1K4TA 2E71A 1QHGA 5FD6A 2WY7Q 4AIDA 1W5CC 1MH3A 2JA8J 1ETVA 1XX5A 2HPIA 1QVUA 3R61A 2CYYA 4ANJA 2WB1N 4CZZA 1YI2I 3IWFA 1X3ZB 2OTJI 2QCOA 3A0HC 1RNLA 3HYIA 1SAUA 3GMEA 2ZFUA 1MZBA 2FSWA 2M9HA 1S9HA 1W7PA 3CCRI 3E6MA 1VTNC 3B73A 2DA7A 1JKOC 1TT0A 5DM7F 1HF0A 4XLPF 1DU6A 4RA2A 1XTAA 1WSUA 3DBLB 4BY7J 1W0UA 2BY0A 1Z0XA 4FETA 2F5VA 3CUOA 4XONA 1Z7UA 4PJJA 2QYOA 5FB2A 3GTKJ 4B3AA 2N8GA 2B0LA 4BE1A 1EH7A 1JJ6C 5TJJA 4B1RA 3EUKL 2Y75A 1ZAOA 1WIBA 1T0FA 3OIQA 3DEWA 1S6LA 3ZMVA 4F3QA 3ML6A 3ZR8X 2P4WA 2EBIA 1XSVA 3JAMZ 2IA2A 3DKWA 4R1HA 2ICWG 3WTUC 1HBXG 1LKXA 2DFEA 2XASA 4FQGA 5JVGF 4JK1X 3SDBA 1X4OA 2HDDA 2ZSHB 4RBOA 2L7MP 2VKEA 1PUEE 1B9MA 4XLCA 2DA2A 1GVJA 3JRAA 3OY9A 3L09A 4HV5A 4LOCA 2DFHA 2KL4A 5K7ZA 3QPHA 2QQAA 3HOSA 3HUGA 2DA1A 2DOAA 3OIPA 5E8IA 2BW3B 1K78B 3GYHX 1KU7A 1RKTA 2XSDC 3K2ZA 2Q2EA 2IAIA 4MQVA 4AVPA 2WAEA 4NHJA 4MIMA 3IC7A 4IKFA 1W7PD 5JHFA 1YG2A 5FRMA 1QRYA 3K4CA 2KISA 1U9NA 3IUOA 1JHHA 1T56A 1GXPA 4QSHA 4EVIA 2A68F 3G1LA 1B72B 2NNNA 3LQRA 2L3DA 3CC4I 3SQNA 2FNPA 5EYRA 5L3BA 4D7NA 2R7OA 1IN5A 4UB8C 5KCMA 3RPQA 5L3EA 1U2WA 1ZR4A 1LPQA 3CUQA 2XKOA 1D1BA 1ZG3A 2DA4A 2WA0A 1BR4A 2K4JA 1VQ5I 2IGMA 1XMKA 1N78A 3EGVB 2W57A 3GTOJ 4XRSG 3HOUJ 2V9VA 2GXGA 2YSRA 1Y8QB 2P7VB 3CUQC 1J0RA 1P9QC 4BY1J 3JRDA 1Z1DA 2NOGA 3RSNA 2X6OA 2JA6J 4BACA 3DTIA 1GT0C 1FIPA 2F5FA 3RPUA 1WJDA 2EZLA 3KZIC 4IJAA 1BW6A 3KFWX 3OS1A 2XAUA 2GXBA 5D8LB 4G7ZF 4CCLA 4ASNA 2BVMA 3GFLA 4XRMA 1QZEA 1SD6A 5GADJ 4M72A 4NNJA 2XPWA 2IS2A 2HYFA 2NNYA 3NWTA 2W00A 2XB0X 2CQQA 1PVEA 5J8FA 1IUFA 3CCYA 5B1BH 2O6GE 2KIUA 1MW7A 4E6KG 5FD5A 2X4HA 4KIGA 4BDYA 3MZHA 2O7OA 5FLXK 1LDJA 3SZGA 2KZGA 3L2QA 2LVSA 3QOEA 3FXLA 4G8XA 3DEUA 2M0CA 1XG1A 4CXFA 2ESHA 2R7DA 1TP4A 1HKQA 1XDSA 2EFQA 2X6WA 3TGNA 5E17F 2L9NA 2MLGA 2ZXJA 3FZVA 3KYDB 4CHUA 3RQIA 3BCAA 1FOYA 1YOVB 1TC3C 1H8AC 4RAYA 3RTRA 1QVTA 2DODA 3GFJA 3LA7A 3ISPA 2ZBKA 1YQAA 1E3PA 1SFEA 5KVRA 1ZREA 4OIQF 3TQNA 3GFMA 3RIRA 3BJ6A 2BY1A 2JA5J 1BR2A 3F0CA 3KLOA 4M6YA 2P8TA 4H4KC 3A03A 2M7AA 2CO5A 2VODA 2MH2A 2BVLA 1XC5A 2FD5A 3H35A 5FKNA 3HEFA 4FHTA 3RPUD 4B8XA 1Z77A 2ESNA 2PMUA 5C44J 1NG7A 4I99C 3WTYC 3I71A 3W2WA 2ZJQF 2A5YB 5H20A 5D5XB 2FQ4A 3HPGA 2R7UA 3H9QA 3S93A 4RMNA 1FMVA 3REOA 1OCOH 1S7EA 3OYKA 1NK2P 1KU3A 4HDVA 3M9AA 3BTJA 4I6ZA 2LY2A 4A69C 4EGZA 2EA2A 4DOZA 4MFEA 2QGUA 3HKZN 3OOUA 5LGNA 2Y30A 3H0DA 2W84A 5LGTA 2CJJA 3H0GJ 4XM3A 2ZKZA 3E1SA 1FP1D 3WTVC 3GWZA 5E20A 4ESFA 2R92J 2L4AA 5DUIA 1U78A 2STTA 2R7VA 4C2MJ 2E1CA 5J3LA 4LLGF 2L7ZA 3MZYA 2EFWA 2HVRA 3FMSA 2W25A 2E7XA 5GAHJ 5D4RA 4BDZA 2CU7A 3HRTA 1RR8C 1O57A 4LIUA 2ME0A 1FBUA 2NS0A 2VJ5A 4MTEA 2TCTA 4JX4A 2IEKA 3C1DA 1YIOA 3QYBA 1IXRC 4HG2A 2JTVA 3L9FA 4N4OB 2O8KA 4C2UA 5F64A 5BS6A 5DCFA 2D2WA 1X3WB 2E1MC 2E34A 3SZPA 2GA1A 3H36A 3ZMUA 4GO1A 1HSTA 4LFUA 3LSHA 1VQPI 3L2RA 3QOPA 4G6TB 5DUKA 1QHHD 4RAGA 3GZ5A 5DCMB 1SD7A 4MEXF 3CJSB 2XGCA 2W82A 1BN5A 2OCEA 4OOIA 4E7HA 2NVQJ 1D8JA 1ZTRA 1QZZA 2M4GA 4LG3A 2LR8A 4XOTA 3KP2A 4KJZA 4NDLA 4XKCA 3C2BA 4OMZA 4D1QA 3FBIB 4XK4A 2GM4A 2DU9A 3H9JA 3LSGA 5LEKA 4B09A 4BXXJ 5HLGA 1WJAA 2O9LA 3PL8A 1UHMA 3ASNH 2AQEA 1OLTA 2DDAA 1R49A 2GWRA 4CYDA 1D5VA 4EJVA 2XPVA 1XSXA 2YUSA 3UKGA 1ETOA 2IGNA 2VBWA 2XAFA 2E36A 3QPLA 1ZG1A 3MKWB 4FE7A 1CQTA 1W36C 2EV5A 3ZMDA 4F55A 1YE9A 3DV8A 2CUZA 1U5TB 3LA2A 4LLNA 3FF5A 4IQ4A 3TOBA 1X1CA 1Y0NA 3S15J 3V8JA 4BE2A 4HF1A 3L7WA 2ACJA 4RDUA 3CJNA 2BHYA 2B7EA 2RKHA 2JSCA 5EZHA 2R5ZA 4FE4A 2ETHA 2GBYA 3S1RJ 1IRXA 2HGCA 4E7JA 2QLZA 1K6YA 2HXIA 2CH0A 2MSYA 2IW5A 2MLKA 2X6XA 1ETXA 1YS6A 5HDKA 4XRSA 3BJAA 1RKWA 2YU3A 1USTA 1AOYA 1DUXC 2XSJC 3JSPA 4AIHA 1QU3A 4XLEA 4Q47A 1HOMA 3CF2A 1ZLKA 5IT9K 2WB1A 3MAJA 2OBPA 2IXSA 2RAEA 4BUPA 2BYVE 2PJRB 4BYYA 1NHAA 4KMUX 4II3A 4HAMA 1MBJA 1LQ1A 2WY8Q 4A12A 1ZHFA 2F4MB 4CUGA 2MD0A 3M8EA 5CVIA 3E6BA 1I3AA 1MMDA 1ZKGA 2VBYA 2RQPA 3K1MA 3G4SI 2GXAA 2ZXWH 2ZMEA 4RLQA 1DPUA 3C2HA 2MC3A 4WXCA 2KPMA 4M6XA 2VPLA 4E7KA 2K02A 2ZMEC 3H5NA 2V6CA 2ELJA 2VI6A 2OV7A 5A2QZ 1G3TA 1SFOJ 4EJOA 3DPLC 2KP6A 1H9TA 1IUYA 2L9VA 5DS9A 5FROA 3HOTA 3HGGA 3BZCA 3T8RA 4HBLA 2FA5A 3ZQ7A 2KRCA 2F4OB 3TBIA 4BE0A 2NVXJ 3P5JA 5LD2C 3K7AJ 2Q0OA 2VB6A 5E1XA 3RJPA 2AQFA 4WWCA 3S17J 5J6XA 1V55H 1O4XA 5DD4A 5H6RA 3IRRA 1Z91A 1HC8A 1P92A 3AL0C 1LFPA 3VSKA 1FSHA 1UZCA 2CSOA 2JT1A 4PSWA 4Y7NJ 3I64A 1USSA 3K10A 4M9SA 5J4YA 3W6VA 2DFFA 2JSPA 3QODA 2X48A 2GOXB 4ZC3A 2YPRA 3DKYA 1FBSA 1VQ8I 1YIJI 1FJLA 1G3YA 1LEBA 2L2OA 2VXDA 3OL4A 5ILSA 3L2CA 1IN6A 3CLOA 4A6DA 3ZN1A 4UVBA 1BR1A 4L9TA 4Y13A 2MABA 2L4MA 2DYRH 1UJ8A 4LK1F 2XF6A 2Z99A 1WJFA 5E1ZB 4A0ZA 1KU2A 1JJ8C 4HYEA 3L00A 4KITB 1E3OC 1RC9A 2LF8A 5EGOA 2A3SA 4IRIA 3SEZA 1OCTC 2BZTA 3K2AA 2CUJA 3JRIA 3ZGKA 3BG5A 4BJ5C 5HNHA 1B59A 2MW8A 1FEXA 5DM6F 4ZYAA 2E2HJ 2JN6A 2GAUA 4CGZA 2BY3A 3FXOA 3CP8A 2IS4A 4YFKF 1Y1VJ 3BY6A 3I58A 2CW8A 2DBBA 4XSZF 2BHZA 2RNGA 4ENMA 2RDPA 3FKIJ 2OC6A 1D1CA 3H3UA 4RB1A 2ME6A 1MBKA 4IF4A 2M34A 1SD5A 4P5OA 3F22A 2VASA 2P5VA 3CMYA 1FNNA 1OISA 4B47A 4A5NA 3BT9A 4EV0A 1J09A 4ZYDA 4B4CA 4Y4RA 2BXYA 3HRUA 2ID3A 3BROA 5L3CA 2E2IJ 3UR3C 2QZ8A 1I6HJ 1MNEA 1V54H 1JKPC 3DLLF 1R5HA 1G3WA 2FMLA 3K1PA 4A2UA 1YYVA 5HS8A 4U7DA 1HXDA 2JQ7A 1ZELA 3I0TA 1ULYA 2X6YA 3FM3A 4ZDOA 4PFOA 2W1OA 4B3XA 2DPUA 3SFZA 4Q4ZF 3A2KA 4N4NB 1EH8A 2EFNA 4LG0B 5AIPA 1IAWA 1BOBA 2IA1A 4U88A 2ZC2A 4LB6B 2FBIA 1ETQA 2K86A 2QENA 4Y3OA 3GTGJ 3WGIA 3U21A 1Z9CA 1P4AA 2VKHA 2V9KA 2IJLA 5JLXA 1XGOA 3CMAI 5J40A 1UCRA 3KEOA 3IKTA 3S14J 2ADUA 2JVGA 1FTZA 2KFDA 4OAZA 2RNJA 5LFAA 5K5QA 1Z7LA 4I76A 2LNBA 5F0CA 4YRVA 3CESA 3VPRA 4CH7A 4KFCA 1WI3A 2V79A 3K4BA 1E17A 1P7JA 2LG4A 3I59B 4PFPA 2VKDA 2PMHA 2FBKA 4DGWB 2ISYA 2VBXA 1R5GA 3JRHA 3QAHA 5IYBJ 1NG6A 4EM0B 4I7HA 5HLIA 3OYBA 3HIFA 3HKZA 1MBHA 2PJPA 2YR2A 3BR5A 4A3JJ 2HEOA 3NWSA 2HKXA 1ZR2A 1CF7A 3BTIA 4IHWA 4IRHA 4F7ZA 4BGDA 1MSFC 2L5QA 4IRGA 2PMZA 5EEHA 1EKEA 4A3GJ 3SXYA 5CVUA 4EM2A 2QM3A 1PP8F 2M8GX 2OU2A 1VFCA 4ESJA 3F21A 4G7HF 2W7NA 2IBDA 2MC4A 2H1LA 2OCCH 2MD5A 3RKWA 1Z3YA 3AG4H 5IP9J 2XF5A 5IY5H 1SVMA 2V4JC 4WXDA 4M9ZA 2IS1A 1WKMA 3M1EA 1IF1A 2R3SA 3U1KA 3QWLA 4HEA2 3EPZA 4CA0A 2K5CA 1WFXA 2HPMA 1MGTA 2M1BA 2LDUA 3CMMA 1TQMA 2M8EA 3I4MJ 3S8PA 2VQLA 4RB0A 3S32A 5BMZA 4IXAA 2YS9A 4ITVA 3IH4A 2DJNA 4PJLA 3OOPA 5L3FA 2YX7A 3BPXA 2H94A 3OIOA 1TZLA 2ZMEB 1YX5A 1I6XA 3CJRB 1I3QJ 3PNVA 4YIIA 5GTHC 4A3LJ 4D5FA 1DDNA 1KYWA 4L5IA 4J19A 1D0ZA 1D8KA 3VDXA 3LAPA 4B48A 3M8JA 2Z2SB 3A02A 1BI0A 5LBQA 1PUFA 4A3DJ 2LTPA 5DDGA 1YJ9I 3IH2A 4GCVA 5K7FA 4MLOA 4UVAA 3UNGC 3LOCA 1UAAA 2DMTA 3FXQA 3K0LA 4NQWB 2KDZA 2KLOA 3QYFA 1ONVA 3QP6A 4OIOF 3VYSB 1TWGJ 2X85A 1WH7A 1EH6A 3F72A 3S2DJ 1S3JA 4EMSA 1LFBA 3NQOA 3WTXC 1T0FC 2ZJ2A 5FRNA 2FNAA 2R7WA 3TO7A 1EF4A 4XQFA 1VQ6I 2E1OA 3QQAA 3RZDJ 3BJOA 3Q9SA 4BXUA 3GTJJ 1WJEA 2MGQA 2XIGA 3FXRA 3VWBA 1Q1VA 1LDKB 4MEYF 3EDPA 3EUAA 3IHUA 4Y17A 1FBQA 1OQYA 1R6RA 2AS5F 4BQNA 2EILH 5E3OA 5M5YJ 3GCMA 1YJNI 1FSEA 5BQTA 2P6TA 2GQQA 4IOCF 3MD2A 1F1ZA 2AXLA 1GV5A 1IDYA 1G6NA 5E3NA 3CCJI 2LY9A 5BOXA 3IL2A 4U87A 2ZNZA 2H27A 2LKSA 2OA4A 2EPFA 3CDIA 3FM5A 2X51A 3IH3A 2DA3A 5HS9A 2CWEA 2XVCA 2DLLA 3ZN0A 1WHUA 2UXXA 1YRNA 3HSFA 4F92B 3LSIA 4XLNF 2HYGD 2JRMA 4L5JA 5HS7A 4IHVA 3G71I 1MMAA 1FX7A 4NB5A 4CYCB 3ZPLA 5J1YA 1DQUA 6PAXA 4A3CJ 2JJ7A 5EEAA 1WVRA 5F04A 3IP4B 5ERIA 1D3YA 2DW4A 2FUG2 3GVAA 4M6VA 3HHHA 1R1VA 2OAZA 3HHGA 3PIPF 1WJ5A 3T8TA 2OPTA 2EB7A 2QBYB 3KIOA 4D9JA 4O6JA 1ON1A 1TNSA 4RB3C 4KT5C 3BR0A 1STZA 2HFHA 1WQ2A 2ID6A 2XHKA 4YFXF 1QGPA 4RM3A 2HZTA 1S7AA 2ELKA 3MKZA 4LLLA 5B66C 3D5LA 1I1SA 1BJZA 3V7SA 3HM5A 3S3NA 2CV1A 3WE2A 3HC7A 2LKXA 2O8XA 3RCOA 1LB2A 1P2FA 3WODF 3CLQA 2M2EA 2R5YB 4RGXA 4MNUA 4RM2A 2DQLA 1KQ9A 2FOWA 4RAFA 4DNCA 1TWHJ 3H92A 5EZGA 4A93J 1NTCA 4AM3A 2EJRA 1DGWY 4C3IJ 2J5PA 2KRHA 4C2TA 3TEDA 4JX6A 3WTTC 3W2AA 1OPCA 3DBHB 1FYKA 3FMQA 4GFBA 3JTHA 2LSOA 3KP7A 3GZ6A 1MMNA 1IRGA 3F8BA 1ZQ3P 1X58A 2EFPA 2RGVA 3ZQCA 1REPC 3ZQGA 3Q3SA 2QF7A 3M7GA 3CCUI 1DU0A 2R4GA 3G2BA 1SFXA 3GW2A 1FY7A 3I5UA 1BOAA 4P55A 5CYVA 2PFBA 5GPCA 4UVCA 4JYKA 4AYBN 1POGA 4WK8F 2A61A 1BC8C 5A2QK 4L9NA 1VF9A 3ZQQA 3TDZC 2ZJRF 3K4KA 3I53A 1TWFJ 3ZMZA 3WU2C 3OYCA 3RKYA 2EIKH 3EYIA 4GYGA 2WWYA 2HTSA 3V7RA 2GIZA 2RQQA 3G1MA 3ZQFA 4CSWA 3DWLE 1R1TA 5EG0A 4PSXA 1BBYA 1WJBA 1IDZA 1LVKA 3CF5F 4B44A 1G8XA 1T39A 3IRQA 4UUSA 4OMYA 4UUVA 3BPVA 2HOEA 2JA2A 1A6IA 4XOPA 4UB6C 3VODA 5JVTA 1C0WA 1TQPA 3NRVA 3DKXA 3Q9VA 4HF0A 4HQMA 3KLNA 5D6EA 3PFYA 2I10A 4KT6A 1LNWA 1K6OA 3HDDA 1HDPA 2DOEA 1IN7A 3O6BB 4L0YB 4IHTA 4G9YA 2M3AA 1MNMC 1T95A 1T6SA 1ZK8A 3CD6I 2CW0F 3WE3A 3J80K 2CQNA 4BU2A 4LMYA 3F6OA 3BOQA 1JT0A 3V7CA 4RS8A 3NARA 4NC6A 4GGGA 4WCGA 2KJBA 1IJWC 4HQEA 2L02A 1O3QA 1ACIA 3LSRA 5E8GA 4PDKA 2XAJA 1ZRDA 5FJ8J 3BR2A 3LFUA 5B1AH 3PSFA 4TV7A 1T98A 2M4KA 2A69F 3F8FA 4XKBA 3VB2A 1SC7A 5TGTA 4C30A 3RYPA 4UV8A 4KYWA 3CCLI 3OR1C 4EATA 2O0YA 4S0HB 2R0QC 1Y1WJ 1A5JA 2V1UA 3C2GA 3FWEA 1ZN2A 2HZDA 2JK3A 4JX5A 2IPQX 3O3KA 4XN0A 5HLTA 3JSOA 4CDGA 2L9RA 3M1CA 2OJED 4KICA 2STWA 3ZXSA 1YW8A 1W7PB 3OYHA 4LJZF 4DZJA 3N05A 3E0JB 4J00A 3R60A 3FBNB 4NBQA 2LREA 3GXOA 3GTPJ 2CV0A 3DP7A 4HPQA 1OKRA 2DK8A 1BI1A 5E3LA 1SAXA 5IP7J 1K83J 3KETA 3E6DA 4XNFA 2P5KA 4UV9A 2E2JJ 1TNTA 4ENJA 1JGSA 2COMA 3SHFA 1B6AA 4A6EA 1B8IA 1QO0D 2Y9YA 5HLHA 2VT2A 3CMEI 1SVOA 1OYWA 3DEEA 2VJIA 2X1CA 4UY8I 1MNDA 4YIFA 2HVSA 2E5ZA 4KN7X 1O7LA 4DYRA 3ZP5A 1A35A 1ZGAA 4CCMA 5TRDA 3WTSC 4KNYA 2OZ6A 2UUZA 4A3MJ 4PUSA 3OL3A 1UFMA 3KEYA 3KPHA 2K3FA 3F8MA 1X1AA 1R58A 3KEQA 4IZZA 3SFIA 1D0YA 1D0XA 3E5XA 4M3GA 1VZ0A 2JUCA 1NH3A 3HL2A 1HA8A 2M30A 5IOZA 1RRJA 3L2UA 5CVJA 1F4KA 3LQQA 4M3FA 4I02A 1U8RA 2ZO4A 2R93J 3OSGA 4XR6A 2VE8A 3HUGB 2R7SA 2F5EA 5LRSA 4OINF 3I56I 2Q2EB 4BEHA 2QUFA 2HXOA 3T1BA 2BXZA 3KX2A 4QWQA 1BIBA 4IVNA 2CV2A 1TWAJ 5CVVA 1YLFA 2I8DA 2KZVA 1X1PA 1AA7A 1YX3A 5J1RA 4ZJZA 3SJMA 4JQFA 4BHBA 2NVUB 4L0ZB 2L9SA 3MCZA 1J7KA 3I4PA 4D0PA 2FBHA 1X2NA 3BZKA 3V42A 4Z2YA 4M73A 2BV6A 2F2EA 3JRGA 1ITYA 3Q0VA 4P96A 3CUQB 4IOAF 1U8BA 1A04A 1IN4A 4DBQA 3MFKA 3FMRA 1HCRA 2A05A 3MEXA 3OS0A 4P9UA 3KZZA 3GTLJ 3R4KA 2PBIA 5CKTA 4ENKA 3W6KB 3S3MA 4N0BA 4C9YA 5M3MJ 3CZ6A 2LOOA 5AIQA 1EV7A 3EYYA 4W97A 2Q8KA 2F4IA 1S72I 4I0AA 3SYTA 5LHGA 3GLXA 4IHSA 4N9HA 3CC2I 1WJCA 2V26A 4P9FA 2CFXA 3COAC 3B02A 4OU0A 2XAGA 4V2GA 3ROUA 4BAYA 2VOOA 2ZXIA 3D5SC 3DU5A 4DBRA 1VNDA 3E5UA 3LSKA 1KYZA 1YO5C 1MJBA 5J47A 1A31A 5KAIC 4U0WA 2IGOA 2NRAC 4HNUA 2H8WA 3QPSA 4X6AJ 2LYCA 5GAEJ 2FJ1A 3CP2A 2WV0A 5C3EJ 3HPHA 4KIFA 1V4RA 3PUBA 3S2WA 4O3MA 1FTTA 4G12A 3F8NA 3KCCA 3FIWA 4E7LA 2Z5UA 4M9XA 3A4CA 1FMWA 4F91B 3TW7A 3O2PE 4BL0B 4V2FA 1IV8A 4HNVA 2IT0A 3RKXA 2G7UA 1G4DA 2PQ8A 2HS5A 3T5XA 3FKJA 3LSPA 1XGNA 2V7FA 4L5EA 2BY2A 1MIJA 3E6CC 1LDDA 5D5VB 3FHNA 5CQEA 3JAMK 3HJEA 2EIMH 2BW3A 4A3FJ 2DAOA 2OQRA 3F9KA 1K78A 5EJCA 1JUMA 2FF4A 1JT6A 2P81A 3FK6A 5LEJA 3S16J 3ABUA 4XMYA 4IHXA 1T33A 2X1EA 3BTLA 1HW2A 4IQJA 2W85A 2MH9A 5ICGA 2RC4A 4EJWA 1JGGA 1IXSB 3K6GA 4XLHA 4AIKA 1B72A 2EV0A 5CLSA 3N4MA 3JR9A 2VQCA 4XSXF 5IT3A 4OIPF 1XSDA 1CGPA 1A36A 2EV6A 1ZGWA 1YW9A 4A3BJ 1Y6IA 1P4WA 1IW7F 5FFXA 3H3VK 2HQNA 3HRSA 2P6SA 4C3HJ 1KGSA 2Q1ZB 2LFBA 4HSRA 1AHDP 2ZSIB 3FK7A 3CO7C 1S29A 4WXHA 3ZQIA 2E5NA 2PEXA 2E1MB 4ZH4F 4X0GA 3TL4X 3Q0UA 1FYMA 4BH9A 1DPRA 1ZGJA 2DT6A 1IC8A 3WGGA 2L7FP 3EQLF 2QQ8A 3L2VA 1FC3A 4EM1A 1WPKA 5IYDJ 3W6JB 3R6SA 3ASOH 3LFKA 4HX7A 2E7WA 3F8CA 2KJCA 5F6FA 1SEUA 2E35A 3BWGA 5IYCJ 3EETA 2W24A 1GV2A 3CCMI 2M45A 4RGRA 1VQOI 1MJ9A 2LBFA 2H1KA 2A6TA 4IX7A 3PO2J 3KP3A 2CW7A 3H5RA 1WI9A 3H5AA 5JR3A 3D5RC 3S1MJ 3J7ZI 1LFUP 1QNTA 2FOKA 5E3MA 1IXCA 2CGPA 2QWWA 3QU6A 1IN8A 2DA5A 4KA4A 2UWMA 3CJTB 2WTEA 2K9LA 5ICEA 1DGRM 1TW2A 3CO6C 2RV8A 3JREA 3DFGA 1NK3P 3KP4A 1ENHA 1KA8A 4V19K 4P1WA 1R4NB 3I9V2 2JPBA 2KIQA 3ZCOA 3VYTB 4CCOA 5K5OA 1R36A 4FISA 3K9TA 5HDNA 4CCJA 3RDIA 3WU0A 2KMUA 3KP5A 2FQ3A 4F93B 2O3FA 2HYJA 5HODA 3CDLA 3QP5A 1VQ7I 1OCRH 2CUEA 3HOVJ 4BBSJ 3K4MA 3WG9A 3D0SA 4BQAA 2K3PA 5IT9Z 2GA2A 2MG4A 5D5UB 2R5ZB 3OWTA 3RQ4A 1XDUA 3OYMA 1F36A 3E97A 2UZKA 4BEHB 4LK0F 1K7AA 3AG1H 2Y0SN 2CS3A 1E2XA 3I55I 1SFKA 5CVRA 4BKXA 3CCSI 5M5WJ 1H89C 3A01A 4ETSA 1BC7C 5DD8A 4OWRB 2FMYA 1DP7P 3VOEA 2VLAA 4KISA 2LF7A 5H2FC 1U0JA 1T38A 1BJAA 1S8NA 1F43A 4H0EA 3I3LA 1SMYF 1R4MB 1S5LC 1SD4A 1D5YA 1OYIA 2DK5A 4II2A 2HOSA 2X9DA 3J7AO 2P0WA 4YFNF 2PX9A 4RB2C 1JI8A 1B1BA 1BM9A 5DEQA 4M71A 4LB5A 3CJQB 1MMSA 1F9NA 3A0BC 3SZTA 4UUTA 4D7MA 4XLFA 5E18F 1W5SA 2BEOA 3E3VA 1OJLA 1HW5A 2XRNA 2OQGA 2XRLA 2YU9J 4YEJA 3L2WA 2VT3A 1Q1HA 2HVQA 3JRCA 3JCUC 1T8IA 4MO7A 1VQLI 2QEXI 1H88C 1IV6A 3QPTA 4XKWA 4E7ZA 2R7RA 2IRFG 1I1GA 5LLQA 3WG7H 2HQAA 4QTRA 2PLYA 2XV4S 4OIRF 2QKMB 2LY1A 2HI3A 4YG2F 1XCBA 4ZDPA 1XN7A 3TDUC 4NC7A 3P7NA 1BIAA 3PO3J 3OYGA 5M5XJ 2O5RA 1TW3A 3GLLA 1FOXA 2ZXHA 3Q5FA 4R8HA 2YX4A 1V5EA 5DCMA 3U2RA 3S2HJ 1AU7A 1Z05A 3ABTA 1UG0A 3BZ6A 2JRTA 1UB9A 2JVHA 4EJUA 3ELKA 3CCEI 3CCVI 3AL0B 3LAJA 4XN3A 3SDGA 3BR3A 1IZ1A 4PCQA 4FTHA 3OR2C 1GLNA 1P7IA 1V5FA 1Y0UA 3ZQLA 2DQRA 2LMDA 4CZCA 3HRMA 3S1QJ 1Z3XA 1TWCJ 5C4JJ 3LSJA 2JWTA 4ZDLA 2XGDA 1L0OC 5K1YA 5C4XJ 2L54A 1Z21A 1XGMA 3WGHA 1XMXA 1FLIA 4JP0A 1FP2A 2LKPA 3LSTA 4Y15A 5GAGJ 3L1PA 1E0EA 1XB4A 4PJ0C 3CDHA 3WHBA 3BQYA 2O61A 3RKQA 3BG7A 3HZJA 3AAFA 1U5TA 4I0BA 4EQQA 1FOWA 5FKOA 4LIVA 1FOKA 4ZYHA 3GTQJ 4G94A 5GPAA 2RVCA 3V8KA 3ERED 3RYRA 5JI6A 1J9IA 5EGOB 2L7KA 1U5TC 2FRHA 2P5LC 1IO2A 4HNTA 3HOXJ 1YW7A 1HW1A 4LD5A 2FX0A 3BLYA 4MHGA 1B9NA 1O3RA 2DXIA 1KU9A 4XIDA 2VE9A 4AWXB 1QPIA 2MYSA 5FLMJ 1LUJB 1RIOH 1R7JA 3A1YA 3KP6A 3HOWJ 4HOBA 2B63J 4OAYA 5ICCA 1UHSA 5F0HA 1PP7U 2XUBA 2XGXA 2DJIA 5CJ9A 2JPCA 3M07A 4GDFA 2PJRA 2VBZA 1Z6RA 1JE8A 4WF2A 2G9WA 1LE8A 3K70C 2IVMA 2M0MA 5KHDA 5H6QA 3K4NA 3GEZA 4XBFA 1DP3A 3SEQA 1KONA 2K9MA 1TL8A 2ECCA 2UV1A 2QSHX 3U1DA 1Z67A 4HX8A 1W5TA 3QRFF 2KHMA 2KRFA 1JXSA 2NXNB 1L3LA 3LMMA 2EQRA 2NS8A 3RI4A 3CCQI 4IPAA 2QKLB 1WZ2A 3BG3A 5CQGA 2KIMA 3AG2H 3ZOBA 1X4PA 3G1OA 3BR1A 1B4AA 1R71A 1RUNA 2DT5A 3W3CA 1EA3A 1Z6TA 2A6EF 4I2OA 4HLYA 3BQZA 2FEZA 2QA4I
chains in the Genus database with same CATH topology
2ZJPF 4PUSA 4KITB 2HU9A 3OL3A 3KEYA 4RLFA 2VL8A 2K3FA 3MKYB 1X1AA 4IZZA 1D0YA 3SEZA 1D0XA 4GRIA 1ERDA 2NOJB 4AVZA 2CUJA 1QHGA 1VZ0A 3HL2A 3EUHC 1HA8A 2WY7Q 4HSTA 3ZGKA 2LBFB 2HPIA 3L2UA 1N75A 4BJ5C 5HNHA 4ANJA 4E4HA 3QYEA 1SAUA 2V1NA 4XR6A 5DM6F 3HXLA 4BQQA 2ZFUA 4ZYAA 3HUGB 1S9HA 2R7SA 3CP8A 2IS4A 1TT0A 2Q2EB 1UELB 1V5GA 4BEHA 5DM7F 3LSMA 3KX2A 2CW8A 2RNGA 2CV2A 3K70D 2I8DA 1D1CA 2F5VA 2KZVA 2OC6A 4FETA 4XONA 1AA7A 1YX3A 4ZJZA 4P5OA 4JQFA 2VASA 4PJJA 5CPRB 2L9SA 4BE1A 2VJ4A 2HNHA 3AKZA 3VYUB 3V42A 4B47A 1J09A 3OYAA 4Y4RA 3OYFA 3EUKL 1WIBA 3OIQA 4F3QA 3UR3C 4XORA 3PNYA 3ZR8X 4DBQA 1MNEA 3OS0A 1LKXA 5CKTA 3S3MA 4PK4A 3KYLA 2JQ7A 1ZELA 3SDBA 4C9YA 1X4OA 2X6YA 4ZDOA 4PFOA 2W1OA 4B3XA 3CZ6A 2LOOA 2ZSHB 3A2KA 4N4NB 2X1DA 2E60A 4XLCA 2F4IA 4BJTA 3SYTA 4FASD 3OY9A 1BOBA 2GOMA 2KL4A 4Y3OA 3U21A 2VJJA 3HOSA 1WJCA 2V26A 2VKHA 3OIPA 2DOAA 2BOLA 2V9KA 2BW3B 2ZXIA 3D5SC 3OYDA 3DU5A 4DBRA 2WAEA 3OMYA 3LSKA 4IKFA 2JVGA 5JHFA 5FRMA 3K4CA 5LFAA 4OAZA 1Z7LA 4YRVA 3IUOA 2IGOA 3CESA 4CH7A 3K4BA 4HNUA 2H8WA 2LG4A 4PFPA 2VKDA 1X1BA 4DGWB 2WADA 2LYCA 3OYEA 2LH9A 1NG6A 3OYJA 2R7OA 3IAS2 4PJNA 3OYBA 5KCMA 3CP2A 3HKZA 1MMGA 1D1BA 3DQVC 2WA0A 3HPHA 1BR4A 2IGMA 1N78A 3NWSA 3PUBA 3EGVB 2RREA 2M7BA 4BGDA 4E7LA 2L5QA 2A5WA 3A4CA 2PMZA 1FMWA 1P9QC 4JOMA 4F91B 2R7TA 3RSNA 4BL0B 4BACA 3DTIA 4CCNA 1WJDA 3PNTA 2W7NA 2MC4A 3ONQA 3FKJA 1Z3YA 2XF5A 3OS1A 2V4JC 2XAUA 2V7FA 2IS1A 3FHNA 5CQEA 4CCLA 2BW3A 2BVMA 4HEA2 3EPZA 4CA0A 2K5CA 3F9KA 1WFXA 2HPMA 5GADJ 4NNJA 3CMMA 2IS2A 3NWTA 2W00A 3S8PA 1PYVA 2VQLA 4XMYA 3S32A 2X1EA 3K4LA 1MW7A 4E6KG 2Y0SA 4ITVA 4BDYA 2W4SA 4NUBA 4IQJA 2VXZA 4PJLA 3K6GA 3SZGA 4XLHA 3L2QA 1TZLA 1YX5A 3CJRB 3PNVA 3QOEA 4LITA 2VQCA 2F6CA 1D0ZA 2X6WA 1Y6IA 3VDXA 2L9NA 4B48A 3M8JA 3PJRA 2Z2SB 2OUMA 2Q1ZB 3BCAA 4HSRA 2ZSIB 2IS6A 3RTRA 4MLOA 3UNGC 4U7BA 2E5NA 1Y56A 1UAAA 2E1MB 4X0GA 3TL4X 4NQWB 4XLAA 2KLOA 1BR2A 3QYFA 2DT6A 3VYSB 2X85A 4AU7A 4H4KC 3L2VA 2M7AA 2BVLA 1T0FC 3H35A 2R7WA 5FRNA 3RPUD 2E35A 4QPOA 4XQFA 1NG7A 3GBGA 4ZTFA 3W2WA 2ZJQF 3J7YJ 2LBFA 3HPGA 1WJEA 3H9QA 2R7UA 2A6TA 3VWBA 1LDKB 3S93A 4RMNA 3H9GA 1FMVA 4IX7A 3EUAA 3OYKA 3H5RA 2CW7A 1R6RA 4BQNA 4F52A 3H5AA 2LY2A 3BC8A 3D5RC 3J7ZI 4DOZA 3OOUA 3H0DA 3MD2A 4XM3A 1W36D 2HDWA 3E1SA 2UWMA 3CJTB 2K9LA 1DGRM 4U87A 4B43A 2R7VA 2X51A 5HNFA 4XL9A 2HVRA 2XDVA 4V19K 4P1WA 4F92B 3I9V2 1PJRA 3LSIA 5GAHJ 3ZCOA 4BDZA 3VYTB 4CCOA 3J7AY 1MMAA 1DQUA 4LIUA 4CCJA 2KMUA 2VJ5A 4BS9A 3PSIA 4F93B 3BCBA 3IP4B 2FUG2 3QYBA 4HG2A 4N4OB 4C2UA 2KQRA 1WJ5A 2E34A 2E1MC 3K4MA 2K3PA 3OWTA 3RQ4A 3LSHA 3OYMA 2VQGA 4D9JA 3L2RA 4BEHB 4G6TB 1QHHD 2CS3A 1SFKA 3CJSB 2XC7A 2W82A 4RM3A 3MKZA 4OWRB 4E7HA 3D5LA 2VLAA 4KISA 2M4GA 4Y33A 3S3NA 4LG3A 1U0JA 1X1DA 3DTEA 2CV1A 3HC7A 4XOTA 3RCOA 4KJZA 4XKCA 3I3LA 4D1QA 3FBIB 4II2A 2P0WA 3H9JA 3LSGA 1JI8A 4RM2A 1WJAA 3PL8A 3CJQB 1MMSA 2WBMA 2CFOA 3OYIA 2AQEA 4XLFA 1OLTA 1DGWY 4E7IA 2KRHA 4C2TA 3W2AA 2IGNA 4YEJA 3L2WA 4DIQA 1MMNA 2E36A 3OYLA 3MKWB 2R7QA 4J01A 1W36C 4F55A 2HVQA 1YE9A 2V6EA 2CUZA 2MFZA 3VYRB 4XKWA 3TMOA 4E7ZA 2R7RA 2R4GA 4IQ4A 3G2BA 1X1CA 2HQAA 1N77A 4BQOA 2QKMB 2LY1A 4BE2A 4HRIA 4ZDPA 2VIXA 2VQHA 4NC7A 4BXFA 3OYGA 3ZQQA 2O5RA 3K4KA 2ZXHA 1IRXA 3K4JA 3OYCA 1V5EA 4E7JA 1K6YA 4QPQA 2CH0A 1UG0A 2RQQA 4CCKA 3LL7A 4CSWA 3DWLE 2X6XA 3AFHA 4PSXA 4PJMA 2JVHA 3AL0B 1WJBA 1LVKA 3CF5F 2XSJC 4XN3A 1G8XA 4B44A 1QU3A 4XLEA 5HOOA 3CF2A 4XOPA 2JA2A 2WB1A 3OR2C 2IXSA 1GLNA 4BUPA 1V5FA 2PJRB 3DKXA 3PFYA 4II3A 4AYBA 4KT6A 4CZCA 2Z1DA 1Z3XA 4YELA 2M3AA 4ZDLA 1T95A 2WY8Q 4CUGA 2MD0A 1G59A 1Z21A 1MMDA 4BU2A 1OR7C 2DT7B 5KNLA 4R79A 5GAGJ 1E0EA 2WAFA 4DJAA 1D1AA 4RLQA 3BG7A 3C2HA 4LIVA 2KPMA 2VPLA 2Z16A 4E7KA 3VSLA 3LFUA 2LC2A 3H5NA 2ELJA 3PSFA 2OV7A 3DPUA 2IGKA 2L7KA 3DPLC 2KP6A 4HNTA 2M4KA 4XKBA 5TGTA 4C30A 3BLYA 5FROA 3HOTA 2DXIA 3OR1C 2CMPA 4EATA 2DCEA 2R7XA 3C2GA 3OS2A 4BJ6C 2MYSA 2KRCA 2HZDA 4BE0A 3TBIA 3A1YA 3DU6A 4XN0A 5HLTA 5LD2C 3OYNA 4OAYA 2VB6A 4XKVA 2KDOA 3M1CA 2AQFA 3ZXSA 2DJIA 3OYHA 3ZRGA 3N05A 3E0JB 3FDYA 4J00A 3FBNB 2LREA 3AL0C 2CV0A 1LFPA 2JUGA 3VSKA 4HPQA 2PJRA 4PSWA 3K10A 3K70C 3S3OA 3MMYB 2XF7A 2M0MA 5KHDA 3K4NA 2JSPA 3QODA 1DP3A 2GOXB 3SEQA 4ZC3A 3BG6A 1KONA 2K9MA 4XNFA 3W2VA 3HG9A 2UV1A 3IAM2 3DPTA 3DKYA 2KHMA 2WAQA 3DLAA 2NXNB 3LMMA 2L2OA 2LRDA 2VXDA 3DTKA 3OL4A 4E7SA 2QKLB 3DEEA 2VJIA 2X1CA 5CQGA 1MNDA 4UY8I 2HVSA 1BR1A 2E5ZA 1X4PA 2MABA 3W3CA 1EA3A 4CCMA 2XF6A 4NC8A 5HVQC 1WJFA 2UUZA 4ZTJA 1X19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DM7 F;  2ZJP F;  2E36 A;  3J7Z I;  2K3F A;  3CJR B;  5GAG J;  3EGV B;  2NXN B;  3CJT B;  3CF5 F;  2JQ7 A;  5GAD J;  2E34 A;  2E35 A;  3CJQ B;  4UY8 I;  1MMS A;  2ZJQ F;  3J7Y J;  4V19 K;  5DM6 F;  2H8W A;  5GAH J;  3CJS B;  1WIB A; 
#chains in the Genus database with same CATH topology
 2ZJP F;  4HX4 A;  3EUH A;  3K1N A;  2HU9 A;  2V1D A;  2K9S A;  4RAZ A;  1MJA A;  1VQ9 I;  2NOJ B;  2D1H A;  4AVZ A;  4M3B A;  4RGS A;  3J81 Z;  3EUH C;  2VKV A;  2K85 A;  4KN4 X;  4WX9 A;  4HST A;  2LBF B;  1N75 A;  4FX0 A;  5FFZ A;  1SAN A;  4E4H A;  2UXN A;  3IKV A;  2HQR A;  3T0Y A;  3QYE A;  2V1N A;  2PG4 A;  3HXL A;  4BQQ A;  4ZYG A;  1Y39 A;  3ESW B;  3MQ0 A;  1YHQ I;  4KMF A;  1JTY A;  5BPD A;  1VQ4 I;  1UG2 A;  1UMQ A;  2BE5 F;  3G73 A;  1UEL B;  1V5G A;  3LSM A;  3FXJ A;  4D5C A;  1GDT A;  2R7Z J;  3K70 D;  2KKO A;  4M3E A;  3O8G A;  1RET A;  1WWX A;  1X3U A;  2DI3 A;  5F0F A;  1VQK I;  2ECB A;  1OCC H;  4GYI A;  1LJ9 A;  4A0Y A;  1OCP A;  3TP0 A;  5CPR B;  1HLV A;  1K4S A;  4XRF A;  4CIC A;  2VJ4 A;  3CQZ J;  4HV6 A;  1ODD A;  2KT0 A;  2HNH A;  3MWM A;  5GTI C;  3AKZ A;  2P7C B;  2CRG A;  3VYU B;  2DDB A;  2EZH A;  4GXO A;  2EIJ H;  2XGE A;  4X1E A;  3OYA A;  4ESB A;  2VC0 A;  3OYF A;  3PQK A;  4O5V A;  4FX4 A;  1ON2 A;  1MH4 A;  4XOR A;  3PNY A;  2NAZ A;  3ZQH A;  2V1X A;  1BW5 A;  1CF7 B;  1OYY A;  2K40 A;  5M3F J;  3C18 A;  4YIR X;  1AKH A;  2EK5 A;  2NVY J;  1SVL A;  5KAF C;  2PI0 A;  5DV5 A;  1AWC A;  1FYL A;  4PK4 A;  3KYL A;  5IPA A;  2Y9Z A;  1O3S A;  1TBX A;  2Z33 A;  2K27 A;  1ZYR F;  3K69 A;  2X1D A;  3FXM A;  3PFI A;  3A01 B;  2E60 A;  1TLH B;  3BG9 A;  2C6Y A;  2K7L A;  4BJT A;  1W0T A;  1BI2 A;  2CQX A;  4FAS D;  3IWZ A;  2GOM A;  2G7H A;  2VJJ A;  3VEP A;  1I5Z A;  3ECH A;  2HR3 A;  2BOL A;  2F48 A;  3HOZ J;  4HZF A;  2ELH A;  1RPW A;  3HSR A;  1N25 A;  1G3S A;  1K79 A;  3E5Q A;  3TKY A;  3OYD A;  2Z9O A;  3OMY A;  2WAQ N;  1MBG A;  1KQ8 A;  2E1N A;  2PMZ N;  1E3H A;  3JTG A;  3CC7 I;  5ED4 A;  2XAQ A;  5AON A;  4QLC U;  3JRF A;  3FXK A;  3BR6 A;  2OTL I;  1P6R A;  1EJ9 A;  3WHC A;  1X1B A;  1ZH5 A;  2Y2Z A;  2WAD A;  5D6F A;  1MBE A;  4HW0 A;  5F27 A;  3OYE A;  4MTD A;  2LH9 A;  2QSF X;  3OYJ A;  2JA7 J;  3IAS 2;  4PJN A;  1VQM I;  1J59 A;  2NVT J;  1MMG A;  4S04 A;  1T2K A;  3DQV C;  3PIO F;  2HKO A;  2AXT C;  2RRE A;  2WC2 A;  2M7B A;  2DMP A;  2VN2 A;  4DYQ A;  3FX3 A;  3DXJ F;  2PN6 A;  2DOF A;  1PUF B;  4HF2 A;  3ZMT A;  2A5W A;  4JOM A;  4HA8 A;  2BBY A;  2R7T A;  2EFO A;  1FT9 A;  1APL C;  3ABL H;  3GFI A;  2H09 A;  3KZY A;  1K61 A;  2O03 A;  5D8K B;  1JKR C;  1TTY A;  1XD7 A;  1HKT A;  4CCN A;  2WV1 A;  1TQI A;  3PNT A;  2KIF A;  4LG0 A;  2GIV A;  3ONQ A;  5IP6 A;  2Y48 A;  2TDX A;  1GHC A;  1RR7 A;  2FXA A;  4I98 B;  3X2Q H;  4Q5S F;  2DTZ A;  4DZP A;  3IV5 A;  4U0V A;  5FKM A;  2HQ5 A;  3B6A A;  5HDG A;  3MZ8 A;  4CO8 A;  2LK2 A;  1O7F A;  4L9J A;  1S7O A;  1XGS A;  3P9I A;  2XRO A;  2NYX A;  2TRT A;  4UNO A;  2EZI A;  5D4S A;  1PYV A;  1Y8R B;  3MVP A;  1GVD A;  3TO9 A;  3K4L A;  2Y0S A;  5B5E C;  4FT8 A;  2W4S A;  4NUB A;  3M4O J;  2E19 A;  2XKP A;  2VXZ A;  3WTW C;  1U6G A;  5EF6 A;  4KDP A;  2QQ9 A;  3I59 A;  4EJT A;  4LIT A;  5DYM A;  2DMU A;  1YJW I;  3D1N I;  4HLX A;  4DYC A;  4ZYE A;  5JFR A;  9ANT A;  2F6C A;  3F23 A;  1X2M A;  1PDN C;  3WU1 B;  1OFC X;  2H6B A;  1YRN B;  5BPI A;  3MKL A;  3PJR A;  2OUM A;  1ETK A;  1FPQ A;  4A3I J;  3RZO J;  1I39 A;  1R22 A;  1W4M A;  2AHQ A;  1IRF A;  5FKL A;  5JHU A;  2IS6 A;  4HDU A;  3QU3 A;  4U7B A;  1Y56 A;  2B9S A;  2VPR A;  4XLA A;  2D45 A;  1FWZ A;  3ERM A;  2LLK A;  3GF2 A;  2DYS H;  3OV8 A;  4AU7 A;  5B3S H;  1GXQ A;  3LA3 A;  3R0J A;  1T08 B;  3HTS B;  3TW6 A;  1WCM J;  2L01 A;  1MDM A;  1JUS A;  1MSE C;  3NAU A;  3PUF A;  4QPO A;  5DTD A;  3GBG A;  2EH3 A;  4I01 A;  4QIW N;  5LHI A;  4ZTF A;  1WGX A;  4A0X A;  1LE8 B;  3J7Y J;  2LP0 A;  1OCZ H;  5LHH A;  2Y69 H;  5FO5 A;  1UHW A;  1VI0 A;  3H9G A;  5FLX Z;  2QQB A;  3V4G A;  1QA6 A;  4EGY A;  4F52 A;  2DFI A;  3BC8 A;  3FIS A;  1I50 J;  2A6H F;  1O3T A;  2X0L A;  1W36 D;  2HDW A;  2G0E A;  4PGH A;  2COB A;  1ZLJ A;  4BHP A;  5FLV A;  4B43 A;  1V3F A;  1R23 A;  5HNF A;  2FE3 A;  4XL9 A;  1IRZ A;  2OF7 A;  3B6C A;  2XDV A;  4UXN A;  1R1U A;  1PJR A;  4Z6Y A;  3HSE A;  3HBL A;  4N9I A;  3J7A Y;  2H8R A;  3U9G A;  1ETW A;  4L9V A;  2ZCW A;  4BS9 A;  1YTY A;  3PSI A;  1R9T J;  1IG7 A;  3BCB A;  4NQW A;  2R7F A;  4ZZD A;  2AO9 A;  1YS7 A;  1H9G A;  1OMI A;  4Y52 J;  3PQJ A;  1FZP B;  2KQR A;  1W1W E;  1XPX A;  4ABZ A;  1U9O A;  3N97 A;  1WH5 A;  3PM1 A;  1JHF A;  5LRR A;  1ZG5 A;  2L0K A;  4M74 A;  2FU4 A;  2M5W A;  4FCY A;  2VQG A;  2OZU A;  2QSG X;  1BA5 A;  4S05 A;  3ECO A;  2W48 A;  2XC7 A;  1HKS A;  2M87 A;  4PGG A;  1YIT I;  3JRB A;  2HWV A;  5EG0 B;  3J80 Z;  1U3E M;  4Y33 A;  5F08 A;  1X1D A;  3DTE A;  3DBR B;  4UUS B;  4G6D A;  5EEG A;  1MKM A;  3HGY A;  2EWN A;  5ILU A;  2K4B A;  1H0M A;  3GTM J;  5KK1 A;  2F5D A;  4AUX A;  5L3G A;  2WBM A;  5FGM A;  2CFO A;  2DN0 A;  2DTR A;  2JMW A;  3OYI A;  1J2X A;  3HB9 A;  3GZN B;  4E7I A;  5JLW A;  4ENN A;  3E7L A;  3F6V A;  1P4X A;  1AKH B;  2MBF A;  1LVA A;  4ZZL A;  2VON A;  4DIQ A;  3G3Z A;  2HTJ A;  3OYL A;  1RES A;  2R7Q A;  4J01 A;  3F3X A;  3V8L A;  4CYC A;  4IHY A;  1RI7 A;  2V6E A;  3TP3 A;  2MFZ A;  1A6Q A;  3VYR B;  2DMQ A;  4JBA A;  1YFH A;  3TMO A;  3FXU A;  2I5U A;  1N77 A;  2ZB9 A;  2EIN H;  3P9C A;  3ZMS A;  2CG4 A;  1QPM A;  2ZNY A;  4BQO A;  3GO5 A;  3OSF A;  1ZRC A;  3C7J A;  4HRI A;  2VIX A;  1HSJ A;  3Q0W A;  1XS9 A;  2VQH A;  4G6Q A;  1HDD C;  4C3J J;  4BXF A;  3ULQ B;  1MBF A;  2H6C A;  5GP9 A;  4IO9 F;  4A3E J;  3M8F A;  2QBY A;  4K2E A;  3K4J A;  4Q48 A;  2DMN A;  2IA0 A;  3BTC A;  1QBJ A;  1ZRF A;  4QPQ A;  3HTU A;  4CCK A;  5K5R A;  3LL7 A;  1R00 A;  3AFH A;  3AG3 H;  5LGU A;  4PJM A;  2VUM J;  1G2H A;  4BBR J;  3C3W A;  3GX4 X;  5J8C A;  1M1E B;  3NEU A;  1R5I D;  3MN2 A;  3DCF A;  2JZY A;  5HOO A;  3WTZ A;  1HQC A;  4I09 A;  5ICF A;  2CQK A;  5FKK A;  5D5W B;  2R5Y A;  2CUF A;  3HOY J;  4AYB A;  3I4N J;  2GZW A;  2Z1D A;  4YEL A;  4DW6 A;  2RN7 A;  1OR7 A;  3KE2 A;  1QQI A;  4PZJ A;  4L18 B;  4EEF G;  1G59 A;  3ABM H;  3P9K A;  5EDN A;  2D1V A;  1OR7 C;  2DT7 B;  1B8I B;  2Y0M A;  5KNL A;  4R79 A;  2BGC A;  5TIS C;  5E79 C;  2WAF A;  4M3D A;  4DJA A;  1D1A A;  4MQ9 F;  3G6E I;  4BNC A;  1QZY A;  2K9N A;  3R0A A;  4BHC A;  1MD0 A;  1KZH A;  2HOT A;  2IP2 A;  2Z16 A;  1I27 A;  2XAH A;  3VSL A;  2LC2 A;  1JKQ C;  4A3K J;  3DPU A;  2IGK A;  3GUD A;  1JTX A;  4DQ2 A;  5ILV A;  2DA6 A;  1XMA A;  3I54 A;  1JUP A;  2Y31 A;  4XIC A;  1F5T A;  4MFD A;  1IGN A;  3TO6 A;  2CMP A;  2HDC A;  2VOP A;  2DCE A;  2HOA A;  2R7X A;  4KUM A;  1SMT A;  4ON0 A;  1GUU A;  3OS2 A;  3BP8 A;  3H1C A;  4BJ6 C;  2DO7 A;  3J81 K;  3CTA A;  2XB5 A;  3DU6 A;  4AD9 A;  2XPU A;  3OYN A;  4XKV A;  1RZ4 A;  2KDO A;  2F5C A;  2NS7 A;  3H3Z A;  2GLO A;  1J5Y A;  5E1W A;  2D5V A;  3ZRG A;  2EA4 A;  1XCV A;  1VQN I;  3FDY A;  2DPD A;  1LEA A;  2V9P A;  5K7H A;  2JUG A;  3S1N J;  3ABK H;  1ETY A;  1KQ0 A;  2XF7 A;  3MMY B;  2OD5 A;  4LGW A;  4UHT A;  3S3O A;  2LD5 A;  4G7O F;  1ORK A;  2Z3Y A;  3BG6 A;  1RUO A;  1WRJ A;  3W2V A;  3M3Y J;  3HG9 A;  4U0Y A;  3IAM 2;  3DPT A;  4KIB A;  2WAQ A;  3DLA A;  5J4V A;  2ISZ A;  2LRD A;  2CQ7 A;  3DTK A;  3LNQ A;  4AC0 A;  3LWF A;  2ZFW A;  1TT5 B;  3TOA A;  4E7S A;  3O8H A;  4AIJ A;  4IL6 C;  4RGU A;  1ZAR A;  1J75 A;  2J5O A;  3FHZ A;  3KYC B;  2A07 F;  3BDD A;  1BL0 A;  1SFU A;  4NC8 A;  4W1U A;  5HVQ C;  4ZTJ A;  2EZK A;  2VC1 A;  3JW4 A;  5IOY A;  1X19 A;  2K9Q A;  1FIA A;  2MA3 A;  1BI3 A;  5L3D A;  4RLF A;  4MGR A;  2VL8 A;  5BNG A;  3MKY B;  1MDM B;  3DF8 A;  5F1R A;  4GRI A;  4A5M A;  2QVO A;  4IEJ A;  5J1U A;  4E70 A;  5F1J A;  3VFZ A;  1ERD A;  1K4T A;  2E71 A;  1QHG A;  5FD6 A;  2WY7 Q;  4AID A;  1W5C C;  1MH3 A;  2JA8 J;  1ETV A;  1XX5 A;  2HPI A;  1QVU A;  3R61 A;  2CYY A;  4ANJ A;  2WB1 N;  4CZZ A;  1YI2 I;  3IWF A;  1X3Z B;  2OTJ I;  2QCO A;  3A0H C;  1RNL A;  3HYI A;  1SAU A;  3GME A;  2ZFU A;  1MZB A;  2FSW A;  2M9H A;  1S9H A;  1W7P A;  3CCR I;  3E6M A;  1VTN C;  3B73 A;  2DA7 A;  1JKO C;  1TT0 A;  5DM7 F;  1HF0 A;  4XLP F;  1DU6 A;  4RA2 A;  1XTA A;  1WSU A;  3DBL B;  4BY7 J;  1W0U A;  2BY0 A;  1Z0X A;  4FET A;  2F5V A;  3CUO A;  4XON A;  1Z7U A;  4PJJ A;  2QYO A;  5FB2 A;  3GTK J;  4B3A A;  2N8G A;  2B0L A;  4BE1 A;  1EH7 A;  1JJ6 C;  5TJJ A;  4B1R A;  3EUK L;  2Y75 A;  1ZAO A;  1WIB A;  1T0F A;  3OIQ A;  3DEW A;  1S6L A;  3ZMV A;  4F3Q A;  3ML6 A;  3ZR8 X;  2P4W A;  2EBI A;  1XSV A;  3JAM Z;  2IA2 A;  3DKW A;  4R1H A;  2ICW G;  3WTU C;  1HBX G;  1LKX A;  2DFE A;  2XAS A;  4FQG A;  5JVG F;  4JK1 X;  3SDB A;  1X4O A;  2HDD A;  2ZSH B;  4RBO A;  2L7M P;  2VKE A;  1PUE E;  1B9M A;  4XLC A;  2DA2 A;  1GVJ A;  3JRA A;  3OY9 A;  3L09 A;  4HV5 A;  4LOC A;  2DFH A;  2KL4 A;  5K7Z A;  3QPH A;  2QQA A;  3HOS A;  3HUG A;  2DA1 A;  2DOA A;  3OIP A;  5E8I A;  2BW3 B;  1K78 B;  3GYH X;  1KU7 A;  1RKT A;  2XSD C;  3K2Z A;  2Q2E A;  2IAI A;  4MQV A;  4AVP A;  2WAE A;  4NHJ A;  4MIM A;  3IC7 A;  4IKF A;  1W7P D;  5JHF A;  1YG2 A;  5FRM A;  1QRY A;  3K4C A;  2KIS A;  1U9N A;  3IUO A;  1JHH A;  1T56 A;  1GXP A;  4QSH A;  4EVI A;  2A68 F;  3G1L A;  1B72 B;  2NNN A;  3LQR A;  2L3D A;  3CC4 I;  3SQN A;  2FNP A;  5EYR A;  5L3B A;  4D7N A;  2R7O A;  1IN5 A;  4UB8 C;  5KCM A;  3RPQ A;  5L3E A;  1U2W A;  1ZR4 A;  1LPQ A;  3CUQ A;  2XKO A;  1D1B A;  1ZG3 A;  2DA4 A;  2WA0 A;  1BR4 A;  2K4J A;  1VQ5 I;  2IGM A;  1XMK A;  1N78 A;  3EGV B;  2W57 A;  3GTO J;  4XRS G;  3HOU J;  2V9V A;  2GXG A;  2YSR A;  1Y8Q B;  2P7V B;  3CUQ C;  1J0R A;  1P9Q C;  4BY1 J;  3JRD A;  1Z1D A;  2NOG A;  3RSN A;  2X6O A;  2JA6 J;  4BAC A;  3DTI A;  1GT0 C;  1FIP A;  2F5F A;  3RPU A;  1WJD A;  2EZL A;  3KZI C;  4IJA A;  1BW6 A;  3KFW X;  3OS1 A;  2XAU A;  2GXB A;  5D8L B;  4G7Z F;  4CCL A;  4ASN A;  2BVM A;  3GFL A;  4XRM A;  1QZE A;  1SD6 A;  5GAD J;  4M72 A;  4NNJ A;  2XPW A;  2IS2 A;  2HYF A;  2NNY A;  3NWT A;  2W00 A;  2XB0 X;  2CQQ A;  1PVE A;  5J8F A;  1IUF A;  3CCY A;  5B1B H;  2O6G E;  2KIU A;  1MW7 A;  4E6K G;  5FD5 A;  2X4H A;  4KIG A;  4BDY A;  3MZH A;  2O7O A;  5FLX K;  1LDJ A;  3SZG A;  2KZG A;  3L2Q A;  2LVS A;  3QOE A;  3FXL A;  4G8X A;  3DEU A;  2M0C A;  1XG1 A;  4CXF A;  2ESH A;  2R7D A;  1TP4 A;  1HKQ A;  1XDS A;  2EFQ A;  2X6W A;  3TGN A;  5E17 F;  2L9N A;  2MLG A;  2ZXJ A;  3FZV A;  3KYD B;  4CHU A;  3RQI A;  3BCA A;  1FOY A;  1YOV B;  1TC3 C;  1H8A C;  4RAY A;  3RTR A;  1QVT A;  2DOD A;  3GFJ A;  3LA7 A;  3ISP A;  2ZBK A;  1YQA A;  1E3P A;  1SFE A;  5KVR A;  1ZRE A;  4OIQ F;  3TQN A;  3GFM A;  3RIR A;  3BJ6 A;  2BY1 A;  2JA5 J;  1BR2 A;  3F0C A;  3KLO A;  4M6Y A;  2P8T A;  4H4K C;  3A03 A;  2M7A A;  2CO5 A;  2VOD A;  2MH2 A;  2BVL A;  1XC5 A;  2FD5 A;  3H35 A;  5FKN A;  3HEF A;  4FHT A;  3RPU D;  4B8X A;  1Z77 A;  2ESN A;  2PMU A;  5C44 J;  1NG7 A;  4I99 C;  3WTY C;  3I71 A;  3W2W A;  2ZJQ F;  2A5Y B;  5H20 A;  5D5X B;  2FQ4 A;  3HPG A;  2R7U A;  3H9Q A;  3S93 A;  4RMN A;  1FMV A;  3REO A;  1OCO H;  1S7E A;  3OYK A;  1NK2 P;  1KU3 A;  4HDV A;  3M9A A;  3BTJ A;  4I6Z A;  2LY2 A;  4A69 C;  4EGZ A;  2EA2 A;  4DOZ A;  4MFE A;  2QGU A;  3HKZ N;  3OOU A;  5LGN A;  2Y30 A;  3H0D A;  2W84 A;  5LGT A;  2CJJ A;  3H0G J;  4XM3 A;  2ZKZ A;  3E1S A;  1FP1 D;  3WTV C;  3GWZ A;  5E20 A;  4ESF A;  2R92 J;  2L4A A;  5DUI A;  1U78 A;  2STT A;  2R7V A;  4C2M J;  2E1C A;  5J3L A;  4LLG F;  2L7Z A;  3MZY A;  2EFW A;  2HVR A;  3FMS A;  2W25 A;  2E7X A;  5GAH J;  5D4R A;  4BDZ A;  2CU7 A;  3HRT A;  1RR8 C;  1O57 A;  4LIU A;  2ME0 A;  1FBU A;  2NS0 A;  2VJ5 A;  4MTE A;  2TCT A;  4JX4 A;  2IEK A;  3C1D A;  1YIO A;  3QYB A;  1IXR C;  4HG2 A;  2JTV A;  3L9F A;  4N4O B;  2O8K A;  4C2U A;  5F64 A;  5BS6 A;  5DCF A;  2D2W A;  1X3W B;  2E1M C;  2E34 A;  3SZP A;  2GA1 A;  3H36 A;  3ZMU A;  4GO1 A;  1HST A;  4LFU A;  3LSH A;  1VQP I;  3L2R A;  3QOP A;  4G6T B;  5DUK A;  1QHH D;  4RAG A;  3GZ5 A;  5DCM B;  1SD7 A;  4MEX F;  3CJS B;  2XGC A;  2W82 A;  1BN5 A;  2OCE A;  4OOI A;  4E7H A;  2NVQ J;  1D8J A;  1ZTR A;  1QZZ A;  2M4G A;  4LG3 A;  2LR8 A;  4XOT A;  3KP2 A;  4KJZ A;  4NDL A;  4XKC A;  3C2B A;  4OMZ A;  4D1Q A;  3FBI B;  4XK4 A;  2GM4 A;  2DU9 A;  3H9J A;  3LSG A;  5LEK A;  4B09 A;  4BXX J;  5HLG A;  1WJA A;  2O9L A;  3PL8 A;  1UHM A;  3ASN H;  2AQE A;  1OLT A;  2DDA A;  1R49 A;  2GWR A;  4CYD A;  1D5V A;  4EJV A;  2XPV A;  1XSX A;  2YUS A;  3UKG A;  1ETO A;  2IGN A;  2VBW A;  2XAF A;  2E36 A;  3QPL A;  1ZG1 A;  3MKW B;  4FE7 A;  1CQT A;  1W36 C;  2EV5 A;  3ZMD A;  4F55 A;  1YE9 A;  3DV8 A;  2CUZ A;  1U5T B;  3LA2 A;  4LLN A;  3FF5 A;  4IQ4 A;  3TOB A;  1X1C A;  1Y0N A;  3S15 J;  3V8J A;  4BE2 A;  4HF1 A;  3L7W A;  2ACJ A;  4RDU A;  3CJN A;  2BHY A;  2B7E A;  2RKH A;  2JSC A;  5EZH A;  2R5Z A;  4FE4 A;  2ETH A;  2GBY A;  3S1R J;  1IRX A;  2HGC A;  4E7J A;  2QLZ A;  1K6Y A;  2HXI A;  2CH0 A;  2MSY A;  2IW5 A;  2MLK A;  2X6X A;  1ETX A;  1YS6 A;  5HDK A;  4XRS A;  3BJA A;  1RKW A;  2YU3 A;  1UST A;  1AOY A;  1DUX C;  2XSJ C;  3JSP A;  4AIH A;  1QU3 A;  4XLE A;  4Q47 A;  1HOM A;  3CF2 A;  1ZLK A;  5IT9 K;  2WB1 A;  3MAJ A;  2OBP A;  2IXS A;  2RAE A;  4BUP A;  2BYV E;  2PJR B;  4BYY A;  1NHA A;  4KMU X;  4II3 A;  4HAM A;  1MBJ A;  1LQ1 A;  2WY8 Q;  4A12 A;  1ZHF A;  2F4M B;  4CUG A;  2MD0 A;  3M8E A;  5CVI A;  3E6B A;  1I3A A;  1MMD A;  1ZKG A;  2VBY A;  2RQP A;  3K1M A;  3G4S I;  2GXA A;  2ZXW H;  2ZME A;  4RLQ A;  1DPU A;  3C2H A;  2MC3 A;  4WXC A;  2KPM A;  4M6X A;  2VPL A;  4E7K A;  2K02 A;  2ZME C;  3H5N A;  2V6C A;  2ELJ A;  2VI6 A;  2OV7 A;  5A2Q Z;  1G3T A;  1SFO J;  4EJO A;  3DPL C;  2KP6 A;  1H9T A;  1IUY A;  2L9V A;  5DS9 A;  5FRO A;  3HOT A;  3HGG A;  3BZC A;  3T8R A;  4HBL A;  2FA5 A;  3ZQ7 A;  2KRC A;  2F4O B;  3TBI A;  4BE0 A;  2NVX J;  3P5J A;  5LD2 C;  3K7A J;  2Q0O A;  2VB6 A;  5E1X A;  3RJP A;  2AQF A;  4WWC A;  3S17 J;  5J6X A;  1V55 H;  1O4X A;  5DD4 A;  5H6R A;  3IRR A;  1Z91 A;  1HC8 A;  1P92 A;  3AL0 C;  1LFP A;  3VSK A;  1FSH A;  1UZC A;  2CSO A;  2JT1 A;  4PSW A;  4Y7N J;  3I64 A;  1USS A;  3K10 A;  4M9S A;  5J4Y A;  3W6V A;  2DFF A;  2JSP A;  3QOD A;  2X48 A;  2GOX B;  4ZC3 A;  2YPR A;  3DKY A;  1FBS A;  1VQ8 I;  1YIJ I;  1FJL A;  1G3Y A;  1LEB A;  2L2O A;  2VXD A;  3OL4 A;  5ILS A;  3L2C A;  1IN6 A;  3CLO A;  4A6D A;  3ZN1 A;  4UVB A;  1BR1 A;  4L9T A;  4Y13 A;  2MAB A;  2L4M A;  2DYR H;  1UJ8 A;  4LK1 F;  2XF6 A;  2Z99 A;  1WJF A;  5E1Z B;  4A0Z A;  1KU2 A;  1JJ8 C;  4HYE A;  3L00 A;  4KIT B;  1E3O C;  1RC9 A;  2LF8 A;  5EGO A;  2A3S A;  4IRI A;  3SEZ A;  1OCT C;  2BZT A;  3K2A A;  2CUJ A;  3JRI A;  3ZGK A;  3BG5 A;  4BJ5 C;  5HNH A;  1B59 A;  2MW8 A;  1FEX A;  5DM6 F;  4ZYA A;  2E2H J;  2JN6 A;  2GAU A;  4CGZ A;  2BY3 A;  3FXO A;  3CP8 A;  2IS4 A;  4YFK F;  1Y1V J;  3BY6 A;  3I58 A;  2CW8 A;  2DBB A;  4XSZ F;  2BHZ A;  2RNG A;  4ENM A;  2RDP A;  3FKI J;  2OC6 A;  1D1C A;  3H3U A;  4RB1 A;  2ME6 A;  1MBK A;  4IF4 A;  2M34 A;  1SD5 A;  4P5O A;  3F22 A;  2VAS A;  2P5V A;  3CMY A;  1FNN A;  1OIS A;  4B47 A;  4A5N A;  3BT9 A;  4EV0 A;  1J09 A;  4ZYD A;  4B4C A;  4Y4R A;  2BXY A;  3HRU A;  2ID3 A;  3BRO A;  5L3C A;  2E2I J;  3UR3 C;  2QZ8 A;  1I6H J;  1MNE A;  1V54 H;  1JKP C;  3DLL F;  1R5H A;  1G3W A;  2FML A;  3K1P A;  4A2U A;  1YYV A;  5HS8 A;  4U7D A;  1HXD A;  2JQ7 A;  1ZEL A;  3I0T A;  1ULY A;  2X6Y A;  3FM3 A;  4ZDO A;  4PFO A;  2W1O A;  4B3X A;  2DPU A;  3SFZ A;  4Q4Z F;  3A2K A;  4N4N B;  1EH8 A;  2EFN A;  4LG0 B;  5AIP A;  1IAW A;  1BOB A;  2IA1 A;  4U88 A;  2ZC2 A;  4LB6 B;  2FBI A;  1ETQ A;  2K86 A;  2QEN A;  4Y3O A;  3GTG J;  3WGI A;  3U21 A;  1Z9C A;  1P4A A;  2VKH A;  2V9K A;  2IJL A;  5JLX A;  1XGO A;  3CMA I;  5J40 A;  1UCR A;  3KEO A;  3IKT A;  3S14 J;  2ADU A;  2JVG A;  1FTZ A;  2KFD A;  4OAZ A;  2RNJ A;  5LFA A;  5K5Q A;  1Z7L A;  4I76 A;  2LNB A;  5F0C A;  4YRV A;  3CES A;  3VPR A;  4CH7 A;  4KFC A;  1WI3 A;  2V79 A;  3K4B A;  1E17 A;  1P7J A;  2LG4 A;  3I59 B;  4PFP A;  2VKD A;  2PMH A;  2FBK A;  4DGW B;  2ISY A;  2VBX A;  1R5G A;  3JRH A;  3QAH A;  5IYB J;  1NG6 A;  4EM0 B;  4I7H A;  5HLI A;  3OYB A;  3HIF A;  3HKZ A;  1MBH A;  2PJP A;  2YR2 A;  3BR5 A;  4A3J J;  2HEO A;  3NWS A;  2HKX A;  1ZR2 A;  1CF7 A;  3BTI A;  4IHW A;  4IRH A;  4F7Z A;  4BGD A;  1MSF C;  2L5Q A;  4IRG A;  2PMZ A;  5EEH A;  1EKE A;  4A3G J;  3SXY A;  5CVU A;  4EM2 A;  2QM3 A;  1PP8 F;  2M8G X;  2OU2 A;  1VFC A;  4ESJ A;  3F21 A;  4G7H F;  2W7N A;  2IBD A;  2MC4 A;  2H1L A;  2OCC H;  2MD5 A;  3RKW A;  1Z3Y A;  3AG4 H;  5IP9 J;  2XF5 A;  5IY5 H;  1SVM A;  2V4J C;  4WXD A;  4M9Z A;  2IS1 A;  1WKM A;  3M1E A;  1IF1 A;  2R3S A;  3U1K A;  3QWL A;  4HEA 2;  3EPZ A;  4CA0 A;  2K5C A;  1WFX A;  2HPM A;  1MGT A;  2M1B A;  2LDU A;  3CMM A;  1TQM A;  2M8E A;  3I4M J;  3S8P A;  2VQL A;  4RB0 A;  3S32 A;  5BMZ A;  4IXA A;  2YS9 A;  4ITV A;  3IH4 A;  2DJN A;  4PJL A;  3OOP A;  5L3F A;  2YX7 A;  3BPX A;  2H94 A;  3OIO A;  1TZL A;  2ZME B;  1YX5 A;  1I6X A;  3CJR B;  1I3Q J;  3PNV A;  4YII A;  5GTH C;  4A3L J;  4D5F A;  1DDN A;  1KYW A;  4L5I A;  4J19 A;  1D0Z A;  1D8K A;  3VDX A;  3LAP A;  4B48 A;  3M8J A;  2Z2S B;  3A02 A;  1BI0 A;  5LBQ A;  1PUF A;  4A3D J;  2LTP A;  5DDG A;  1YJ9 I;  3IH2 A;  4GCV A;  5K7F A;  4MLO A;  4UVA A;  3UNG C;  3LOC A;  1UAA A;  2DMT A;  3FXQ A;  3K0L A;  4NQW B;  2KDZ A;  2KLO A;  3QYF A;  1ONV A;  3QP6 A;  4OIO F;  3VYS B;  1TWG J;  2X85 A;  1WH7 A;  1EH6 A;  3F72 A;  3S2D J;  1S3J A;  4EMS A;  1LFB A;  3NQO A;  3WTX C;  1T0F C;  2ZJ2 A;  5FRN A;  2FNA A;  2R7W A;  3TO7 A;  1EF4 A;  4XQF A;  1VQ6 I;  2E1O A;  3QQA A;  3RZD J;  3BJO A;  3Q9S A;  4BXU A;  3GTJ J;  1WJE A;  2MGQ A;  2XIG A;  3FXR A;  3VWB A;  1Q1V A;  1LDK B;  4MEY F;  3EDP A;  3EUA A;  3IHU A;  4Y17 A;  1FBQ A;  1OQY A;  1R6R A;  2AS5 F;  4BQN A;  2EIL H;  5E3O A;  5M5Y J;  3GCM A;  1YJN I;  1FSE A;  5BQT A;  2P6T A;  2GQQ A;  4IOC F;  3MD2 A;  1F1Z A;  2AXL A;  1GV5 A;  1IDY A;  1G6N A;  5E3N A;  3CCJ I;  2LY9 A;  5BOX A;  3IL2 A;  4U87 A;  2ZNZ A;  2H27 A;  2LKS A;  2OA4 A;  2EPF A;  3CDI A;  3FM5 A;  2X51 A;  3IH3 A;  2DA3 A;  5HS9 A;  2CWE A;  2XVC A;  2DLL A;  3ZN0 A;  1WHU A;  2UXX A;  1YRN A;  3HSF A;  4F92 B;  3LSI A;  4XLN F;  2HYG D;  2JRM A;  4L5J A;  5HS7 A;  4IHV A;  3G71 I;  1MMA A;  1FX7 A;  4NB5 A;  4CYC B;  3ZPL A;  5J1Y A;  1DQU A;  6PAX A;  4A3C J;  2JJ7 A;  5EEA A;  1WVR A;  5F04 A;  3IP4 B;  5ERI A;  1D3Y A;  2DW4 A;  2FUG 2;  3GVA A;  4M6V A;  3HHH A;  1R1V A;  2OAZ A;  3HHG A;  3PIP F;  1WJ5 A;  3T8T A;  2OPT A;  2EB7 A;  2QBY B;  3KIO A;  4D9J A;  4O6J A;  1ON1 A;  1TNS A;  4RB3 C;  4KT5 C;  3BR0 A;  1STZ A;  2HFH A;  1WQ2 A;  2ID6 A;  2XHK A;  4YFX F;  1QGP A;  4RM3 A;  2HZT A;  1S7A A;  2ELK A;  3MKZ A;  4LLL A;  5B66 C;  3D5L A;  1I1S A;  1BJZ A;  3V7S A;  3HM5 A;  3S3N A;  2CV1 A;  3WE2 A;  3HC7 A;  2LKX A;  2O8X A;  3RCO A;  1LB2 A;  1P2F A;  3WOD F;  3CLQ A;  2M2E A;  2R5Y B;  4RGX A;  4MNU A;  4RM2 A;  2DQL A;  1KQ9 A;  2FOW A;  4RAF A;  4DNC A;  1TWH J;  3H92 A;  5EZG A;  4A93 J;  1NTC A;  4AM3 A;  2EJR A;  1DGW Y;  4C3I J;  2J5P A;  2KRH A;  4C2T A;  3TED A;  4JX6 A;  3WTT C;  3W2A A;  1OPC A;  3DBH B;  1FYK A;  3FMQ A;  4GFB A;  3JTH A;  2LSO A;  3KP7 A;  3GZ6 A;  1MMN A;  1IRG A;  3F8B A;  1ZQ3 P;  1X58 A;  2EFP A;  2RGV A;  3ZQC A;  1REP C;  3ZQG A;  3Q3S A;  2QF7 A;  3M7G A;  3CCU I;  1DU0 A;  2R4G A;  3G2B A;  1SFX A;  3GW2 A;  1FY7 A;  3I5U A;  1BOA A;  4P55 A;  5CYV A;  2PFB A;  5GPC A;  4UVC A;  4JYK A;  4AYB N;  1POG A;  4WK8 F;  2A61 A;  1BC8 C;  5A2Q K;  4L9N A;  1VF9 A;  3ZQQ A;  3TDZ C;  2ZJR F;  3K4K A;  3I53 A;  1TWF J;  3ZMZ A;  3WU2 C;  3OYC A;  3RKY A;  2EIK H;  3EYI A;  4GYG A;  2WWY A;  2HTS A;  3V7R A;  2GIZ A;  2RQQ A;  3G1M A;  3ZQF A;  4CSW A;  3DWL E;  1R1T A;  5EG0 A;  4PSX A;  1BBY A;  1WJB A;  1IDZ A;  1LVK A;  3CF5 F;  4B44 A;  1G8X A;  1T39 A;  3IRQ A;  4UUS A;  4OMY A;  4UUV A;  3BPV A;  2HOE A;  2JA2 A;  1A6I A;  4XOP A;  4UB6 C;  3VOD A;  5JVT A;  1C0W A;  1TQP A;  3NRV A;  3DKX A;  3Q9V A;  4HF0 A;  4HQM A;  3KLN A;  5D6E A;  3PFY A;  2I10 A;  4KT6 A;  1LNW A;  1K6O A;  3HDD A;  1HDP A;  2DOE A;  1IN7 A;  3O6B B;  4L0Y B;  4IHT A;  4G9Y A;  2M3A A;  1MNM C;  1T95 A;  1T6S A;  1ZK8 A;  3CD6 I;  2CW0 F;  3WE3 A;  3J80 K;  2CQN A;  4BU2 A;  4LMY A;  3F6O A;  3BOQ A;  1JT0 A;  3V7C A;  4RS8 A;  3NAR A;  4NC6 A;  4GGG A;  4WCG A;  2KJB A;  1IJW C;  4HQE A;  2L02 A;  1O3Q A;  1ACI A;  3LSR A;  5E8G A;  4PDK A;  2XAJ A;  1ZRD A;  5FJ8 J;  3BR2 A;  3LFU A;  5B1A H;  3PSF A;  4TV7 A;  1T98 A;  2M4K A;  2A69 F;  3F8F A;  4XKB A;  3VB2 A;  1SC7 A;  5TGT A;  4C30 A;  3RYP A;  4UV8 A;  4KYW A;  3CCL I;  3OR1 C;  4EAT A;  2O0Y A;  4S0H B;  2R0Q C;  1Y1W J;  1A5J A;  2V1U A;  3C2G A;  3FWE A;  1ZN2 A;  2HZD A;  2JK3 A;  4JX5 A;  2IPQ X;  3O3K A;  4XN0 A;  5HLT A;  3JSO A;  4CDG A;  2L9R A;  3M1C A;  2OJE D;  4KIC A;  2STW A;  3ZXS A;  1YW8 A;  1W7P B;  3OYH A;  4LJZ F;  4DZJ A;  3N05 A;  3E0J B;  4J00 A;  3R60 A;  3FBN B;  4NBQ A;  2LRE A;  3GXO A;  3GTP J;  2CV0 A;  3DP7 A;  4HPQ A;  1OKR A;  2DK8 A;  1BI1 A;  5E3L A;  1SAX A;  5IP7 J;  1K83 J;  3KET A;  3E6D A;  4XNF A;  2P5K A;  4UV9 A;  2E2J J;  1TNT A;  4ENJ A;  1JGS A;  2COM A;  3SHF A;  1B6A A;  4A6E A;  1B8I A;  1QO0 D;  2Y9Y A;  5HLH A;  2VT2 A;  3CME I;  1SVO A;  1OYW A;  3DEE A;  2VJI A;  2X1C A;  4UY8 I;  1MND A;  4YIF A;  2HVS A;  2E5Z A;  4KN7 X;  1O7L A;  4DYR A;  3ZP5 A;  1A35 A;  1ZGA A;  4CCM A;  5TRD A;  3WTS C;  4KNY A;  2OZ6 A;  2UUZ A;  4A3M J;  4PUS A;  3OL3 A;  1UFM A;  3KEY A;  3KPH A;  2K3F A;  3F8M A;  1X1A A;  1R58 A;  3KEQ A;  4IZZ A;  3SFI A;  1D0Y A;  1D0X A;  3E5X A;  4M3G A;  1VZ0 A;  2JUC A;  1NH3 A;  3HL2 A;  1HA8 A;  2M30 A;  5IOZ A;  1RRJ A;  3L2U A;  5CVJ A;  1F4K A;  3LQQ A;  4M3F A;  4I02 A;  1U8R A;  2ZO4 A;  2R93 J;  3OSG A;  4XR6 A;  2VE8 A;  3HUG B;  2R7S A;  2F5E A;  5LRS A;  4OIN F;  3I56 I;  2Q2E B;  4BEH A;  2QUF A;  2HXO A;  3T1B A;  2BXZ A;  3KX2 A;  4QWQ A;  1BIB A;  4IVN A;  2CV2 A;  1TWA J;  5CVV A;  1YLF A;  2I8D A;  2KZV A;  1X1P A;  1AA7 A;  1YX3 A;  5J1R A;  4ZJZ A;  3SJM A;  4JQF A;  4BHB A;  2NVU B;  4L0Z B;  2L9S A;  3MCZ A;  1J7K A;  3I4P A;  4D0P A;  2FBH A;  1X2N A;  3BZK A;  3V42 A;  4Z2Y A;  4M73 A;  2BV6 A;  2F2E A;  3JRG A;  1ITY A;  3Q0V A;  4P96 A;  3CUQ B;  4IOA F;  1U8B A;  1A04 A;  1IN4 A;  4DBQ A;  3MFK A;  3FMR A;  1HCR A;  2A05 A;  3MEX A;  3OS0 A;  4P9U A;  3KZZ A;  3GTL J;  3R4K A;  2PBI A;  5CKT A;  4ENK A;  3W6K B;  3S3M A;  4N0B A;  4C9Y A;  5M3M J;  3CZ6 A;  2LOO A;  5AIQ A;  1EV7 A;  3EYY A;  4W97 A;  2Q8K A;  2F4I A;  1S72 I;  4I0A A;  3SYT A;  5LHG A;  3GLX A;  4IHS A;  4N9H A;  3CC2 I;  1WJC A;  2V26 A;  4P9F A;  2CFX A;  3COA C;  3B02 A;  4OU0 A;  2XAG A;  4V2G A;  3ROU A;  4BAY A;  2VOO A;  2ZXI A;  3D5S C;  3DU5 A;  4DBR A;  1VND A;  3E5U A;  3LSK A;  1KYZ A;  1YO5 C;  1MJB A;  5J47 A;  1A31 A;  5KAI C;  4U0W A;  2IGO A;  2NRA C;  4HNU A;  2H8W A;  3QPS A;  4X6A J;  2LYC A;  5GAE J;  2FJ1 A;  3CP2 A;  2WV0 A;  5C3E J;  3HPH A;  4KIF A;  1V4R A;  3PUB A;  3S2W A;  4O3M A;  1FTT A;  4G12 A;  3F8N A;  3KCC A;  3FIW A;  4E7L A;  2Z5U A;  4M9X A;  3A4C A;  1FMW A;  4F91 B;  3TW7 A;  3O2P E;  4BL0 B;  4V2F A;  1IV8 A;  4HNV A;  2IT0 A;  3RKX A;  2G7U A;  1G4D A;  2PQ8 A;  2HS5 A;  3T5X A;  3FKJ A;  3LSP A;  1XGN A;  2V7F A;  4L5E A;  2BY2 A;  1MIJ A;  3E6C C;  1LDD A;  5D5V B;  3FHN A;  5CQE A;  3JAM K;  3HJE A;  2EIM H;  2BW3 A;  4A3F J;  2DAO A;  2OQR A;  3F9K A;  1K78 A;  5EJC A;  1JUM A;  2FF4 A;  1JT6 A;  2P81 A;  3FK6 A;  5LEJ A;  3S16 J;  3ABU A;  4XMY A;  4IHX A;  1T33 A;  2X1E A;  3BTL A;  1HW2 A;  4IQJ A;  2W85 A;  2MH9 A;  5ICG A;  2RC4 A;  4EJW A;  1JGG A;  1IXS B;  3K6G A;  4XLH A;  4AIK A;  1B72 A;  2EV0 A;  5CLS A;  3N4M A;  3JR9 A;  2VQC A;  4XSX F;  5IT3 A;  4OIP F;  1XSD A;  1CGP A;  1A36 A;  2EV6 A;  1ZGW A;  1YW9 A;  4A3B J;  1Y6I A;  1P4W A;  1IW7 F;  5FFX A;  3H3V K;  2HQN A;  3HRS A;  2P6S A;  4C3H J;  1KGS A;  2Q1Z B;  2LFB A;  4HSR A;  1AHD P;  2ZSI B;  3FK7 A;  3CO7 C;  1S29 A;  4WXH A;  3ZQI A;  2E5N A;  2PEX A;  2E1M B;  4ZH4 F;  4X0G A;  3TL4 X;  3Q0U A;  1FYM A;  4BH9 A;  1DPR A;  1ZGJ A;  2DT6 A;  1IC8 A;  3WGG A;  2L7F P;  3EQL F;  2QQ8 A;  3L2V A;  1FC3 A;  4EM1 A;  1WPK A;  5IYD J;  3W6J B;  3R6S A;  3ASO H;  3LFK A;  4HX7 A;  2E7W A;  3F8C A;  2KJC A;  5F6F A;  1SEU A;  2E35 A;  3BWG A;  5IYC J;  3EET A;  2W24 A;  1GV2 A;  3CCM I;  2M45 A;  4RGR A;  1VQO I;  1MJ9 A;  2LBF A;  2H1K A;  2A6T A;  4IX7 A;  3PO2 J;  3KP3 A;  2CW7 A;  3H5R A;  1WI9 A;  3H5A A;  5JR3 A;  3D5R C;  3S1M J;  3J7Z I;  1LFU P;  1QNT A;  2FOK A;  5E3M A;  1IXC A;  2CGP A;  2QWW A;  3QU6 A;  1IN8 A;  2DA5 A;  4KA4 A;  2UWM A;  3CJT B;  2WTE A;  2K9L A;  5ICE A;  1DGR M;  1TW2 A;  3CO6 C;  2RV8 A;  3JRE A;  3DFG A;  1NK3 P;  3KP4 A;  1ENH A;  1KA8 A;  4V19 K;  4P1W A;  1R4N B;  3I9V 2;  2JPB A;  2KIQ A;  3ZCO A;  3VYT B;  4CCO A;  5K5O A;  1R36 A;  4FIS A;  3K9T A;  5HDN A;  4CCJ A;  3RDI A;  3WU0 A;  2KMU A;  3KP5 A;  2FQ3 A;  4F93 B;  2O3F A;  2HYJ A;  5HOD A;  3CDL A;  3QP5 A;  1VQ7 I;  1OCR H;  2CUE A;  3HOV J;  4BBS J;  3K4M A;  3WG9 A;  3D0S A;  4BQA A;  2K3P A;  5IT9 Z;  2GA2 A;  2MG4 A;  5D5U B;  2R5Z B;  3OWT A;  3RQ4 A;  1XDU A;  3OYM A;  1F36 A;  3E97 A;  2UZK A;  4BEH B;  4LK0 F;  1K7A A;  3AG1 H;  2Y0S N;  2CS3 A;  1E2X A;  3I55 I;  1SFK A;  5CVR A;  4BKX A;  3CCS I;  5M5W J;  1H89 C;  3A01 A;  4ETS A;  1BC7 C;  5DD8 A;  4OWR B;  2FMY A;  1DP7 P;  3VOE A;  2VLA A;  4KIS A;  2LF7 A;  5H2F C;  1U0J A;  1T38 A;  1BJA A;  1S8N A;  1F43 A;  4H0E A;  3I3L A;  1SMY F;  1R4M B;  1S5L C;  1SD4 A;  1D5Y A;  1OYI A;  2DK5 A;  4II2 A;  2HOS A;  2X9D A;  3J7A O;  2P0W A;  4YFN F;  2PX9 A;  4RB2 C;  1JI8 A;  1B1B A;  1BM9 A;  5DEQ A;  4M71 A;  4LB5 A;  3CJQ B;  1MMS A;  1F9N A;  3A0B C;  3SZT A;  4UUT A;  4D7M A;  4XLF A;  5E18 F;  1W5S A;  2BEO A;  3E3V A;  1OJL A;  1HW5 A;  2XRN A;  2OQG A;  2XRL A;  2YU9 J;  4YEJ A;  3L2W A;  2VT3 A;  1Q1H A;  2HVQ A;  3JRC A;  3JCU C;  1T8I A;  4MO7 A;  1VQL I;  2QEX I;  1H88 C;  1IV6 A;  3QPT A;  4XKW A;  4E7Z A;  2R7R A;  2IRF G;  1I1G A;  5LLQ A;  3WG7 H;  2HQA A;  4QTR A;  2PLY A;  2XV4 S;  4OIR F;  2QKM B;  2LY1 A;  2HI3 A;  4YG2 F;  1XCB A;  4ZDP A;  1XN7 A;  3TDU C;  4NC7 A;  3P7N A;  1BIA A;  3PO3 J;  3OYG A;  5M5X J;  2O5R A;  1TW3 A;  3GLL A;  1FOX A;  2ZXH A;  3Q5F A;  4R8H A;  2YX4 A;  1V5E A;  5DCM A;  3U2R A;  3S2H J;  1AU7 A;  1Z05 A;  3ABT A;  1UG0 A;  3BZ6 A;  2JRT A;  1UB9 A;  2JVH A;  4EJU A;  3ELK A;  3CCE I;  3CCV I;  3AL0 B;  3LAJ A;  4XN3 A;  3SDG A;  3BR3 A;  1IZ1 A;  4PCQ A;  4FTH A;  3OR2 C;  1GLN A;  1P7I A;  1V5F A;  1Y0U A;  3ZQL A;  2DQR A;  2LMD A;  4CZC A;  3HRM A;  3S1Q J;  1Z3X A;  1TWC J;  5C4J J;  3LSJ A;  2JWT A;  4ZDL A;  2XGD A;  1L0O C;  5K1Y A;  5C4X J;  2L54 A;  1Z21 A;  1XGM A;  3WGH A;  1XMX A;  1FLI A;  4JP0 A;  1FP2 A;  2LKP A;  3LST A;  4Y15 A;  5GAG J;  3L1P A;  1E0E A;  1XB4 A;  4PJ0 C;  3CDH A;  3WHB A;  3BQY A;  2O61 A;  3RKQ A;  3BG7 A;  3HZJ A;  3AAF A;  1U5T A;  4I0B A;  4EQQ A;  1FOW A;  5FKO A;  4LIV A;  1FOK A;  4ZYH A;  3GTQ J;  4G94 A;  5GPA A;  2RVC A;  3V8K A;  3ERE D;  3RYR A;  5JI6 A;  1J9I A;  5EGO B;  2L7K A;  1U5T C;  2FRH A;  2P5L C;  1IO2 A;  4HNT A;  3HOX J;  1YW7 A;  1HW1 A;  4LD5 A;  2FX0 A;  3BLY A;  4MHG A;  1B9N A;  1O3R A;  2DXI A;  1KU9 A;  4XID A;  2VE9 A;  4AWX B;  1QPI A;  2MYS A;  5FLM J;  1LUJ B;  1RIO H;  1R7J A;  3A1Y A;  3KP6 A;  3HOW J;  4HOB A;  2B63 J;  4OAY A;  5ICC A;  1UHS A;  5F0H A;  1PP7 U;  2XUB A;  2XGX A;  2DJI A;  5CJ9 A;  2JPC A;  3M07 A;  4GDF A;  2PJR A;  2VBZ A;  1Z6R A;  1JE8 A;  4WF2 A;  2G9W A;  1LE8 A;  3K70 C;  2IVM A;  2M0M A;  5KHD A;  5H6Q A;  3K4N A;  3GEZ A;  4XBF A;  1DP3 A;  3SEQ A;  1KON A;  2K9M A;  1TL8 A;  2ECC A;  2UV1 A;  2QSH X;  3U1D A;  1Z67 A;  4HX8 A;  1W5T A;  3QRF F;  2KHM A;  2KRF A;  1JXS A;  2NXN B;  1L3L A;  3LMM A;  2EQR A;  2NS8 A;  3RI4 A;  3CCQ I;  4IPA A;  2QKL B;  1WZ2 A;  3BG3 A;  5CQG A;  2KIM A;  3AG2 H;  3ZOB A;  1X4P A;  3G1O A;  3BR1 A;  1B4A A;  1R71 A;  1RUN A;  2DT5 A;  3W3C A;  1EA3 A;  1Z6T A;  2A6E F;  4I2O A;  4HLY A;  3BQZ A;  2FEZ A;  2QA4 I; 
#chains in the Genus database with same CATH homology
 2ZJP F;  4PUS A;  4KIT B;  2HU9 A;  3OL3 A;  3KEY A;  4RLF A;  2VL8 A;  2K3F A;  3MKY B;  1X1A A;  4IZZ A;  1D0Y A;  3SEZ A;  1D0X A;  4GRI A;  1ERD A;  2NOJ B;  4AVZ A;  2CUJ A;  1QHG A;  1VZ0 A;  3HL2 A;  3EUH C;  1HA8 A;  2WY7 Q;  4HST A;  3ZGK A;  2LBF B;  2HPI A;  3L2U A;  1N75 A;  4BJ5 C;  5HNH A;  4ANJ A;  4E4H A;  3QYE A;  1SAU A;  2V1N A;  4XR6 A;  5DM6 F;  3HXL A;  4BQQ A;  2ZFU A;  4ZYA A;  3HUG B;  1S9H A;  2R7S A;  3CP8 A;  2IS4 A;  1TT0 A;  2Q2E B;  1UEL B;  1V5G A;  4BEH A;  5DM7 F;  3LSM A;  3KX2 A;  2CW8 A;  2RNG A;  2CV2 A;  3K70 D;  2I8D A;  1D1C A;  2F5V A;  2KZV A;  2OC6 A;  4FET A;  4XON A;  1AA7 A;  1YX3 A;  4ZJZ A;  4P5O A;  4JQF A;  2VAS A;  4PJJ A;  5CPR B;  2L9S A;  4BE1 A;  2VJ4 A;  2HNH A;  3AKZ A;  3VYU B;  3V42 A;  4B47 A;  1J09 A;  3OYA A;  4Y4R A;  3OYF A;  3EUK L;  1WIB A;  3OIQ A;  4F3Q A;  3UR3 C;  4XOR A;  3PNY A;  3ZR8 X;  4DBQ A;  1MNE A;  3OS0 A;  1LKX A;  5CKT A;  3S3M A;  4PK4 A;  3KYL A;  2JQ7 A;  1ZEL A;  3SDB A;  4C9Y A;  1X4O A;  2X6Y A;  4ZDO A;  4PFO A;  2W1O A;  4B3X A;  3CZ6 A;  2LOO A;  2ZSH B;  3A2K A;  4N4N B;  2X1D A;  2E60 A;  4XLC A;  2F4I A;  4BJT A;  3SYT A;  4FAS D;  3OY9 A;  1BOB A;  2GOM A;  2KL4 A;  4Y3O A;  3U21 A;  2VJJ A;  3HOS A;  1WJC A;  2V26 A;  2VKH A;  3OIP A;  2DOA A;  2BOL A;  2V9K A;  2BW3 B;  2ZXI A;  3D5S C;  3OYD A;  3DU5 A;  4DBR A;  2WAE A;  3OMY A;  3LSK A;  4IKF A;  2JVG A;  5JHF A;  5FRM A;  3K4C A;  5LFA A;  4OAZ A;  1Z7L A;  4YRV A;  3IUO A;  2IGO A;  3CES A;  4CH7 A;  3K4B A;  4HNU A;  2H8W A;  2LG4 A;  4PFP A;  2VKD A;  1X1B A;  4DGW B;  2WAD A;  2LYC A;  3OYE A;  2LH9 A;  1NG6 A;  3OYJ A;  2R7O A;  3IAS 2;  4PJN A;  3OYB A;  5KCM A;  3CP2 A;  3HKZ A;  1MMG A;  1D1B A;  3DQV C;  2WA0 A;  3HPH A;  1BR4 A;  2IGM A;  1N78 A;  3NWS A;  3PUB A;  3EGV B;  2RRE A;  2M7B A;  4BGD A;  4E7L A;  2L5Q A;  2A5W A;  3A4C A;  2PMZ A;  1FMW A;  1P9Q C;  4JOM A;  4F91 B;  2R7T A;  3RSN A;  4BL0 B;  4BAC A;  3DTI A;  4CCN A;  1WJD A;  3PNT A;  2W7N A;  2MC4 A;  3ONQ A;  3FKJ A;  1Z3Y A;  2XF5 A;  3OS1 A;  2V4J C;  2XAU A;  2V7F A;  2IS1 A;  3FHN A;  5CQE A;  4CCL A;  2BW3 A;  2BVM A;  4HEA 2;  3EPZ A;  4CA0 A;  2K5C A;  3F9K A;  1WFX A;  2HPM A;  5GAD J;  4NNJ A;  3CMM A;  2IS2 A;  3NWT A;  2W00 A;  3S8P A;  1PYV A;  2VQL A;  4XMY A;  3S32 A;  2X1E A;  3K4L A;  1MW7 A;  4E6K G;  2Y0S A;  4ITV A;  4BDY A;  2W4S A;  4NUB A;  4IQJ A;  2VXZ A;  4PJL A;  3K6G A;  3SZG A;  4XLH A;  3L2Q A;  1TZL A;  1YX5 A;  3CJR B;  3PNV A;  3QOE A;  4LIT A;  2VQC A;  2F6C A;  1D0Z A;  2X6W A;  1Y6I A;  3VDX A;  2L9N A;  4B48 A;  3M8J A;  3PJR A;  2Z2S B;  2OUM A;  2Q1Z B;  3BCA A;  4HSR A;  2ZSI B;  2IS6 A;  3RTR A;  4MLO A;  3UNG C;  4U7B A;  2E5N A;  1Y56 A;  1UAA A;  2E1M B;  4X0G A;  3TL4 X;  4NQW B;  4XLA A;  2KLO A;  1BR2 A;  3QYF A;  2DT6 A;  3VYS B;  2X85 A;  4AU7 A;  4H4K C;  3L2V A;  2M7A A;  2BVL A;  1T0F C;  3H35 A;  2R7W A;  5FRN A;  3RPU D;  2E35 A;  4QPO A;  4XQF A;  1NG7 A;  3GBG A;  4ZTF A;  3W2W A;  2ZJQ F;  3J7Y J;  2LBF A;  3HPG A;  1WJE A;  3H9Q A;  2R7U A;  2A6T A;  3VWB A;  1LDK B;  3S93 A;  4RMN A;  3H9G A;  1FMV A;  4IX7 A;  3EUA A;  3OYK A;  3H5R A;  2CW7 A;  1R6R A;  4BQN A;  4F52 A;  3H5A A;  2LY2 A;  3BC8 A;  3D5R C;  3J7Z I;  4DOZ A;  3OOU A;  3H0D A;  3MD2 A;  4XM3 A;  1W36 D;  2HDW A;  3E1S A;  2UWM A;  3CJT B;  2K9L A;  1DGR M;  4U87 A;  4B43 A;  2R7V A;  2X51 A;  5HNF A;  4XL9 A;  2HVR A;  2XDV A;  4V19 K;  4P1W A;  4F92 B;  3I9V 2;  1PJR A;  3LSI A;  5GAH J;  3ZCO A;  4BDZ A;  3VYT B;  4CCO A;  3J7A Y;  1MMA A;  1DQU A;  4LIU A;  4CCJ A;  2KMU A;  2VJ5 A;  4BS9 A;  3PSI A;  4F93 B;  3BCB A;  3IP4 B;  2FUG 2;  3QYB A;  4HG2 A;  4N4O B;  4C2U A;  2KQR A;  1WJ5 A;  2E34 A;  2E1M C;  3K4M A;  2K3P A;  3OWT A;  3RQ4 A;  3LSH A;  3OYM A;  2VQG A;  4D9J A;  3L2R A;  4BEH B;  4G6T B;  1QHH D;  2CS3 A;  1SFK A;  3CJS B;  2XC7 A;  2W82 A;  4RM3 A;  3MKZ A;  4OWR B;  4E7H A;  3D5L A;  2VLA A;  4KIS A;  2M4G A;  4Y33 A;  3S3N A;  4LG3 A;  1U0J A;  1X1D A;  3DTE A;  2CV1 A;  3HC7 A;  4XOT A;  3RCO A;  4KJZ A;  4XKC A;  3I3L A;  4D1Q A;  3FBI B;  4II2 A;  2P0W A;  3H9J A;  3LSG A;  1JI8 A;  4RM2 A;  1WJA A;  3PL8 A;  3CJQ B;  1MMS A;  2WBM A;  2CFO A;  3OYI A;  2AQE A;  4XLF A;  1OLT A;  1DGW Y;  4E7I A;  2KRH A;  4C2T A;  3W2A A;  2IGN A;  4YEJ A;  3L2W A;  4DIQ A;  1MMN A;  2E36 A;  3OYL A;  3MKW B;  2R7Q A;  4J01 A;  1W36 C;  4F55 A;  2HVQ A;  1YE9 A;  2V6E A;  2CUZ A;  2MFZ A;  3VYR B;  4XKW A;  3TMO A;  4E7Z A;  2R7R A;  2R4G A;  4IQ4 A;  3G2B A;  1X1C A;  2HQA A;  1N77 A;  4BQO A;  2QKM B;  2LY1 A;  4BE2 A;  4HRI A;  4ZDP A;  2VIX A;  2VQH A;  4NC7 A;  4BXF A;  3OYG A;  3ZQQ A;  2O5R A;  3K4K A;  2ZXH A;  1IRX A;  3K4J A;  3OYC A;  1V5E A;  4E7J A;  1K6Y A;  4QPQ A;  2CH0 A;  1UG0 A;  2RQQ A;  4CCK A;  3LL7 A;  4CSW A;  3DWL E;  2X6X A;  3AFH A;  4PSX A;  4PJM A;  2JVH A;  3AL0 B;  1WJB A;  1LVK A;  3CF5 F;  2XSJ C;  4XN3 A;  1G8X A;  4B44 A;  1QU3 A;  4XLE A;  5HOO A;  3CF2 A;  4XOP A;  2JA2 A;  2WB1 A;  3OR2 C;  2IXS A;  1GLN A;  4BUP A;  1V5F A;  2PJR B;  3DKX A;  3PFY A;  4II3 A;  4AYB A;  4KT6 A;  4CZC A;  2Z1D A;  1Z3X A;  4YEL A;  2M3A A;  4ZDL A;  1T95 A;  2WY8 Q;  4CUG A;  2MD0 A;  1G59 A;  1Z21 A;  1MMD A;  4BU2 A;  1OR7 C;  2DT7 B;  5KNL A;  4R79 A;  5GAG J;  1E0E A;  2WAF A;  4DJA A;  1D1A A;  4RLQ A;  3BG7 A;  3C2H A;  4LIV A;  2KPM A;  2VPL A;  2Z16 A;  4E7K A;  3VSL A;  3LFU A;  2LC2 A;  3H5N A;  2ELJ A;  3PSF A;  2OV7 A;  3DPU A;  2IGK A;  2L7K A;  3DPL C;  2KP6 A;  4HNT A;  2M4K A;  4XKB A;  5TGT A;  4C30 A;  3BLY A;  5FRO A;  3HOT A;  2DXI A;  3OR1 C;  2CMP A;  4EAT A;  2DCE A;  2R7X A;  3C2G A;  3OS2 A;  4BJ6 C;  2MYS A;  2KRC A;  2HZD A;  4BE0 A;  3TBI A;  3A1Y A;  3DU6 A;  4XN0 A;  5HLT A;  5LD2 C;  3OYN A;  4OAY A;  2VB6 A;  4XKV A;  2KDO A;  3M1C A;  2AQF A;  3ZXS A;  2DJI A;  3OYH A;  3ZRG A;  3N05 A;  3E0J B;  3FDY A;  4J00 A;  3FBN B;  2LRE A;  3AL0 C;  2CV0 A;  1LFP A;  2JUG A;  3VSK A;  4HPQ A;  2PJR A;  4PSW A;  3K10 A;  3K70 C;  3S3O A;  3MMY B;  2XF7 A;  2M0M A;  5KHD A;  3K4N A;  2JSP A;  3QOD A;  1DP3 A;  2GOX B;  3SEQ A;  4ZC3 A;  3BG6 A;  1KON A;  2K9M A;  4XNF A;  3W2V A;  3HG9 A;  2UV1 A;  3IAM 2;  3DPT A;  3DKY A;  2KHM A;  2WAQ A;  3DLA A;  2NXN B;  3LMM A;  2L2O A;  2LRD A;  2VXD A;  3DTK A;  3OL4 A;  4E7S A;  2QKL B;  3DEE A;  2VJI A;  2X1C A;  5CQG A;  1MND A;  4UY8 I;  2HVS A;  1BR1 A;  2E5Z A;  1X4P A;  2MAB A;  3W3C A;  1EA3 A;  4CCM A;  2XF6 A;  4NC8 A;  5HVQ C;  1WJF A;  2UUZ A;  4ZTJ A;  1X19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...