3CJQB

Ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 in space group p212121
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
140
structure length
121
Chain Sequence
KKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVAAFNAATANMGDAIVPVEITIYADRSFTFVTKTPPASYLIRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVVGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein L11 methyltransferase
publication title Multiple-Site Trimethylation of Ribosomal Protein L11 by the PrmA Methyltransferase.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase/ribosomal protein
total genus 22
structure length 121
sequence length 140
chains with identical sequence E, H
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2720 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3cjqB02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 3cjqB01
1WIBA 5GAHJ 2JQ7A 5DM6F 2E34A 1MMSA 2ZJQF 3CJRB 3CJQB 3J7ZI 3J7YJ 5DM7F 4UY8I 3CF5F 3EGVB 2NXNB 2H8WA 2E35A 3CJSB 2E36A 3CJTB 2ZJPF 4V19K 5GAGJ 5GADJ 2K3FA
chains in the Genus database with same CATH superfamily
1Z67A 5FO5A 1XSDA 1T6SA 1XPXA 1BW5A 2VPRA 2XRLA 1U3EM 3E6DA 4OAZA 3E6BA 3CJQB 4XK4A 2LREA 2EPFA 2ZJRF 1FIAA 2L7ZA 1Y1WJ 1ZQ3P 2EK5A 2KMUA 2LOOA 2HGCA 1UJ8A 3HGYA 3MFKA 1YQAA 2M7AA 2BXZA 3CD6I 2PG4A 2ETHA 2O3FA 2Y0SN 1RC9A 1RRJA 2A5YB 2ZXWH 4HEA2 3VODA 5DS9A 1NH3A 1LQ1A 2K02A 1O3SA 3LFUA 3PO2J 2ME0A 3H0DA 2HZTA 1HSJA 4C3HJ 2LRDA 2LKPA 2L9NA 4B8XA 2RNGA 1ETWA 4YEJA 2KIUA 4XKWA 2A6TA 4MTEA 1VQMI 4IHWA 1Y1VJ 2TCTA 1G3WA 3KYDB 1ONVA 3OS1A 3S3OA 1I5ZA 1FMVA 3CUOA 2OBPA 4WK8F 3K4LA 1TWCJ 3CDIA 2CUJA 3BR2A 1RUNA 2MBFA 5CVJA 3OYGA 4IOCF 2J5OA 1BM9A 4L9TA 3RKXA 2GOMA 2V79A 5E18F 3IC7A 1PYVA 1QPIA 1B6AA 4IQJA 4A0YA 4DQ2A 1AKHA 1SEUA 3DEUA 2I10A 3CJRB 1QU3A 3FKIJ 2WC2A 3IWFA 1AKHB 2NS7A 3CLOA 2XF7A 2Y9YA 1SMTA 2BW3A 5GPCA 2QKLB 5F0HA 1HCRA 1USSA 2BW3B 4NNJA 5CJ9A 3LSKA 4HOBA 2F5EA 1YJWI 1AA7A 4S04A 1AOYA 4DOZA 2JRMA 3ABLH 3V7CA 5JHUA 5BPDA 3PFIA 2Z1DA 4I0BA 3OYFA 4UNOA 1UELB 2CV0A 3FBNB 3FXLA 1P4XA 3FBIB 2ESHA 1HW2A 3CCQI 1STZA 4C3JJ 1Y8QB 5IT9Z 3S93A 2Q2EB 2X6OA 3IHUA 4A2UA 3WE3A 2XV4S 2W85A 3M1EA 3HG9A 4XSZF 3E0JB 4CSWA 5ICGA 3JR9A 4MO7A 2W48A 2E36A 3MZYA 2EFOA 3TO9A 3OV8A 3ABKH 2R7ZJ 3PUFA 3OWTA 4UUVA 2A5WA 5HDNA 1A36A 6PAXA 4M3BA 4QSHA 2D5VA 3BT9A 3A2KA 2GXAA 4HW0A 5FKLA 5B5EC 3U1DA 2H94A 5F1JA 2KIQA 1FP2A 1X1DA 2K27A 3S15J 5IPAA 4XRSG 3EUHC 1OCTC 4U88A 4DJAA 3DPLC 4E7ZA 4DW6A 3G6EI 1YI2I 1X4OA 1RUOA 3I54A 4P55A 1Y8RB 2AXTC 4IXAA 2W25A 3LSJA 4PGGA 4BQAA 3S1NJ 2LFBA 4BDZA 2CQXA 2VC0A 3H3ZA 3OYDA 2EA4A 4LK0F 4X1EA 2LH9A 3SDGA 5K7FA 2ZXHA 3OYHA 1ZH5A 2IGMA 4KN7X 2CYYA 3PSFA 2X85A 4JP0A 1JE8A 3I0TA 5K5RA 2HPIA 3B73A 3CZ6A 1ZK8A 2CW7A 1JKOC 3T5XA 1VQLI 1JUSA 3A02A 3KFWX 1VZ0A 4BXUA 1BI2A 1N77A 2V9KA 2GM4A 1K6YA 1XCVA 4L9JA 4LIVA 4BU2A 1U5TC 1IRGA 3OYIA 2E5ZA 4NBQA 2O61A 3EGVB 1QPMA 3WODF 3BG7A 2L7FP 2O03A 3I4PA 3NWTA 5E1ZB 1LVKA 2BZTA 2Y31A 4ANJA 3BG6A 3CP8A 2P6SA 1ZGAA 2QQBA 2QF7A 3HPGA 4YIFA 1F5TA 1SD4A 2XPVA 2FXAA 2UUZA 5HLIA 4IO9F 4J01A 2WAFA 3MKYB 1VQ8I 3BWGA 1NK3P 1YW7A 1IUFA 2STTA 1CGPA 1JTXA 3H5NA 1R22A 1HW1A 2KP6A 4U7BA 2E2JJ 2W4SA 1TL8A 1F9NA 2LF8A 5M3FJ 4P5OA 5JHFA 3GWZA 4AIJA 1X2MA 1RPWA 5TISC 1SFOJ 4HA8A 2LK2A 1X1PA 5J1YA 3KX2A 1YTYA 2JSCA 4E4HA 4RAYA 4LGWA 3L2CA 2EFQA 2PLYA 5HLGA 1FLIA 1IO2A 1Z91A 2MFZA 5E3LA 3CMEI 1T38A 2QQ8A 3S8PA 5TGTA 1LJ9A 2FEZA 2WAQN 4A6DA 2QQAA 4PFOA 3L2UA 5J8FA 4KDPA 1O3RA 2OQRA 3RZDJ 1HKSA 2QGUA 2F5DA 3OS2A 2OZUA 3E5QA 3A0BC 5FGMA 4O3MA 2JA7J 2Z5UA 2HR3A 3LSPA 2R7UA 2QENA 3M4OJ 1X19A 3V8LA 4A3LJ 1IGNA 1OKRA 4MQVA 5FKNA 1W0UA 1B9MA 1VQNI 4XOTA 4E7LA 2KDOA 2YR2A 3F0CA 2DYSH 2F2EA 2LP0A 2WBMA 3GTOJ 3FK7A 4UVAA 1VI0A 4I76A 3CC2I 3GTKJ 3CMYA 1P6RA 2EQRA 3Q9VA 4EJUA 5A2QK 2L54A 4G94A 2OJED 1IV8A 2OZ6A 4IRIA 4HYEA 3FXUA 3HXLA 2M4KA 3IL2A 3REOA 1O4XA 3V7SA 4UUTA 2CFXA 3FMSA 3R60A 1X3UA 4ESBA 2NRAC 4BAYA 2A61A 2RC4A 4C2TA 4ZYGA 1HKTA 1KU3A 3P7NA 3HOWJ 2KISA 5DV5A 4RM2A 4IJAA 4FE7A 4IVNA 3HSEA 5B1BH 3HOUJ 4OWRB 2DDBA 1IV6A 4LB6B 1D5VA 2FBHA 2COMA 3FX3A 2XF5A 3JRAA 1OPCA 1JKQC 2EA2A 2BVMA 2VQHA 2DMPA 4Y3OA 3FDYA 5FKMA 1I1GA 4XM3A 4Y52J 3CUQC 3SEZA 3I9V2 1DP3A 1XC5A 3J80Z 3EUHA 1IJWC 1R6RA 2H6BA 1FIPA 1I39A 3DU5A 1UHMA 3GTPJ 3CCRI 2JVHA 2GIVA 2KLOA 4L0YB 4AIDA 2XAUA 3EQLF 3A01A 3TL4X 1EF4A 3FXJA 2VASA 5EEHA 4AIHA 2KT0A 4RB0A 5K7HA 2LY2A 2CQKA 1LEAA 1MGTA 3S14J 5DM7F 1W0TA 1ZTRA 2WB1A 4HV6A 4YIRX 3RPUA 4BEHB 2IT0A 2CUZA 4U7DA 4ENMA 5C3EJ 4M9XA 2DLLA 1EH7A 2ISYA 3G4SI 2OCCH 4I2OA 4W1UA 2NVUB 3LQQA 5D8KB 2M5WA 1JJ6C 4RA2A 4HF2A 2ZJPF 1U5TA 2EIJH 4N4NB 2R7VA 1TT0A 1W36C 1VFCA 3S32A 1F4KA 2MYSA 3T0YA 2VKDA 1U5TB 2UV1A 1U8BA 2Y9ZA 1L3LA 3KIOA 5GTIC 1XX5A 4LOCA 1FOKA 3F8NA 4ETSA 4R8HA 2LR8A 2R4GA 2F5VA 1FZPB 2R5ZA 1ZR4A 3T8TA 3OYEA 1LFPA 1W7PA 5FRNA 2IEKA 2EIKH 3SZGA 4IKFA 1MMNA 1RETA 2FJ1A 3CESA 4RAGA 2Y48A 3JRHA 2R5ZB 1XTAA 4IEJA 4DGWB 2VT3A 4HSRA 3JTHA 3AG1H 4TV7A 2B0LA 2GOXB 2OUMA 1J2XA 1XN7A 2CG4A 2F4MB 3ISPA 3E5XA 3RQ4A 5LGNA 3AFHA 1R23A 2QVOA 4YFKF 2X1CA 1RI7A 2JTVA 4I0AA 3OYJA 2EINH 2VONA 3JREA 3ZGKA 3OYCA 3S3NA 1S6LA 3K0LA 4KUMA 1X1BA 2ELKA 2XKPA 2L01A 1K61A 3DBHB 2EH3A 2BGCA 4CCLA 3DKXA 4CCOA 3FHNA 5FROA 4NHJA 1OCZH 2ZFUA 4E7HA 2L9VA 1WJEA 1JUMA 5KVRA 1GT0C 1ZRFA 3LSGA 1DDNA 2V7FA 1LKXA 2H09A 4UUSB 3BTLA 2NAZA 2JQ7A 3HOVJ 2QWWA 1S9HA 5K5OA 3CTAA 4RAFA 3S17J 2Y75A 3L7WA 3WG9A 2HXOA 1ZARA 3K1MA 4IL6C 2M8GX 1Z21A 4GXOA 4E6KG 4BY1J 4YG2F 2VJJA 1ZKGA 3VFZA 2I8DA 1ORKA 1MBKA 1Y39A 1TNTA 4MFDA 4CZCA 1DPUA 1IXSB 2P6TA 3GZ6A 1E3PA 4EM2A 4LK1F 1O3TA 2W57A 1GV2A 4KA4A 3CMMA 2ELHA 5CQGA 1MMAA 3F8CA 3RKQA 4H0EA 1X2NA 1WQ2A 1V3FA 4YIIA 4UV9A 1YJNI 1PDNC 1LB2A 1B9NA 2COBA 1FYMA 4BDYA 2P5LC 4JOMA 4AYBN 2O6GE 4D5CA 2WAEA 3CUQA 2CS3A 1YITI 4X0GA 2WV0A 3TQNA 2UXNA 2VQCA 1JKPC 4PSWA 5E1WA 1W1WE 3CUQB 3FXKA 2VODA 2IS2A 3EYYA 1GHCA 5KNLA 3BR6A 2HOTA 1FY7A 2ZXIA 4B4CA 4DIQA 2DYRH 4BY7J 3CO7C 1BIAA 3SZTA 1P7IA 1REPC 3KP3A 3PIPF 4BQNA 3ULQB 1S7OA 1V55H 3JRDA 4IHSA 3B6CA 1IXRC 3I71A 2KHMA 1DQUA 2VBZA 2K86A 5J4YA 1V54H 3LQRA 2DQLA 2DT6A 2XB5A 1IDZA 2KJBA 5CVIA 5EGOB 5JR3A 4G7ZF 4DZPA 2XASA 1MMSA 4IPAA 2PI0A 2F4IA 4KT6A 1ENHA 2HS5A 1XCBA 3HM5A 4BXFA 1FP1D 1R5ID 3QPLA 2GXGA 3RYPA 1R1TA 3M1CA 4LLLA 2EB7A 1D1CA 3LSRA 4LD5A 4XKVA 2OTJI 4PJJA 3RKYA 3V7RA 3C2HA 2IA0A 2AO9A 1KQ0A 2Q8KA 3WGGA 3H35A 3F6VA 1KQ8A 4XQFA 2OU2A 1KYZA 3BTIA 4L9NA 2P81A 2M4GA 1KQ9A 3MAJA 2HTJA 3I4MJ 4G7OF 4N9HA 4U87A 4A0ZA 4D9JA 1N25A 3PNTA 4HF0A 5GP9A 1FBQA 2F5CA 4MIMA 4X6AJ 2VKEA 4JX4A 1IRXA 2DOAA 2TDXA 3OR1C 2CUFA 2E35A 4HAMA 4ZZDA 2IS1A 3PM1A 4BHBA 4CH7A 4JX6A 3ZQQA 4C2UA 4UHTA 4BHCA 2RKHA 2VQGA 3KP2A 2JA8J 1V5FA 2KIMA 3S2DJ 2CQ7A 2IXSA 2B7EA 3F23A 2XAGA 4HX8A 1GUUA 2EZLA 3KEYA 4IX7A 2UWMA 3KETA 1ZGJA 1S29A 1J09A 5CYVA 2MC4A 2JPBA 3O8HA 5F0CA 5HVQC 4ENJA 3WHBA 2VQLA 2BOLA 3FMRA 2NVQJ 2XVCA 4WXHA 3BROA 4YFNF 2BY2A 5TRDA 3DEEA 1NTCA 3NRVA 4M6XA 3A03A 4RLFA 3TMOA 1YW9A 2DK8A 2EZHA 5F64A 5DEQA 4ON0A 3SZPA 3S16J 1QO0D 5GTHC 2F4OB 3ERMA 5ERIA 2PJRA 3DCFA 2GBYA 1Z7UA 2ZXJA 2EV5A 1SANA 1FWZA 2K40A 1S5LC 2Y69H 3LA7A 4A3JJ 4G6QA 3QOPA 2PJRB 3TDZC 1DGRM 5IYBJ 2V4JC 3ZQCA 3VEPA 2EJRA 4A3KJ 1XMXA 2FBKA 2LY9A 4FISA 4UVBA 2H1KA 1I27A 1Z3XA 2MLKA 3DXJF 3GFJA 4O5VA 1Z77A 4PFPA 2FF4A 2ZKZA 3CCSI 1BIBA 2E7XA 2CV1A 4L18B 4V19K 3W6KB 2HWVA 3ZMDA 3CCUI 1XGNA 1E17A 1ZRDA 3I5UA 4G7HF 5DDGA 4CYCA 2E34A 2PMUA 1FC3A 2J5PA 4I99C 4M3FA 4MLOA 2EV0A 4CICA 4PJ0C 2NNYA 4CYCB 2JVGA 3HJEA 2DJNA 4A3GJ 1W36D 3K70C 5CLSA 3IAM2 2M0CA 1GVJA 1UG2A 2W1OA 1TQPA 4ZH4F 2NVYJ 2QQ9A 1TZLA 3AG3H 3DKYA 3BZKA 4P96A 2L3DA 2XHKA 1P2FA 5L3BA 3FXRA 3TKYA 1YS6A 3TDUC 1XSXA 5HDGA 2L5QA 1FEXA 4BKXA 2HYJA 3BTCA 3H9GA 4CO8A 5FJ8J 4LIUA 4OU0A 3HKZA 2R93J 3BJ6A 2FX0A 1ZHFA 1GLNA 2C6YA 1FOYA 1X3WB 4ZYDA 3RIRA 3CCLI 2BE5F 1HW5A 3DU6A 2R0QC 3CO6C 3C18A 3NQOA 1FBSA 3HOTA 2QM3A 1BI1A 1ITYA 1QZZA 1U9OA 2CMPA 2FE3A 3MKZA 3UNGC 1IN5A 1H88C 3HC7A 3D5SC 2RNJA 2VJIA 3CJSB 3SHFA 2IA1A 2Q0OA 4RB1A 4JYKA 3M07A 3BC8A 4ABZA 5BQTA 3SFIA 3ZMUA 3JTGA 1X3ZB 5HNHA 5H6QA 1ETQA 3LNQA 2MSYA 3RJPA 4I01A 4CDGA 4XRFA 4EM1A 2R5YA 3O2PE 1UMQA 2PEXA 4ZTFA 3OIQA 3FF5A 4D0PA 4S0HB 1FT9A 2PBIA 3GXOA 2WWYA 1GXPA 1OCPA 4MEYF 3CCJI 3IH2A 1FOXA 3QQAA 2PFBA 1G59A 3DFGA 2FRHA 4PDKA 2RV8A 2X6YA 1U0JA 2YS9A 5K1YA 1RNLA 3JW4A 2JA5J 4NUBA 1R1UA 2Y0SA 1MH3A 3JRCA 4HQMA 4MFEA 2FD5A 3BLYA 2HKOA 2VBYA 3GTJJ 2L7KA 5F08A 2ID6A 4AU7A 2ZBKA 2DMNA 3ECHA 2N8GA 4BHPA 1DGWY 2A05A 4QPOA 2DPDA 4FT8A 2MABA 4P9FA 2LMDA 2WY8Q 4RAZA 4F55A 3HTSB 2DW4A 1SFEA 2DA4A 3W2VA 3H5AA 3L2RA 2R7RA 4GDFA 2DMTA 2RGVA 1I1SA 4M6VA 5ICCA 3BOQA 1X58A 3ZN0A 2XSJC 5GAHJ 1LE8A 4U0VA 3CLQA 2HFHA 2Y0MA 4DYQA 5J4VA 3J7ZI 3IWZA 5FLXZ 1LE8B 1J5YA 2WV1A 5KHDA 1B8IA 2LG4A 4JBAA 4C2MJ 1X4PA 4XORA 1V4RA 4UB8C 4HZFA 5E3OA 1B8IB 2DFHA 2FUG2 4O6JA 3JAMK 4UB6C 3WGHA 3BCBA 3T1BA 2YUSA 1E3HA 2OCEA 5EG0A 5EDNA 4R79A 2LYCA 4ZYAA 1VQPI 1BOBA 2PX9A 2KRHA 3F72A 2ZJQF 1U9NA 1QVTA 3H36A 5JI6A 3QPTA 4UXNA 1WWXA 3GEZA 5LGUA 4V2FA 2WADA 4ZYEA 3T8RA 3AG2H 1ETOA 2R7XA 2JJ7A 2K9NA 1QRYA 2LD5A 3LAPA 3KP6A 1YE9A 4HDUA 2K3PA 2VJ4A 4XKCA 5HOOA 2K9MA 1R49A 4GFBA 1U8RA 5GADJ 3ZXSA 1QGPA 5ILUA 3Q0VA 1VF9A 3WU1B 4Z6YA 1BL0A 5C4XJ 1UFMA 3BDDA 3MCZA 1RKWA 3ERED 1OYWA 2ESNA 4G8XA 4A0XA 3MN2A 1FNNA 3RZOJ 2VUMJ 3A1YA 5LHIA 4OOIA 3V8KA 3S2HJ 1D0YA 2ZCWA 2Z99A 1WHUA 2K4BA 5JFRA 5E8GA 3OL4A 2FMLA 2RQPA 4CCJA 4A3CJ 3SDBA 2GAUA 2JSPA 3BG5A 5KCMA 3KLNA 3JSPA 1MD0A 4EVIA 2GIZA 2V26A 4KIBA 5HDKA 1KU7A 4Y13A 1PJRA 3OL3A 2MGQA 3EETA 3G2BA 2W24A 2XGEA 4KT5C 3ECOA 1X1CA 1FMWA 4Y7NJ 5F6FA 4NDLA 1MBGA 4PZJA 2VL8A 4KJZA 2DXIA 1FX7A 4D1QA 2Z9OA 3FMQA 1F1ZA 2LF7A 1ZREA 5J47A 3OYLA 2XUBA 3QP6A 1HA8A 1XMKA 4Y33A 2V9PA 4IHYA 3VDXA 2E5NA 2X9DA 3PL8A 2BVLA 2JN6A 1FJLA 2CJJA 1YYVA 1OCOH 3TW6A 3ZRGA 4ENKA 2LTPA 4HV5A 2IVMA 5E3MA 1ETYA 2ZNZA 2HNHA 2CV2A 4R1HA 4F7ZA 2X0LA 2HQNA 1K4TA 1XB4A 5D5VB 3J7AY 4A69C 2QA4I 3N97A 1CQTA 4E7JA 3TEDA 1MNDA 2G9WA 5LLQA 2HPMA 3HOYJ 1A6QA 2CW8A 3W6JB 5F04A 2RAEA 3KLOA 3GTGJ 1D8JA 3Q0UA 4CA0A 2BYVE 2XAFA 3FK6A 4A5MA 1ZG5A 4FX4A 3OMYA 1IAWA 4DBQA 4ENNA 3GVAA 5IYCJ 2NS0A 2V9VA 4FTHA 4ASNA 4F93B 1MBHA 1HDDC 3CMAI 1T2KA 3DPUA 4BXXJ 2WAQA 4BE2A 4ZDOA 1G3YA 1WRJA 2FNPA 1SFXA 2DA3A 2PQ8A 1DPRA 3HEFA 4FHTA 2QSGX 2KQRA 3WTUC 1APLC 3LSMA 3VOEA 4NC7A 1WGXA 2W00A 3QP5A 3K4KA 3SJMA 2ZO4A 4BS9A 2X1DA 5LHGA 4Q47A 4EQQA 2G0EA 4FASD 2QLZA 4IQ4A 1IG7A 1PP8F 1HF0A 3R0AA 1QHHD 4M6YA 1F36A 4I6ZA 2Q1ZB 1FPQA 2M8EA 3RSNA 1Q1VA 1BI0A 4KIGA 1SAUA 1TBXA 2NNNA 4UV8A 4D5FA 4B43A 2IS6A 2FSWA 1OYYA 3TGNA 3G3ZA 1YO5C 1MJAA 3U9GA 4EJOA 3I64A 5LRRA 5L3GA 3KE2A 1F43A 1WI3A 3MQ0A 2GWRA 2LNBA 5J3LA 4W97A 4B3XA 4EJWA 3IAS2 2K9SA 4G9YA 3A01B 2JRTA 1LDDA 3W3CA 3GO5A 2A69F 3ZQ7A 3I53A 4AWXB 5DD4A 1H89C 2AS5F 1I3AA 3JCUC 3AKZA 3IRQA 4E7IA 3LMMA 4JQFA 2CH0A 2M3AA 3M8JA 5HNFA 4II3A 1MW7A 1R5HA 1TP4A 3PIOF 3RI4A 2UXXA 1JUPA 1XGMA 2MLGA 3K7AJ 4HPQA 4MTDA 4GO1A 5M5YJ 2KFDA 2ZSHB 1JJ8C 3BR1A 2HQ5A 3OYAA 1TT5B 3B6AA 4P1WA 5F0FA 3CF5F 3HSRA 4CCNA 3CJNA 1G3TA 1TWHJ 4GRIA 5J1UA 3L2VA 2E2IJ 4CGZA 2H8WA 5BMZA 3PSIA 4XKBA 4OIRF 1T08B 1VQ5I 3LA3A 4M9ZA 1EA3A 2DMUA 2NYXA 2XAJA 3HHHA 4IRGA 2DAOA 4EGZA 4L9VA 1W7PB 1D1AA 2DTRA 4MQ9F 2CUEA 2CSOA 4AUXA 2KIFA 2ECCA 3BR3A 3F9KA 3OIPA 3I4NJ 3LSIA 1YRNA 2ZMEC 3RYRA 3J7YJ 5GAEJ 1Z9CA 3VYUB 2X6XA 5JLWA 1YRNB 5FLMJ 4PSXA 2ISZA 4HX7A 2DT7B 4AVZA 3V8JA 4HNTA 2JA6J 1WFXA 2VC1A 5CQEA 4RGSA 3LFKA 3G73A 3S1MJ 2FOWA 3GCMA 2X51A 4M73A 2BXYA 2L4AA 3D5RC 1B59A 2L7MP 5C4JJ 1BOAA 2F48A 4CUGA 3V4GA 1Y0NA 1A04A 2PMZN 3GTLJ 3F8BA 3DLAA 3PJRA 5F1RA 4I98B 3CDHA 2GLOA 2EFPA 3HOXJ 3VB2A 1IC8A 1JGSA 3K1PA 4WWCA 2JWTA 3QRFF 2K9QA 1I50J 2LSOA 1ZN2A 4XLEA 1HQCA 3G1OA 2A6EF 1USTA 2HOSA 2E1OA 1S7AA 1R58A 2KZVA 3K6GA 1OCCH 1JGGA 1WI9A 2DFIA 4XL9A 1XD7A 3SFZA 3LSTA 3D5LA 3TP3A 5LRSA 2D1VA 3TO6A 3AL0C 3HGGA 3K4NA 1LEBA 3A4CA 3DV8A 5CKTA 2DBBA 4PGHA 2AQFA 4XLFA 2E1MC 1Z1DA 3S2WA 5L3FA 1HLVA 2R7SA 1U6GA 1NHAA 3RPUD 1LVAA 2DDAA 2LDUA 3X2QH 4GGGA 3BTJA 2VOPA 3QPHA 1VQKI 2WTEA 3Q3SA 4EATA 4OMYA 2QBYA 2HYGD 2QSFX 3KZIC 1LPQA 5AIPA 1I6HJ 1IDYA 2CWEA 3ABTA 3PQKA 1LFBA 3IH3A 2XROA 1WJDA 4JX5A 4LMYA 3JRFA 2QBYB 4A93J 3HRMA 4L5EA 1R4MB 3BP8A 1R71A 2VB6A 3MZ8A 3QODA 1JT0A 1XDSA 3GZNB 3WGIA 1LFUP 4BE0A 2W7NA 3QOEA 4II2A 4B47A 2KL4A 3WU2C 4I02A 4KYWA 5IT9K 2O7OA 3WTWC 3I3LA 3RCOA 3BY6A 3KYLA 5BS6A 1TQMA 5D4RA 2OTLI 5K7ZA 2MH2A 1BN5A 2K3FA 2M30A 2ZJ2A 3CCVI 1W7PD 2IJLA 1YOVB 3FWEA 3WTVC 4FETA 3MD2A 5H2FC 3E1SA 4ZDLA 1IUYA 1AWCA 3FXMA 1KU9A 1BI3A 1JKRC 5M5XJ 2CQNA 2VJ5A 2EFNA 1D1BA 1Y56A 2EV6A 3K4BA 4RB3C 1HBXG 3J7AO 2ICWG 3HOSA 4KMUX 3J81Z 2YX7A 1ACIA 3A0HC 4M74A 3GTQJ 4BQQA 2CGPA 1ZG1A 1IZ1A 4KITB 3MMYB 2P0WA 2AHQA 3HSFA 4P9UA 1UAAA 2RDPA 1Z3YA 2H6CA 3CC7I 5LFAA 3KP4A 2K4JA 2DJIA 1BJZA 3CQZJ 2L2OA 1HXDA 2OD5A 3K2ZA 4DYCA 1E0EA 4QLCU 2CO5A 2X48A 3DF8A 2ZMEA 1HC8A 3DPTA 4WF2A 2XAHA 2HOAA 3KYCB 3SEQA 3OSFA 5D4SA 4C30A 2ZMEB 5E20A 5DYMA 3WTZA 3OYMA 3COAC 5L3EA 5ICFA 2R7OA 1D8KA 4MGRA 2EIMH 3K10A 2HZDA 4PJNA 5A2QZ 2E2HJ 3JRGA 5D5XB 2HTSA 3ASNH 1BC7C 4XRMA 4RBOA 1S8NA 2O8XA 3KP7A 3VSLA 1TWGJ 4XLAA 4XLPF 4HDVA 2AXLA 1UHSA 2E60A 4LJZF 2XC7A 2O9LA 3RKWA 9ANTA 4A3BJ 2DI3A 4FQGA 3BJOA 2V1UA 1R36A 4ZDPA 3RTRA 3I59A 4YFXF 5D5WB 3FHZA 3F3XA 5L3DA 4Z2YA 4BACA 1ZLKA 1G6NA 4ZTJA 5EYRA 3GBGA 3K4JA 3CCYA 3FZVA 1RZ4A 3OYKA 5ICEA 1OMIA 1WJFA 4N4OB 2HVRA 2BY3A 1DUXC 3S1QJ 4QPQA 3GW2A 3RPQA 5H6RA 3M9AA 2MH9A 3HIFA 2R7QA 4ZJZA 5GPAA 4F52A 4RGUA 4IZZA 4YELA 4KICA 1YW8A 2BHZA 2QYOA 1B1BA 3HUGA 2P8TA 4LLGF 2HYFA 5TJJA 4RMNA 4B3AA 2EBIA 3R61A 3AL0B 3TO7A 3OIOA 4N9IA 2DN0A 3HUGB 3ZQHA 1U78A 1R5GA 2LY1A 1BA5A 3ZN1A 2BBYA 1T33A 1IF1A 2F6CA 4KISA 3AG4H 3BQZA 1YS7A 2IGKA 3ZMSA 4BL0B 2DA2A 4LLNA 1D0XA 2DCEA 3NAUA 3L00A 1E2XA 1UCRA 1L0OC 2DOFA 2IP2A 5FKOA 1PVEA 2IGNA 3ZQGA 2D2WA 3H9JA 1RKTA 2XSDC 1G4DA 3BPXA 5IY5H 1J75A 4CCMA 4C9YA 3NEUA 1WZ2A 1N78A 4HNVA 4HX4A 1OFCX 3ZMTA 4A6EA 4HF1A 4B1RA 1R1VA 3QU3A 2HDWA 1Z0XA 1DU0A 4HBLA 2Z3YA 3E6MA 3VYSB 3W2AA 3EYIA 2F5FA 2WA0A 4A3IJ 4IHTA 1Z7LA 2W84A 2LVSA 1N75A 1ON2A 1MIJA 3LOCA 4NQWA 4KNYA 4K2EA 3ABMH 1HSTA 2LLKA 2G7HA 3O8GA 1MMGA 4IHXA 3ZP5A 2NOJB 5JVGF 3VYTB 4BBRJ 1FYLA 3QWLA 4XSXF 3MVPA 2K7LA 2NVXJ 1Y0UA 3NWSA 3J80K 2FNAA 1VTNC 4IRHA 1O7LA 4PCQA 4EV0A 5IOZA 3HOZJ 1MNMC 4EMSA 4GCVA 4Q5SF 1YFHA 1P92A 2M1BA 2GZWA 4F91B 1KYWA 1W4MA 4QWQA 1IN8A 2V6CA 5IP9J 1Z6RA 2R5YB 3K4CA 3HRSA 2ECBA 2MW8A 3DTIA 1FBUA 1OQYA 2OF7A 3B02A 2R7DA 5EZHA 1HOMA 2P7VB 5LD2C 2FOKA 1R7JA 3F8MA 1O7FA 3K2AA 5IYDJ 3HB9A 3WG7H 2IS4A 5IP7J 1P7JA 2D1HA 2VXDA 3DKWA 2HDDA 2JUGA 5J6XA 5B66C 3JSOA 2V6EA 1H9GA 2QKMB 1WKMA 2M0MA 4LFUA 1ON1A 4NB5A 1XGOA 3OR2C 1O57A 3E6CC 1WH7A 1AHDP 4Y15A 2DQRA 2O0YA 3I56I 2DPUA 2L4MA 3ML6A 3H3UA 3M7GA 3H92A 3F21A 3CC4I 3E7LA 3GLXA 2EFWA 1MNEA 2DODA 3IRRA 3IKVA 1LUJB 2DK5A 1WIBA 1FSHA 5FD5A 1GDTA 3MWMA 5BPIA 3O3KA 3PFYA 4WX9A 1A5JA 2Z16A 2K5CA 3BR5A 3LSHA 2D45A 4HQEA 2ACJA 3IKTA 1UB9A 4M72A 1W5SA 1JHFA 3WTSC 1XS9A 5HS9A 5LEKA 2MD5A 3P9CA 4BYYA 4LG3A 3U1KA 1TC3C 2XGXA 2YX4A 3HRUA 2ZB9A 3F8FA 1I6XA 3KEOA 1I3QJ 1P4WA 5BOXA 2M2EA 2IA2A 2JMWA 2KZGA 3K1NA 3JRIA 1FTZA 2B9SA 1O3QA 3UKGA 1ODDA 2Q2EA 4EJTA 4A3FJ 4XR6A 3I58A 3HL2A 2M87A 1SD6A 4BGDA 2H27A 5M5WJ 3BQYA 3WHCA 1FSEA 5EG0B 3ONQA 3FXQA 3BZCA 4G6TB 2JK3A 5E3NA 2K85A 3BR0A 2Y30A 4PJLA 3EUKL 5AIQA 2DA1A 5GAGJ 2KKOA 2OC6A 3IP4B 2DU9A 4M3DA 3LAJA 3C2BA 2IRFG 3MZHA 2PMHA 1ERDA 3VPRA 1BR2A 1WVRA 1DU6A 2XPUA 2JZYA 1X1AA 3C7JA 3QPSA 3FIWA 5DCMA 2M9HA 4DYRA 3H5RA 2MC3A 1UG0A 2IW5A 4DBRA 4XICA 1VQ4I 3CCMI 2BY1A 5DCMB 2HI3A 3KZZA 1TWAJ 4C3IJ 3QYFA 4RM3A 3L2WA 1VQ6I 1R4NB 2GQQA 1ZRCA 2DOEA 3DLLF 2R92J 2R3SA 4ESJA 3R4KA 4OINF 1VQOI 4WXCA 2PN6A 5E79C 5D5UB 4ESFA 2KDZA 3MEXA 5C44J 1TW3A 2XDVA 3H9QA 2HU9A 4BBSJ 3L1PA 2DTZA 4AIKA 4NC8A 2IPQX 1VQ9I 3HYIA 1QQIA 1IRZA 3TW7A 5E1XA 1XG1A 3OSGA 2NXNB 3GX4X 3HRTA 4AM3A 4CYDA 1HKQA 5HLHA 1YIJI 2BEOA 2VI6A 3CJTB 3IV5A 3ZQIA 4Q4ZF 2O5RA 4U0WA 1FOWA 4F3QA 2NS8A 3HHGA 3TBIA 2ID3A 2X6WA 3P9KA 1K6OA 2RVCA 2HQAA 1J7KA 1NG7A 2DFFA 2VN2A 2EZKA 4FE4A 4A3EJ 1EV7A 4BQOA 1BBYA 3M8EA 4HLXA 2HXIA 1B4AA 2CQQA 1K7AA 2DA7A 5CVVA 3IH4A 3TOAA 5D6FA 1Y6IA 2P5VA 3J81K 4KFCA 2FBIA 1Z6TA 2EILH 4OIQF 1K79A 3SXYA 1AU7A 4XOPA 4M3EA 2ZNYA 2OA4A 4HNUA 3QAHA 1K4SA 3GFMA 5DD8A 2RN7A 3GTMJ 5B1AH 2KJCA 1ETXA 4M9SA 4KMFA 5L3CA 4UY8I 1TLHB 4MEXF 5HODA 1WJCA 1QHGA 3HPHA 2VOOA 2P7CB 4J19A 5EZGA 4RDUA 3E5UA 4EJVA 2VT2A 2KRFA 5DUKA 2XB0X 1BR4A 2R7FA 2HEOA 2E19A 1Z05A 3C3WA 2A3SA 5FFXA 3OY9A 2YPRA 1S3JA 5IT3A 3K70D 4HRIA 1NK2P 2QSHX 2CRGA 1R9TJ 4U0YA 5M3MJ 3KPHA 1EH8A 1S72I 2L9RA 4RGRA 3ZR8X 4AC0A 4ZC3A 1E3OC 4BJTA 2FU4A 3H1CA 3PQJA 5DTDA 1RIOH 3GF2A 1JHHA 5LEJA 3F6OA 4BNCA 1SVMA 1YIOA 4FX0A 3G1MA 2E71A 5CPRB 3R0JA 3VWBA 2HVSA 2ADUA 2A07F 4PK4A 1JXSA 2OQGA 2V1NA 1SFUA 1LDJA 3U21A 2O8KA 4BE1A 1H8AC 1NG6A 3N05A 5BNGA 2RQQA 4I7HA 1A31A 2WB1N 1WPKA 2OPTA 2Z2SB 4B44A 1WJAA 3GYHX 3K4MA 5JVTA 3DBRB 1UZCA 3KP5A 3GUDA 1ZYRF 1J9IA 1XSVA 5D6EA 3VSKA 1YJ9I 3NARA 3Q0WA 2X1EA 5KAIC 3ZQLA 1IN4A 2XKOA 3GFIA 2ZC2A 1ZGWA 3N4MA 1SVOA 5JLXA 1C0WA 5FRMA 3E3VA 2AQEA 3FM5A 1T39A 2XF6A 4IOAF 4B09A 1IN7A 5EEAA 1W5CC 2VE9A 4I09A 5DM6F 4BEHA 4QIWN 2HQRA 3SQNA 2JPCA 1T56A 3VYRB 2V1DA 5B3SH 2K9LA 2E1CA 1FTTA 3ESWB 3PNYA 2VBWA 3S1RJ 1RR7A 2H8RA 3KZYA 3K9TA 2XGDA 1R00A 2NVTJ 1SFKA 1JI8A 3D0SA 5CVRA 3AAFA 2VIXA 2OAZA 3U2RA 1PUEE 2B63J 1ZLJA 2ELJA 1S7EA 2QCOA 3KEQA 1WSUA 4D7MA 1TTYA 1MMDA 3ZMZA 2HKXA 1G2HA 1K83J 3OOPA 3Q9SA 2DA6A 4Y17A 2L0KA 4MNUA 4XLCA 3DEWA 1KU2A 3GLLA 4KN4X 3EPZA 2VXZA 4N0BA 5DCFA 1P4AA 2CFOA 2X4HA 1A35A 3GZ5A 1VQ7I 1P9QC 1PUFA 1IXCA 1ZELA 1TNSA 4RS8A 1T0FC 4XIDA 1T8IA 2HVQA 2JUCA 4BH9A 1PUFB 3S3MA 4L5JA 2WY7Q 2DA5A 3L2QA 1K78A 4KIFA 3G1LA 3V42A 4A3DJ 3BJAA 2R7WA 1WJBA 4ITVA 2DFEA 3L9FA 1K78B 1EJ9A 2L9SA 4ZYHA 1H9TA 1GV5A 3GFLA 4PJMA 3BG9A 2STWA 5EJCA 3JAMZ 3OS0A 1MSEC 2CU7A 1BW6A 4JK1X 2P5KA 3ZMVA 2FQ3A 3H0GJ 4UUSA 1SAXA 1T98A 4HG2A 1MJ9A 3DTEA 1SC7A 5E17F 1DP7P 2V1XA 2M7BA 3DP7A 1HDPA 4G12A 2VKVA 2XRNA 2A68F 4CCKA 2A6HF 2XPWA 3G71I 2IGOA 2QUFA 3C1DA 1ZR2A 4XLHA 3DTKA 4L5IA 4M71A 3D1NI 1YLFA 3PNVA 2PMZA 2BV6A 2TRTA 1ULYA 1RESA 3OYNA 2VKHA 2VE8A 4F92B 2FMYA 3ABUA 5KAFC 1SD5A 4HLYA 4BUPA 3R6SA 1BR1A 2GA1A 4XNFA 4IF4A 2LC2A 3EUAA 3RQIA 2JA2A 3K69A 5K5QA 1IN6A 1IRFA 5IOYA 1FYKA 2IBDA 1XGSA 3W2WA 3DQVC 1GXQA 1IW7F 2HOEA 2MD0A 3HZJA 4EM0B 4XMYA 1MSFC 2VBXA 3PUBA 4XN3A 4LG0A 5DUIA 3FISA 4DZJA 5HS8A 4XRSA 1OR7C 4HSTA 3TP0A 5FLXK 1ZAOA 2ME6A 1KGSA 3I55I 4LG0B 2DO7A 4QTRA 1VNDA 3TOBA 1V5EA 2XGCA 4S05A 4G6DA 4XBFA 1J0RA 4E70A 3CF2A 2H1LA 4AVPA 1LDKB 2ZFWA 5H20A 4A5NA 4AYBA 2DMQA 4FCYA 3QYBA 2P4WA 1M1EB 5LHHA 2FA5A 1ETKA 2E1NA 2IAIA 2LKSA 3ZPLA 3O6BB 2FQ4A 2QZ8A 1QZEA 2JT1A 1MKMA 3FM3A 3IUOA 1TQIA 2CW0F 4Q48A 5FFZA 3LA2A 1XDUA 1LNWA 3QYEA 3Q5FA 3C2GA 5AONA 1TWFJ 1ETVA 1MBFA 5EGOA 2GXBA 3GMEA 1RR8C 4WCGA 2PJPA 2DT5A 4XLNF 4CZZA 2W82A 3WTTC 3ASOH 3UR3C 3P5JA 4GYIA 2ZSIB 3EDPA 4LITA 5KK1A 4BJ5C 4RB2C 2M45A 3FKJA 4EEFG 3ZQFA 5FLVA 3BZ6A 1MBEA 3HDDA 4E7SA 1CF7A 1G3SA 1OISA 1V5GA 5J1RA 3WTYC 4D7NA 4H4KC 5IP6A 1KA8A 5FD6A 4OMZA 1CF7B 3M3YJ 5HLTA 4RGXA 2G7UA 4E7KA 3ROUA 1QBJA 1T0FA 5ILVA 1Q1HA 3W6VA 3H3VK 5CVUA 1G8XA 1OJLA 1QVUA 3M8FA 1MH4A 3RDIA 1MDMA 4EGYA 1JT6A 2GA2A 2LBFA 5J40A 2VPLA 2L02A 2XIGA 5E8IA 3F22A 4XONA 1MDMB 3PO3J 3MKLA 3BCAA 1H0MA 2R7TA 3LL7A 2LBFB 4OAYA 4A3MJ 2LKXA 4B48A 1ZG3A 2HDCA 5ED4A 1T95A 3SYTA 1XMAA 1BJAA 1U2WA 2OV7A 2NOGA 3I59B 3WE2A 4YRVA 5J8CA 1QNTA 1B72A 3BPVA 1MZBA 4J00A 3ZCOA 1OCRH 3WTXC 3DBLB 2RREA 2EZIA 3LWFA 1YX3A 3FXOA 4DNCA 1YX5A 1B72B 1OYIA 4UVCA 4Y4RA 1KONA 1YHQI 1UHWA 4RLQA 2MG4A 1QZYA 4A12A 1A6IA 1SVLA 5FB2A 3MKWB 1GVDA 2YU3A 3ZOBA 1EH6A 2EWNA 4MHGA 5LBQA 4V2GA 2UZKA 1PP7U 3CDLA 3BG3A 3KCCA 3ELKA 4AD9A 1SMYF 2E1MB 2I5UA 1MBJA 3JRBA 1D3YA 1SD7A 3WU0A 2E7WA 1WJ5A 2BY0A 1W5TA 4GYGA 4BJ6C 3CCEI 4M3GA 2M34A 2MA3A 4WXDA 2QEXI 1D5YA 5EF6A 4CXFA 1MJBA 1POGA 4L0ZB 1YG2A 2Z33A 1OR7A 2KRCA 3OYBA 1QA6A 3HKZN 3L09A 2BHYA 3E97A 5LGTA 4XN0A 2VLAA 5HS7A 3DWLE 3HTUA 2XAQA 1WH5A 4OIPF 1WCMJ 4ZZLA 5F27A 5ILSA 4LB5A 1EKEA 3OOUA 2KPMA 4PUSA 1D0ZA 3CP2A 4IHVA 1TW2A 4NC6A 4CHUA 4NQWB 1BC8C 2Y2ZA 2YSRA 3P9IA 3QU6A 5FKKA 5EEGA 2YU9J 1OLTA 1J59A 3HBLA 4OIOF 1JTYA 1KZHA 5D8LB
chains in the Genus database with same CATH topology
2DT6A 4HPQA 2XDVA 3H9QA 1MMSA 2F4IA 2HU9A 4KT6A 4OAZA 3CJQB 2ZSHB 2LREA 4BXFA 3OYAA 4NC8A 4P1WA 3CF5F 4CCNA 2KMUA 2LOOA 3M1CA 1D1CA 2M7AA 4XKVA 4GRIA 4PJJA 3L2VA 2NXNB 2H8WA 3C2HA 3PSIA 4XKBA 4HEA2 3CJTB 1EA3A 2O5RA 3H35A 4F3QA 3TBIA 3LFUA 4XQFA 2X6WA 1D1AA 3H0DA 2HQAA 2LRDA 2M4GA 3F9KA 3OIPA 3LSIA 1NG7A 2L9NA 2RNGA 4YEJA 4XKWA 2A6TA 3J7YJ 4U87A 3VYUB 4BQOA 4D9JA 2X6XA 3PNTA 4PSXA 3OS1A 3S3OA 1FMVA 1IRXA 2DOAA 3OR1C 2E35A 2DT7B 3K4LA 2IS1A 4CH7A 4AVZA 1Y6IA 2CUJA 4HNTA 3ZQQA 4C2UA 1WFXA 5CQEA 3OYGA 2VQGA 1V5FA 2GOMA 4XOPA 2X51A 4HNUA 1PYVA 4IQJA 3D5RC 2IXSA 4CUGA 3CJRB 1QU3A 3KEYA 4IX7A 2UWMA 4UY8I 3DLAA 3PJRA 2XF7A 1J09A 1WJCA 2MC4A 5HVQC 2BW3A 1QHGA 3HPHA 2VQLA 2BOLA 2QKLB 2BW3B 3DEEA 4NNJA 3LSKA 4XLEA 1BR4A 4RLFA 1AA7A 3TMOA 3OY9A 4DOZA 3K70D 2KZVA 4HRIA 3K6GA 2PJRA 2Z1DA 3OYFA 1UELB 2CV0A 4XL9A 3FBNB 3D5LA 3ZR8X 3FBIB 4ZC3A 2PJRB 1DGRM 4BJTA 3AL0C 3K4NA 3S93A 3A4CA 2Q2EB 2V4JC 5CKTA 2AQFA 4XLFA 3HG9A 2E1MC 1Z3XA 3E0JB 4CSWA 5CPRB 3VWBA 2R7SA 2HVSA 4PFPA 4PK4A 3RPUD 2E36A 2CV1A 2V1NA 4V19K 3U21A 3OWTA 2A5WA 4EATA 4BE1A 1NG6A 3N05A 2RQQA 2E34A 3A2KA 1WJDA 2Z2SB 4MLOA 4B44A 1WJAA 1X1DA 3K4MA 2JVGA 3EUHC 2VB6A 4DJAA 3DPLC 4E7ZA 1W36D 3QODA 1X4OA 3K70C 3IAM2 2W1OA 1TZLA 3VSKA 3DKYA 4BE0A 2W7NA 3QOEA 4II2A 4B47A 2KL4A 2X1EA 3I3LA 4BDZA 3RCOA 3OYDA 3KYLA 2LH9A 3OYHA 2ZXHA 5FRMA 2AQEA 2L5QA 2XF6A 2IGMA 2K3FA 3PSFA 2X85A 3H9GA 4LIUA 5DM6F 3HKZA 2HPIA 4BEHA 4FETA 3MD2A 1GLNA 3E1SA 3CZ6A 4ZDLA 3VYRB 2CW7A 2K9LA 3DU6A 3PNYA 3HOTA 1VZ0A 1N77A 2VJ5A 1D1BA 1Y56A 2CMPA 2V9KA 3K4BA 3MKZA 1K6YA 4LIVA 3UNGC 4BU2A 3HC7A 3HOSA 3D5SC 2VJIA 1SFKA 2E5ZA 3OYIA 4BQQA 1JI8A 3EGVB 2VIXA 3CJSB 4KITB 3BG7A 3NWTA 2ELJA 3BC8A 1LVKA 3MMYB 2P0WA 5HNHA 1UAAA 4ANJA 1Z3YA 3BG6A 3CP8A 1MMDA 5LFAA 3HPGA 2DJIA 2UUZA 3OIQA 4ZTFA 2L2OA 4J01A 4XLCA 2WAFA 3MKYB 3EPZA 2VXZA 1E0EA 3H5NA 2CFOA 2KP6A 4U7BA 2W4SA 3DPTA 1P9QC 1G59A 1ZELA 4P5OA 3SEQA 1T0FC 5JHFA 2HVQA 4C30A 2X6YA 1U0JA 3OYMA 2R7OA 3KX2A 3S3MA 4NUBA 4E4HA 2Y0SA 3K10A 2HZDA 2WY7Q 4PJNA 3L2QA 3V42A 2MFZA 3BLYA 2R7WA 1WJBA 3S8PA 5TGTA 2L7KA 4ITVA 3L2UA 4PFOA 3VSLA 4AU7A 4XLAA 2L9SA 2E60A 2XC7A 1DGWY 4PJMA 3OS2A 4QPOA 2MABA 4F55A 3OS0A 2WY8Q 4ZDPA 3RTRA 2R7UA 1X19A 3H5AA 3W2VA 4BACA 3L2RA 4ZTJA 4HG2A 4XOTA 2R7RA 4E7LA 2KDOA 3DTEA 3GBGA 2WBMA 3K4JA 3OYKA 2M7BA 2XSJC 2HVRA 1WJFA 4N4OB 5GAHJ 4CCKA 4QPQA 3J7ZI 2IGOA 4XLHA 5KHDA 3DTKA 3HXLA 2LG4A 2R7QA 2M4KA 4ZJZA 3PNVA 4F52A 4IZZA 1X4PA 2PMZA 4XORA 4YELA 2FUG2 3OYNA 2VKHA 4RMNA 4F92B 3AL0B 3BCBA 4C2TA 4BUPA 3HUGB 4RM2A 2LY1A 1BR1A 4XNFA 4OWRB 2LC2A 3EUAA 2LYCA 4ZYAA 4R79A 1BOBA 2KRHA 2JA2A 2ZJQF 2F6CA 2XF5A 3W2WA 3DQVC 2MD0A 4KISA 4BL0B 2IGKA 4XMYA 3PUBA 1D0XA 2BVMA 2DCEA 2VQHA 2WADA 4XN3A 4Y3OA 3FDYA 4XM3A 2IGNA 2R7XA 1OR7C 4HSTA 3SEZA 3I9V2 3H9JA 1DP3A 1R6RA 4CCMA 4C9YA 1YE9A 1N78A 3DU5A 2K3PA 2VJ4A 4XKCA 5HOOA 2K9MA 2JVHA 1V5EA 5GADJ 2KLOA 3ZXSA 2XAUA 3CF2A 1LDKB 4AYBA 2HDWA 3TL4X 2VASA 3QYBA 2LY2A 3A1YA 3VYSB 3W2AA 2WA0A 5DM7F 1D0YA 1Z7LA 2WB1A 4BEHB 1N75A 2CUZA 3IUOA 3OL4A 1MMGA 3QYEA 3C2GA 4CCJA 2NOJB 3SDBA 3VYTB 2JSPA 2ZJPF 2R7VA 5KCMA 3NWSA 4N4NB 1TT0A 2W82A 1W36C 3S32A 3UR3C 2V26A 2MYSA 2ZSIB 4LITA 4BJ5C 2VKDA 2UV1A 1PJRA 3OL3A 3FKJA 3G2BA 4F91B 4E7SA 1X1CA 1FMWA 3K4CA 1V5GA 4H4KC 2VL8A 4KJZA 2DXIA 2R4GA 3DTIA 4D1QA 2F5VA 5HLTA 3OYEA 1LFPA 5FRNA 5LD2C 4E7KA 3SZGA 4IKFA 1MMNA 3CESA 3OYLA 1HA8A 4Y33A 4DGWB 3VDXA 4HSRA 2E5NA 2IS4A 3PL8A 2BVLA 1G8XA 2GOXB 2OUMA 2VXDA 2JUGA 3RQ4A 3ZRGA 2LBFA 3AFHA 2VPLA 2V6EA 2QKMB 2M0MA 2X1CA 4XONA 2HNHA 2CV2A 3OYJA 3BCAA 2R7TA 3S3NA 3LL7A 3ZGKA 3OYCA 3OR2C 2LBFB 4OAYA 1X1BA 4B48A 3J7AY 4CCLA 3DKXA 4E7JA 4CCOA 1T95A 3FHNA 1MNDA 3SYTA 5FROA 2ZFUA 4E7HA 2HPMA 2CW8A 1WJEA 2OV7A 1MNEA 3LSGA 2V7FA 1LKXA 4CA0A 1WIBA 4YRVA 2JQ7A 3OMYA 4J00A 3ZCOA 4DBQA 3PFYA 2Z16A 1S9HA 2RREA 1YX3A 2K5CA 4F93B 3LSHA 1YX5A 3DPUA 2WAQA 1Z21A 4BE2A 4Y4RA 4E6KG 4ZDOA 1KONA 2VJJA 4RLQA 4LG3A 2I8DA 3MKWB 2KQRA 4CZCA 3LSMA 4NC7A 2W00A 3K4KA 3CMMA 5CQGA 4BS9A 2X1DA 4XR6A 2E1MB 3HL2A 1MMAA 4BGDA 1WJ5A 4FASD 4IQ4A 3ONQA 1QHHD 4G6TB 4BJ6C 2Q1ZB 3RSNA 4BDYA 4JOMA 4PJLA 2WAEA 3EUKL 1SAUA 2CS3A 2KRCA 3OYBA 4B43A 4X0GA 2IS6A 5GAGJ 2OC6A 2VQCA 4PSWA 3IP4B 4XN0A 2VLAA 3DWLE 2IS2A 1ERDA 1BR2A 5KNLA 4B3XA 1X1AA 3IAS2 2ZXIA 3H5RA 4DIQA 1UG0A 3W3CA 4DBRA 4BQNA 3OOUA 2KPMA 4PUSA 3QYFA 4RM3A 3L2WA 1D0ZA 3CP2A 3AKZA 4E7IA 3LMMA 2KHMA 4NQWB 4JQFA 1DQUA 2CH0A 2M3AA 3M8JA 5HNFA 1OLTA 4II3A 1MW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WIB A;  5GAH J;  2JQ7 A;  5DM6 F;  2E34 A;  1MMS A;  2ZJQ F;  3CJR B;  3CJQ B;  3J7Z I;  3J7Y J;  5DM7 F;  4UY8 I;  3CF5 F;  3EGV B;  2NXN B;  2H8W A;  2E35 A;  3CJS B;  2E36 A;  3CJT B;  2ZJP F;  4V19 K;  5GAG J;  5GAD J;  2K3F A; 
#chains in the Genus database with same CATH topology
 1Z67 A;  5FO5 A;  1XSD A;  1T6S A;  1XPX A;  1BW5 A;  2VPR A;  2XRL A;  1U3E M;  3E6D A;  4OAZ A;  3E6B A;  3CJQ B;  4XK4 A;  2LRE A;  2EPF A;  2ZJR F;  1FIA A;  2L7Z A;  1Y1W J;  1ZQ3 P;  2EK5 A;  2KMU A;  2LOO A;  2HGC A;  1UJ8 A;  3HGY A;  3MFK A;  1YQA A;  2M7A A;  2BXZ A;  3CD6 I;  2PG4 A;  2ETH A;  2O3F A;  2Y0S N;  1RC9 A;  1RRJ A;  2A5Y B;  2ZXW H;  4HEA 2;  3VOD A;  5DS9 A;  1NH3 A;  1LQ1 A;  2K02 A;  1O3S A;  3LFU A;  3PO2 J;  2ME0 A;  3H0D A;  2HZT A;  1HSJ A;  4C3H J;  2LRD A;  2LKP A;  2L9N A;  4B8X A;  2RNG A;  1ETW A;  4YEJ A;  2KIU A;  4XKW A;  2A6T A;  4MTE A;  1VQM I;  4IHW A;  1Y1V J;  2TCT A;  1G3W A;  3KYD B;  1ONV A;  3OS1 A;  3S3O A;  1I5Z A;  1FMV A;  3CUO A;  2OBP A;  4WK8 F;  3K4L A;  1TWC J;  3CDI A;  2CUJ A;  3BR2 A;  1RUN A;  2MBF A;  5CVJ A;  3OYG A;  4IOC F;  2J5O A;  1BM9 A;  4L9T A;  3RKX A;  2GOM A;  2V79 A;  5E18 F;  3IC7 A;  1PYV A;  1QPI A;  1B6A A;  4IQJ A;  4A0Y A;  4DQ2 A;  1AKH A;  1SEU A;  3DEU A;  2I10 A;  3CJR B;  1QU3 A;  3FKI J;  2WC2 A;  3IWF A;  1AKH B;  2NS7 A;  3CLO A;  2XF7 A;  2Y9Y A;  1SMT A;  2BW3 A;  5GPC A;  2QKL B;  5F0H A;  1HCR A;  1USS A;  2BW3 B;  4NNJ A;  5CJ9 A;  3LSK A;  4HOB A;  2F5E A;  1YJW I;  1AA7 A;  4S04 A;  1AOY A;  4DOZ A;  2JRM A;  3ABL H;  3V7C A;  5JHU A;  5BPD A;  3PFI A;  2Z1D A;  4I0B A;  3OYF A;  4UNO A;  1UEL B;  2CV0 A;  3FBN B;  3FXL A;  1P4X A;  3FBI B;  2ESH A;  1HW2 A;  3CCQ I;  1STZ A;  4C3J J;  1Y8Q B;  5IT9 Z;  3S93 A;  2Q2E B;  2X6O A;  3IHU A;  4A2U A;  3WE3 A;  2XV4 S;  2W85 A;  3M1E A;  3HG9 A;  4XSZ F;  3E0J B;  4CSW A;  5ICG A;  3JR9 A;  4MO7 A;  2W48 A;  2E36 A;  3MZY A;  2EFO A;  3TO9 A;  3OV8 A;  3ABK H;  2R7Z J;  3PUF A;  3OWT A;  4UUV A;  2A5W A;  5HDN A;  1A36 A;  6PAX A;  4M3B A;  4QSH A;  2D5V A;  3BT9 A;  3A2K A;  2GXA A;  4HW0 A;  5FKL A;  5B5E C;  3U1D A;  2H94 A;  5F1J A;  2KIQ A;  1FP2 A;  1X1D A;  2K27 A;  3S15 J;  5IPA A;  4XRS G;  3EUH C;  1OCT C;  4U88 A;  4DJA A;  3DPL C;  4E7Z A;  4DW6 A;  3G6E I;  1YI2 I;  1X4O A;  1RUO A;  3I54 A;  4P55 A;  1Y8R B;  2AXT C;  4IXA A;  2W25 A;  3LSJ A;  4PGG A;  4BQA A;  3S1N J;  2LFB A;  4BDZ A;  2CQX A;  2VC0 A;  3H3Z A;  3OYD A;  2EA4 A;  4LK0 F;  4X1E A;  2LH9 A;  3SDG A;  5K7F A;  2ZXH A;  3OYH A;  1ZH5 A;  2IGM A;  4KN7 X;  2CYY A;  3PSF A;  2X85 A;  4JP0 A;  1JE8 A;  3I0T A;  5K5R A;  2HPI A;  3B73 A;  3CZ6 A;  1ZK8 A;  2CW7 A;  1JKO C;  3T5X A;  1VQL I;  1JUS A;  3A02 A;  3KFW X;  1VZ0 A;  4BXU A;  1BI2 A;  1N77 A;  2V9K A;  2GM4 A;  1K6Y A;  1XCV A;  4L9J A;  4LIV A;  4BU2 A;  1U5T C;  1IRG A;  3OYI A;  2E5Z A;  4NBQ A;  2O61 A;  3EGV B;  1QPM A;  3WOD F;  3BG7 A;  2L7F P;  2O03 A;  3I4P A;  3NWT A;  5E1Z B;  1LVK A;  2BZT A;  2Y31 A;  4ANJ A;  3BG6 A;  3CP8 A;  2P6S A;  1ZGA A;  2QQB A;  2QF7 A;  3HPG A;  4YIF A;  1F5T A;  1SD4 A;  2XPV A;  2FXA A;  2UUZ A;  5HLI A;  4IO9 F;  4J01 A;  2WAF A;  3MKY B;  1VQ8 I;  3BWG A;  1NK3 P;  1YW7 A;  1IUF A;  2STT A;  1CGP A;  1JTX A;  3H5N A;  1R22 A;  1HW1 A;  2KP6 A;  4U7B A;  2E2J J;  2W4S A;  1TL8 A;  1F9N A;  2LF8 A;  5M3F J;  4P5O A;  5JHF A;  3GWZ A;  4AIJ A;  1X2M A;  1RPW A;  5TIS C;  1SFO J;  4HA8 A;  2LK2 A;  1X1P A;  5J1Y A;  3KX2 A;  1YTY A;  2JSC A;  4E4H A;  4RAY A;  4LGW A;  3L2C A;  2EFQ A;  2PLY A;  5HLG A;  1FLI A;  1IO2 A;  1Z91 A;  2MFZ A;  5E3L A;  3CME I;  1T38 A;  2QQ8 A;  3S8P A;  5TGT A;  1LJ9 A;  2FEZ A;  2WAQ N;  4A6D A;  2QQA A;  4PFO A;  3L2U A;  5J8F A;  4KDP A;  1O3R A;  2OQR A;  3RZD J;  1HKS A;  2QGU A;  2F5D A;  3OS2 A;  2OZU A;  3E5Q A;  3A0B C;  5FGM A;  4O3M A;  2JA7 J;  2Z5U A;  2HR3 A;  3LSP A;  2R7U A;  2QEN A;  3M4O J;  1X19 A;  3V8L A;  4A3L J;  1IGN A;  1OKR A;  4MQV A;  5FKN A;  1W0U A;  1B9M A;  1VQN I;  4XOT A;  4E7L A;  2KDO A;  2YR2 A;  3F0C A;  2DYS H;  2F2E A;  2LP0 A;  2WBM A;  3GTO J;  3FK7 A;  4UVA A;  1VI0 A;  4I76 A;  3CC2 I;  3GTK J;  3CMY A;  1P6R A;  2EQR A;  3Q9V A;  4EJU A;  5A2Q K;  2L54 A;  4G94 A;  2OJE D;  1IV8 A;  2OZ6 A;  4IRI A;  4HYE A;  3FXU A;  3HXL A;  2M4K A;  3IL2 A;  3REO A;  1O4X A;  3V7S A;  4UUT A;  2CFX A;  3FMS A;  3R60 A;  1X3U A;  4ESB A;  2NRA C;  4BAY A;  2A61 A;  2RC4 A;  4C2T A;  4ZYG A;  1HKT A;  1KU3 A;  3P7N A;  3HOW J;  2KIS A;  5DV5 A;  4RM2 A;  4IJA A;  4FE7 A;  4IVN A;  3HSE A;  5B1B H;  3HOU J;  4OWR B;  2DDB A;  1IV6 A;  4LB6 B;  1D5V A;  2FBH A;  2COM A;  3FX3 A;  2XF5 A;  3JRA A;  1OPC A;  1JKQ C;  2EA2 A;  2BVM A;  2VQH A;  2DMP A;  4Y3O A;  3FDY A;  5FKM A;  1I1G A;  4XM3 A;  4Y52 J;  3CUQ C;  3SEZ A;  3I9V 2;  1DP3 A;  1XC5 A;  3J80 Z;  3EUH A;  1IJW C;  1R6R A;  2H6B A;  1FIP A;  1I39 A;  3DU5 A;  1UHM A;  3GTP J;  3CCR I;  2JVH A;  2GIV A;  2KLO A;  4L0Y B;  4AID A;  2XAU A;  3EQL F;  3A01 A;  3TL4 X;  1EF4 A;  3FXJ A;  2VAS A;  5EEH A;  4AIH A;  2KT0 A;  4RB0 A;  5K7H A;  2LY2 A;  2CQK A;  1LEA A;  1MGT A;  3S14 J;  5DM7 F;  1W0T A;  1ZTR A;  2WB1 A;  4HV6 A;  4YIR X;  3RPU A;  4BEH B;  2IT0 A;  2CUZ A;  4U7D A;  4ENM A;  5C3E J;  4M9X A;  2DLL A;  1EH7 A;  2ISY A;  3G4S I;  2OCC H;  4I2O A;  4W1U A;  2NVU B;  3LQQ A;  5D8K B;  2M5W A;  1JJ6 C;  4RA2 A;  4HF2 A;  2ZJP F;  1U5T A;  2EIJ H;  4N4N B;  2R7V A;  1TT0 A;  1W36 C;  1VFC A;  3S32 A;  1F4K A;  2MYS A;  3T0Y A;  2VKD A;  1U5T B;  2UV1 A;  1U8B A;  2Y9Z A;  1L3L A;  3KIO A;  5GTI C;  1XX5 A;  4LOC A;  1FOK A;  3F8N A;  4ETS A;  4R8H A;  2LR8 A;  2R4G A;  2F5V A;  1FZP B;  2R5Z A;  1ZR4 A;  3T8T A;  3OYE A;  1LFP A;  1W7P A;  5FRN A;  2IEK A;  2EIK H;  3SZG A;  4IKF A;  1MMN A;  1RET A;  2FJ1 A;  3CES A;  4RAG A;  2Y48 A;  3JRH A;  2R5Z B;  1XTA A;  4IEJ A;  4DGW B;  2VT3 A;  4HSR A;  3JTH A;  3AG1 H;  4TV7 A;  2B0L A;  2GOX B;  2OUM A;  1J2X A;  1XN7 A;  2CG4 A;  2F4M B;  3ISP A;  3E5X A;  3RQ4 A;  5LGN A;  3AFH A;  1R23 A;  2QVO A;  4YFK F;  2X1C A;  1RI7 A;  2JTV A;  4I0A A;  3OYJ A;  2EIN H;  2VON A;  3JRE A;  3ZGK A;  3OYC A;  3S3N A;  1S6L A;  3K0L A;  4KUM A;  1X1B A;  2ELK A;  2XKP A;  2L01 A;  1K61 A;  3DBH B;  2EH3 A;  2BGC A;  4CCL A;  3DKX A;  4CCO A;  3FHN A;  5FRO A;  4NHJ A;  1OCZ H;  2ZFU A;  4E7H A;  2L9V A;  1WJE A;  1JUM A;  5KVR A;  1GT0 C;  1ZRF A;  3LSG A;  1DDN A;  2V7F A;  1LKX A;  2H09 A;  4UUS B;  3BTL A;  2NAZ A;  2JQ7 A;  3HOV J;  2QWW A;  1S9H A;  5K5O A;  3CTA A;  4RAF A;  3S17 J;  2Y75 A;  3L7W A;  3WG9 A;  2HXO A;  1ZAR A;  3K1M A;  4IL6 C;  2M8G X;  1Z21 A;  4GXO A;  4E6K G;  4BY1 J;  4YG2 F;  2VJJ A;  1ZKG A;  3VFZ A;  2I8D A;  1ORK A;  1MBK A;  1Y39 A;  1TNT A;  4MFD A;  4CZC A;  1DPU A;  1IXS B;  2P6T A;  3GZ6 A;  1E3P A;  4EM2 A;  4LK1 F;  1O3T A;  2W57 A;  1GV2 A;  4KA4 A;  3CMM A;  2ELH A;  5CQG A;  1MMA A;  3F8C A;  3RKQ A;  4H0E A;  1X2N A;  1WQ2 A;  1V3F A;  4YII A;  4UV9 A;  1YJN I;  1PDN C;  1LB2 A;  1B9N A;  2COB A;  1FYM A;  4BDY A;  2P5L C;  4JOM A;  4AYB N;  2O6G E;  4D5C A;  2WAE A;  3CUQ A;  2CS3 A;  1YIT I;  4X0G A;  2WV0 A;  3TQN A;  2UXN A;  2VQC A;  1JKP C;  4PSW A;  5E1W A;  1W1W E;  3CUQ B;  3FXK A;  2VOD A;  2IS2 A;  3EYY A;  1GHC A;  5KNL A;  3BR6 A;  2HOT A;  1FY7 A;  2ZXI A;  4B4C A;  4DIQ A;  2DYR H;  4BY7 J;  3CO7 C;  1BIA A;  3SZT A;  1P7I A;  1REP C;  3KP3 A;  3PIP F;  4BQN A;  3ULQ B;  1S7O A;  1V55 H;  3JRD A;  4IHS A;  3B6C A;  1IXR C;  3I71 A;  2KHM A;  1DQU A;  2VBZ A;  2K86 A;  5J4Y A;  1V54 H;  3LQR A;  2DQL A;  2DT6 A;  2XB5 A;  1IDZ A;  2KJB A;  5CVI A;  5EGO B;  5JR3 A;  4G7Z F;  4DZP A;  2XAS A;  1MMS A;  4IPA A;  2PI0 A;  2F4I A;  4KT6 A;  1ENH A;  2HS5 A;  1XCB A;  3HM5 A;  4BXF A;  1FP1 D;  1R5I D;  3QPL A;  2GXG A;  3RYP A;  1R1T A;  3M1C A;  4LLL A;  2EB7 A;  1D1C A;  3LSR A;  4LD5 A;  4XKV A;  2OTJ I;  4PJJ A;  3RKY A;  3V7R A;  3C2H A;  2IA0 A;  2AO9 A;  1KQ0 A;  2Q8K A;  3WGG A;  3H35 A;  3F6V A;  1KQ8 A;  4XQF A;  2OU2 A;  1KYZ A;  3BTI A;  4L9N A;  2P81 A;  2M4G A;  1KQ9 A;  3MAJ A;  2HTJ A;  3I4M J;  4G7O F;  4N9H A;  4U87 A;  4A0Z A;  4D9J A;  1N25 A;  3PNT A;  4HF0 A;  5GP9 A;  1FBQ A;  2F5C A;  4MIM A;  4X6A J;  2VKE A;  4JX4 A;  1IRX A;  2DOA A;  2TDX A;  3OR1 C;  2CUF A;  2E35 A;  4HAM A;  4ZZD A;  2IS1 A;  3PM1 A;  4BHB A;  4CH7 A;  4JX6 A;  3ZQQ A;  4C2U A;  4UHT A;  4BHC A;  2RKH A;  2VQG A;  3KP2 A;  2JA8 J;  1V5F A;  2KIM A;  3S2D J;  2CQ7 A;  2IXS A;  2B7E A;  3F23 A;  2XAG A;  4HX8 A;  1GUU A;  2EZL A;  3KEY A;  4IX7 A;  2UWM A;  3KET A;  1ZGJ A;  1S29 A;  1J09 A;  5CYV A;  2MC4 A;  2JPB A;  3O8H A;  5F0C A;  5HVQ C;  4ENJ A;  3WHB A;  2VQL A;  2BOL A;  3FMR A;  2NVQ J;  2XVC A;  4WXH A;  3BRO A;  4YFN F;  2BY2 A;  5TRD A;  3DEE A;  1NTC A;  3NRV A;  4M6X A;  3A03 A;  4RLF A;  3TMO A;  1YW9 A;  2DK8 A;  2EZH A;  5F64 A;  5DEQ A;  4ON0 A;  3SZP A;  3S16 J;  1QO0 D;  5GTH C;  2F4O B;  3ERM A;  5ERI A;  2PJR A;  3DCF A;  2GBY A;  1Z7U A;  2ZXJ A;  2EV5 A;  1SAN A;  1FWZ A;  2K40 A;  1S5L C;  2Y69 H;  3LA7 A;  4A3J J;  4G6Q A;  3QOP A;  2PJR B;  3TDZ C;  1DGR M;  5IYB J;  2V4J C;  3ZQC A;  3VEP A;  2EJR A;  4A3K J;  1XMX A;  2FBK A;  2LY9 A;  4FIS A;  4UVB A;  2H1K A;  1I27 A;  1Z3X A;  2MLK A;  3DXJ F;  3GFJ A;  4O5V A;  1Z77 A;  4PFP A;  2FF4 A;  2ZKZ A;  3CCS I;  1BIB A;  2E7X A;  2CV1 A;  4L18 B;  4V19 K;  3W6K B;  2HWV A;  3ZMD A;  3CCU I;  1XGN A;  1E17 A;  1ZRD A;  3I5U A;  4G7H F;  5DDG A;  4CYC A;  2E34 A;  2PMU A;  1FC3 A;  2J5P A;  4I99 C;  4M3F A;  4MLO A;  2EV0 A;  4CIC A;  4PJ0 C;  2NNY A;  4CYC B;  2JVG A;  3HJE A;  2DJN A;  4A3G J;  1W36 D;  3K70 C;  5CLS A;  3IAM 2;  2M0C A;  1GVJ A;  1UG2 A;  2W1O A;  1TQP A;  4ZH4 F;  2NVY J;  2QQ9 A;  1TZL A;  3AG3 H;  3DKY A;  3BZK A;  4P96 A;  2L3D A;  2XHK A;  1P2F A;  5L3B A;  3FXR A;  3TKY A;  1YS6 A;  3TDU C;  1XSX A;  5HDG A;  2L5Q A;  1FEX A;  4BKX A;  2HYJ A;  3BTC A;  3H9G A;  4CO8 A;  5FJ8 J;  4LIU A;  4OU0 A;  3HKZ A;  2R93 J;  3BJ6 A;  2FX0 A;  1ZHF A;  1GLN A;  2C6Y A;  1FOY A;  1X3W B;  4ZYD A;  3RIR A;  3CCL I;  2BE5 F;  1HW5 A;  3DU6 A;  2R0Q C;  3CO6 C;  3C18 A;  3NQO A;  1FBS A;  3HOT A;  2QM3 A;  1BI1 A;  1ITY A;  1QZZ A;  1U9O A;  2CMP A;  2FE3 A;  3MKZ A;  3UNG C;  1IN5 A;  1H88 C;  3HC7 A;  3D5S C;  2RNJ A;  2VJI A;  3CJS B;  3SHF A;  2IA1 A;  2Q0O A;  4RB1 A;  4JYK A;  3M07 A;  3BC8 A;  4ABZ A;  5BQT A;  3SFI A;  3ZMU A;  3JTG A;  1X3Z B;  5HNH A;  5H6Q A;  1ETQ A;  3LNQ A;  2MSY A;  3RJP A;  4I01 A;  4CDG A;  4XRF A;  4EM1 A;  2R5Y A;  3O2P E;  1UMQ A;  2PEX A;  4ZTF A;  3OIQ A;  3FF5 A;  4D0P A;  4S0H B;  1FT9 A;  2PBI A;  3GXO A;  2WWY A;  1GXP A;  1OCP A;  4MEY F;  3CCJ I;  3IH2 A;  1FOX A;  3QQA A;  2PFB A;  1G59 A;  3DFG A;  2FRH A;  4PDK A;  2RV8 A;  2X6Y A;  1U0J A;  2YS9 A;  5K1Y A;  1RNL A;  3JW4 A;  2JA5 J;  4NUB A;  1R1U A;  2Y0S A;  1MH3 A;  3JRC A;  4HQM A;  4MFE A;  2FD5 A;  3BLY A;  2HKO A;  2VBY A;  3GTJ J;  2L7K A;  5F08 A;  2ID6 A;  4AU7 A;  2ZBK A;  2DMN A;  3ECH A;  2N8G A;  4BHP A;  1DGW Y;  2A05 A;  4QPO A;  2DPD A;  4FT8 A;  2MAB A;  4P9F A;  2LMD A;  2WY8 Q;  4RAZ A;  4F55 A;  3HTS B;  2DW4 A;  1SFE A;  2DA4 A;  3W2V A;  3H5A A;  3L2R A;  2R7R A;  4GDF A;  2DMT A;  2RGV A;  1I1S A;  4M6V A;  5ICC A;  3BOQ A;  1X58 A;  3ZN0 A;  2XSJ C;  5GAH J;  1LE8 A;  4U0V A;  3CLQ A;  2HFH A;  2Y0M A;  4DYQ A;  5J4V A;  3J7Z I;  3IWZ A;  5FLX Z;  1LE8 B;  1J5Y A;  2WV1 A;  5KHD A;  1B8I A;  2LG4 A;  4JBA A;  4C2M J;  1X4P A;  4XOR A;  1V4R A;  4UB8 C;  4HZF A;  5E3O A;  1B8I B;  2DFH A;  2FUG 2;  4O6J A;  3JAM K;  4UB6 C;  3WGH A;  3BCB A;  3T1B A;  2YUS A;  1E3H A;  2OCE A;  5EG0 A;  5EDN A;  4R79 A;  2LYC A;  4ZYA A;  1VQP I;  1BOB A;  2PX9 A;  2KRH A;  3F72 A;  2ZJQ F;  1U9N A;  1QVT A;  3H36 A;  5JI6 A;  3QPT A;  4UXN A;  1WWX A;  3GEZ A;  5LGU A;  4V2F A;  2WAD A;  4ZYE A;  3T8R A;  3AG2 H;  1ETO A;  2R7X A;  2JJ7 A;  2K9N A;  1QRY A;  2LD5 A;  3LAP A;  3KP6 A;  1YE9 A;  4HDU A;  2K3P A;  2VJ4 A;  4XKC A;  5HOO A;  2K9M A;  1R49 A;  4GFB A;  1U8R A;  5GAD J;  3ZXS A;  1QGP A;  5ILU A;  3Q0V A;  1VF9 A;  3WU1 B;  4Z6Y A;  1BL0 A;  5C4X J;  1UFM A;  3BDD A;  3MCZ A;  1RKW A;  3ERE D;  1OYW A;  2ESN A;  4G8X A;  4A0X A;  3MN2 A;  1FNN A;  3RZO J;  2VUM J;  3A1Y A;  5LHI A;  4OOI A;  3V8K A;  3S2H J;  1D0Y A;  2ZCW A;  2Z99 A;  1WHU A;  2K4B A;  5JFR A;  5E8G A;  3OL4 A;  2FML A;  2RQP A;  4CCJ A;  4A3C J;  3SDB A;  2GAU A;  2JSP A;  3BG5 A;  5KCM A;  3KLN A;  3JSP A;  1MD0 A;  4EVI A;  2GIZ A;  2V26 A;  4KIB A;  5HDK A;  1KU7 A;  4Y13 A;  1PJR A;  3OL3 A;  2MGQ A;  3EET A;  3G2B A;  2W24 A;  2XGE A;  4KT5 C;  3ECO A;  1X1C A;  1FMW A;  4Y7N J;  5F6F A;  4NDL A;  1MBG A;  4PZJ A;  2VL8 A;  4KJZ A;  2DXI A;  1FX7 A;  4D1Q A;  2Z9O A;  3FMQ A;  1F1Z A;  2LF7 A;  1ZRE A;  5J47 A;  3OYL A;  2XUB A;  3QP6 A;  1HA8 A;  1XMK A;  4Y33 A;  2V9P A;  4IHY A;  3VDX A;  2E5N A;  2X9D A;  3PL8 A;  2BVL A;  2JN6 A;  1FJL A;  2CJJ A;  1YYV A;  1OCO H;  3TW6 A;  3ZRG A;  4ENK A;  2LTP A;  4HV5 A;  2IVM A;  5E3M A;  1ETY A;  2ZNZ A;  2HNH A;  2CV2 A;  4R1H A;  4F7Z A;  2X0L A;  2HQN A;  1K4T A;  1XB4 A;  5D5V B;  3J7A Y;  4A69 C;  2QA4 I;  3N97 A;  1CQT A;  4E7J A;  3TED A;  1MND A;  2G9W A;  5LLQ A;  2HPM A;  3HOY J;  1A6Q A;  2CW8 A;  3W6J B;  5F04 A;  2RAE A;  3KLO A;  3GTG J;  1D8J A;  3Q0U A;  4CA0 A;  2BYV E;  2XAF A;  3FK6 A;  4A5M A;  1ZG5 A;  4FX4 A;  3OMY A;  1IAW A;  4DBQ A;  4ENN A;  3GVA A;  5IYC J;  2NS0 A;  2V9V A;  4FTH A;  4ASN A;  4F93 B;  1MBH A;  1HDD C;  3CMA I;  1T2K A;  3DPU A;  4BXX J;  2WAQ A;  4BE2 A;  4ZDO A;  1G3Y A;  1WRJ A;  2FNP A;  1SFX A;  2DA3 A;  2PQ8 A;  1DPR A;  3HEF A;  4FHT A;  2QSG X;  2KQR A;  3WTU C;  1APL C;  3LSM A;  3VOE A;  4NC7 A;  1WGX A;  2W00 A;  3QP5 A;  3K4K A;  3SJM A;  2ZO4 A;  4BS9 A;  2X1D A;  5LHG A;  4Q47 A;  4EQQ A;  2G0E A;  4FAS D;  2QLZ A;  4IQ4 A;  1IG7 A;  1PP8 F;  1HF0 A;  3R0A A;  1QHH D;  4M6Y A;  1F36 A;  4I6Z A;  2Q1Z B;  1FPQ A;  2M8E A;  3RSN A;  1Q1V A;  1BI0 A;  4KIG A;  1SAU A;  1TBX A;  2NNN A;  4UV8 A;  4D5F A;  4B43 A;  2IS6 A;  2FSW A;  1OYY A;  3TGN A;  3G3Z A;  1YO5 C;  1MJA A;  3U9G A;  4EJO A;  3I64 A;  5LRR A;  5L3G A;  3KE2 A;  1F43 A;  1WI3 A;  3MQ0 A;  2GWR A;  2LNB A;  5J3L A;  4W97 A;  4B3X A;  4EJW A;  3IAS 2;  2K9S A;  4G9Y A;  3A01 B;  2JRT A;  1LDD A;  3W3C A;  3GO5 A;  2A69 F;  3ZQ7 A;  3I53 A;  4AWX B;  5DD4 A;  1H89 C;  2AS5 F;  1I3A A;  3JCU C;  3AKZ A;  3IRQ A;  4E7I A;  3LMM A;  4JQF A;  2CH0 A;  2M3A A;  3M8J A;  5HNF A;  4II3 A;  1MW7 A;  1R5H A;  1TP4 A;  3PIO F;  3RI4 A;  2UXX A;  1JUP A;  1XGM A;  2MLG A;  3K7A J;  4HPQ A;  4MTD A;  4GO1 A;  5M5Y J;  2KFD A;  2ZSH B;  1JJ8 C;  3BR1 A;  2HQ5 A;  3OYA A;  1TT5 B;  3B6A A;  4P1W A;  5F0F A;  3CF5 F;  3HSR A;  4CCN A;  3CJN A;  1G3T A;  1TWH J;  4GRI A;  5J1U A;  3L2V A;  2E2I J;  4CGZ A;  2H8W A;  5BMZ A;  3PSI A;  4XKB A;  4OIR F;  1T08 B;  1VQ5 I;  3LA3 A;  4M9Z A;  1EA3 A;  2DMU A;  2NYX A;  2XAJ A;  3HHH A;  4IRG A;  2DAO A;  4EGZ A;  4L9V A;  1W7P B;  1D1A A;  2DTR A;  4MQ9 F;  2CUE A;  2CSO A;  4AUX A;  2KIF A;  2ECC A;  3BR3 A;  3F9K A;  3OIP A;  3I4N J;  3LSI A;  1YRN A;  2ZME C;  3RYR A;  3J7Y J;  5GAE J;  1Z9C A;  3VYU B;  2X6X A;  5JLW A;  1YRN B;  5FLM J;  4PSX A;  2ISZ A;  4HX7 A;  2DT7 B;  4AVZ A;  3V8J A;  4HNT A;  2JA6 J;  1WFX A;  2VC1 A;  5CQE A;  4RGS A;  3LFK A;  3G73 A;  3S1M J;  2FOW A;  3GCM A;  2X51 A;  4M73 A;  2BXY A;  2L4A A;  3D5R C;  1B59 A;  2L7M P;  5C4J J;  1BOA A;  2F48 A;  4CUG A;  3V4G A;  1Y0N A;  1A04 A;  2PMZ N;  3GTL J;  3F8B A;  3DLA A;  3PJR A;  5F1R A;  4I98 B;  3CDH A;  2GLO A;  2EFP A;  3HOX J;  3VB2 A;  1IC8 A;  1JGS A;  3K1P A;  4WWC A;  2JWT A;  3QRF F;  2K9Q A;  1I50 J;  2LSO A;  1ZN2 A;  4XLE A;  1HQC A;  3G1O A;  2A6E F;  1UST A;  2HOS A;  2E1O A;  1S7A A;  1R58 A;  2KZV A;  3K6G A;  1OCC H;  1JGG A;  1WI9 A;  2DFI A;  4XL9 A;  1XD7 A;  3SFZ A;  3LST A;  3D5L A;  3TP3 A;  5LRS A;  2D1V A;  3TO6 A;  3AL0 C;  3HGG A;  3K4N A;  1LEB A;  3A4C A;  3DV8 A;  5CKT A;  2DBB A;  4PGH A;  2AQF A;  4XLF A;  2E1M C;  1Z1D A;  3S2W A;  5L3F A;  1HLV A;  2R7S A;  1U6G A;  1NHA A;  3RPU D;  1LVA A;  2DDA A;  2LDU A;  3X2Q H;  4GGG A;  3BTJ A;  2VOP A;  3QPH A;  1VQK I;  2WTE A;  3Q3S A;  4EAT A;  4OMY A;  2QBY A;  2HYG D;  2QSF X;  3KZI C;  1LPQ A;  5AIP A;  1I6H J;  1IDY A;  2CWE A;  3ABT A;  3PQK A;  1LFB A;  3IH3 A;  2XRO A;  1WJD A;  4JX5 A;  4LMY A;  3JRF A;  2QBY B;  4A93 J;  3HRM A;  4L5E A;  1R4M B;  3BP8 A;  1R71 A;  2VB6 A;  3MZ8 A;  3QOD A;  1JT0 A;  1XDS A;  3GZN B;  3WGI A;  1LFU P;  4BE0 A;  2W7N A;  3QOE A;  4II2 A;  4B47 A;  2KL4 A;  3WU2 C;  4I02 A;  4KYW A;  5IT9 K;  2O7O A;  3WTW C;  3I3L A;  3RCO A;  3BY6 A;  3KYL A;  5BS6 A;  1TQM A;  5D4R A;  2OTL I;  5K7Z A;  2MH2 A;  1BN5 A;  2K3F A;  2M30 A;  2ZJ2 A;  3CCV I;  1W7P D;  2IJL A;  1YOV B;  3FWE A;  3WTV C;  4FET A;  3MD2 A;  5H2F C;  3E1S A;  4ZDL A;  1IUY A;  1AWC A;  3FXM A;  1KU9 A;  1BI3 A;  1JKR C;  5M5X J;  2CQN A;  2VJ5 A;  2EFN A;  1D1B A;  1Y56 A;  2EV6 A;  3K4B A;  4RB3 C;  1HBX G;  3J7A O;  2ICW G;  3HOS A;  4KMU X;  3J81 Z;  2YX7 A;  1ACI A;  3A0H C;  4M74 A;  3GTQ J;  4BQQ A;  2CGP A;  1ZG1 A;  1IZ1 A;  4KIT B;  3MMY B;  2P0W A;  2AHQ A;  3HSF A;  4P9U A;  1UAA A;  2RDP A;  1Z3Y A;  2H6C A;  3CC7 I;  5LFA A;  3KP4 A;  2K4J A;  2DJI A;  1BJZ A;  3CQZ J;  2L2O A;  1HXD A;  2OD5 A;  3K2Z A;  4DYC A;  1E0E A;  4QLC U;  2CO5 A;  2X48 A;  3DF8 A;  2ZME A;  1HC8 A;  3DPT A;  4WF2 A;  2XAH A;  2HOA A;  3KYC B;  3SEQ A;  3OSF A;  5D4S A;  4C30 A;  2ZME B;  5E20 A;  5DYM A;  3WTZ A;  3OYM A;  3COA C;  5L3E A;  5ICF A;  2R7O A;  1D8K A;  4MGR A;  2EIM H;  3K10 A;  2HZD A;  4PJN A;  5A2Q Z;  2E2H J;  3JRG A;  5D5X B;  2HTS A;  3ASN H;  1BC7 C;  4XRM A;  4RBO A;  1S8N A;  2O8X A;  3KP7 A;  3VSL A;  1TWG J;  4XLA A;  4XLP F;  4HDV A;  2AXL A;  1UHS A;  2E60 A;  4LJZ F;  2XC7 A;  2O9L A;  3RKW A;  9ANT A;  4A3B J;  2DI3 A;  4FQG A;  3BJO A;  2V1U A;  1R36 A;  4ZDP A;  3RTR A;  3I59 A;  4YFX F;  5D5W B;  3FHZ A;  3F3X A;  5L3D A;  4Z2Y A;  4BAC A;  1ZLK A;  1G6N A;  4ZTJ A;  5EYR A;  3GBG A;  3K4J A;  3CCY A;  3FZV A;  1RZ4 A;  3OYK A;  5ICE A;  1OMI A;  1WJF A;  4N4O B;  2HVR A;  2BY3 A;  1DUX C;  3S1Q J;  4QPQ A;  3GW2 A;  3RPQ A;  5H6R A;  3M9A A;  2MH9 A;  3HIF A;  2R7Q A;  4ZJZ A;  5GPA A;  4F52 A;  4RGU A;  4IZZ A;  4YEL A;  4KIC A;  1YW8 A;  2BHZ A;  2QYO A;  1B1B A;  3HUG A;  2P8T A;  4LLG F;  2HYF A;  5TJJ A;  4RMN A;  4B3A A;  2EBI A;  3R61 A;  3AL0 B;  3TO7 A;  3OIO A;  4N9I A;  2DN0 A;  3HUG B;  3ZQH A;  1U78 A;  1R5G A;  2LY1 A;  1BA5 A;  3ZN1 A;  2BBY A;  1T33 A;  1IF1 A;  2F6C A;  4KIS A;  3AG4 H;  3BQZ A;  1YS7 A;  2IGK A;  3ZMS A;  4BL0 B;  2DA2 A;  4LLN A;  1D0X A;  2DCE A;  3NAU A;  3L00 A;  1E2X A;  1UCR A;  1L0O C;  2DOF A;  2IP2 A;  5FKO A;  1PVE A;  2IGN A;  3ZQG A;  2D2W A;  3H9J A;  1RKT A;  2XSD C;  1G4D A;  3BPX A;  5IY5 H;  1J75 A;  4CCM A;  4C9Y A;  3NEU A;  1WZ2 A;  1N78 A;  4HNV A;  4HX4 A;  1OFC X;  3ZMT A;  4A6E A;  4HF1 A;  4B1R A;  1R1V A;  3QU3 A;  2HDW A;  1Z0X A;  1DU0 A;  4HBL A;  2Z3Y A;  3E6M A;  3VYS B;  3W2A A;  3EYI A;  2F5F A;  2WA0 A;  4A3I J;  4IHT A;  1Z7L A;  2W84 A;  2LVS A;  1N75 A;  1ON2 A;  1MIJ A;  3LOC A;  4NQW A;  4KNY A;  4K2E A;  3ABM H;  1HST A;  2LLK A;  2G7H A;  3O8G A;  1MMG A;  4IHX A;  3ZP5 A;  2NOJ B;  5JVG F;  3VYT B;  4BBR J;  1FYL A;  3QWL A;  4XSX F;  3MVP A;  2K7L A;  2NVX J;  1Y0U A;  3NWS A;  3J80 K;  2FNA A;  1VTN C;  4IRH A;  1O7L A;  4PCQ A;  4EV0 A;  5IOZ A;  3HOZ J;  1MNM C;  4EMS A;  4GCV A;  4Q5S F;  1YFH A;  1P92 A;  2M1B A;  2GZW A;  4F91 B;  1KYW A;  1W4M A;  4QWQ A;  1IN8 A;  2V6C A;  5IP9 J;  1Z6R A;  2R5Y B;  3K4C A;  3HRS A;  2ECB A;  2MW8 A;  3DTI A;  1FBU A;  1OQY A;  2OF7 A;  3B02 A;  2R7D A;  5EZH A;  1HOM A;  2P7V B;  5LD2 C;  2FOK A;  1R7J A;  3F8M A;  1O7F A;  3K2A A;  5IYD J;  3HB9 A;  3WG7 H;  2IS4 A;  5IP7 J;  1P7J A;  2D1H A;  2VXD A;  3DKW A;  2HDD A;  2JUG A;  5J6X A;  5B66 C;  3JSO A;  2V6E A;  1H9G A;  2QKM B;  1WKM A;  2M0M A;  4LFU A;  1ON1 A;  4NB5 A;  1XGO A;  3OR2 C;  1O57 A;  3E6C C;  1WH7 A;  1AHD P;  4Y15 A;  2DQR A;  2O0Y A;  3I56 I;  2DPU A;  2L4M A;  3ML6 A;  3H3U A;  3M7G A;  3H92 A;  3F21 A;  3CC4 I;  3E7L A;  3GLX A;  2EFW A;  1MNE A;  2DOD A;  3IRR A;  3IKV A;  1LUJ B;  2DK5 A;  1WIB A;  1FSH A;  5FD5 A;  1GDT A;  3MWM A;  5BPI A;  3O3K A;  3PFY A;  4WX9 A;  1A5J A;  2Z16 A;  2K5C A;  3BR5 A;  3LSH A;  2D45 A;  4HQE A;  2ACJ A;  3IKT A;  1UB9 A;  4M72 A;  1W5S A;  1JHF A;  3WTS C;  1XS9 A;  5HS9 A;  5LEK A;  2MD5 A;  3P9C A;  4BYY A;  4LG3 A;  3U1K A;  1TC3 C;  2XGX A;  2YX4 A;  3HRU A;  2ZB9 A;  3F8F A;  1I6X A;  3KEO A;  1I3Q J;  1P4W A;  5BOX A;  2M2E A;  2IA2 A;  2JMW A;  2KZG A;  3K1N A;  3JRI A;  1FTZ A;  2B9S A;  1O3Q A;  3UKG A;  1ODD A;  2Q2E A;  4EJT A;  4A3F J;  4XR6 A;  3I58 A;  3HL2 A;  2M87 A;  1SD6 A;  4BGD A;  2H27 A;  5M5W J;  3BQY A;  3WHC A;  1FSE A;  5EG0 B;  3ONQ A;  3FXQ A;  3BZC A;  4G6T B;  2JK3 A;  5E3N A;  2K85 A;  3BR0 A;  2Y30 A;  4PJL A;  3EUK L;  5AIQ A;  2DA1 A;  5GAG J;  2KKO A;  2OC6 A;  3IP4 B;  2DU9 A;  4M3D A;  3LAJ A;  3C2B A;  2IRF G;  3MZH A;  2PMH A;  1ERD A;  3VPR A;  1BR2 A;  1WVR A;  1DU6 A;  2XPU A;  2JZY A;  1X1A A;  3C7J A;  3QPS A;  3FIW A;  5DCM A;  2M9H A;  4DYR A;  3H5R A;  2MC3 A;  1UG0 A;  2IW5 A;  4DBR A;  4XIC A;  1VQ4 I;  3CCM I;  2BY1 A;  5DCM B;  2HI3 A;  3KZZ A;  1TWA J;  4C3I J;  3QYF A;  4RM3 A;  3L2W A;  1VQ6 I;  1R4N B;  2GQQ A;  1ZRC A;  2DOE A;  3DLL F;  2R92 J;  2R3S A;  4ESJ A;  3R4K A;  4OIN F;  1VQO I;  4WXC A;  2PN6 A;  5E79 C;  5D5U B;  4ESF A;  2KDZ A;  3MEX A;  5C44 J;  1TW3 A;  2XDV A;  3H9Q A;  2HU9 A;  4BBS J;  3L1P A;  2DTZ A;  4AIK A;  4NC8 A;  2IPQ X;  1VQ9 I;  3HYI A;  1QQI A;  1IRZ A;  3TW7 A;  5E1X A;  1XG1 A;  3OSG A;  2NXN B;  3GX4 X;  3HRT A;  4AM3 A;  4CYD A;  1HKQ A;  5HLH A;  1YIJ I;  2BEO A;  2VI6 A;  3CJT B;  3IV5 A;  3ZQI A;  4Q4Z F;  2O5R A;  4U0W A;  1FOW A;  4F3Q A;  2NS8 A;  3HHG A;  3TBI A;  2ID3 A;  2X6W A;  3P9K A;  1K6O A;  2RVC A;  2HQA A;  1J7K A;  1NG7 A;  2DFF A;  2VN2 A;  2EZK A;  4FE4 A;  4A3E J;  1EV7 A;  4BQO A;  1BBY A;  3M8E A;  4HLX A;  2HXI A;  1B4A A;  2CQQ A;  1K7A A;  2DA7 A;  5CVV A;  3IH4 A;  3TOA A;  5D6F A;  1Y6I A;  2P5V A;  3J81 K;  4KFC A;  2FBI A;  1Z6T A;  2EIL H;  4OIQ F;  1K79 A;  3SXY A;  1AU7 A;  4XOP A;  4M3E A;  2ZNY A;  2OA4 A;  4HNU A;  3QAH A;  1K4S A;  3GFM A;  5DD8 A;  2RN7 A;  3GTM J;  5B1A H;  2KJC A;  1ETX A;  4M9S A;  4KMF A;  5L3C A;  4UY8 I;  1TLH B;  4MEX F;  5HOD A;  1WJC A;  1QHG A;  3HPH A;  2VOO A;  2P7C B;  4J19 A;  5EZG A;  4RDU A;  3E5U A;  4EJV A;  2VT2 A;  2KRF A;  5DUK A;  2XB0 X;  1BR4 A;  2R7F A;  2HEO A;  2E19 A;  1Z05 A;  3C3W A;  2A3S A;  5FFX A;  3OY9 A;  2YPR A;  1S3J A;  5IT3 A;  3K70 D;  4HRI A;  1NK2 P;  2QSH X;  2CRG A;  1R9T J;  4U0Y A;  5M3M J;  3KPH A;  1EH8 A;  1S72 I;  2L9R A;  4RGR A;  3ZR8 X;  4AC0 A;  4ZC3 A;  1E3O C;  4BJT A;  2FU4 A;  3H1C A;  3PQJ A;  5DTD A;  1RIO H;  3GF2 A;  1JHH A;  5LEJ A;  3F6O A;  4BNC A;  1SVM A;  1YIO A;  4FX0 A;  3G1M A;  2E71 A;  5CPR B;  3R0J A;  3VWB A;  2HVS A;  2ADU A;  2A07 F;  4PK4 A;  1JXS A;  2OQG A;  2V1N A;  1SFU A;  1LDJ A;  3U21 A;  2O8K A;  4BE1 A;  1H8A C;  1NG6 A;  3N05 A;  5BNG A;  2RQQ A;  4I7H A;  1A31 A;  2WB1 N;  1WPK A;  2OPT A;  2Z2S B;  4B44 A;  1WJA A;  3GYH X;  3K4M A;  5JVT A;  3DBR B;  1UZC A;  3KP5 A;  3GUD A;  1ZYR F;  1J9I A;  1XSV A;  5D6E A;  3VSK A;  1YJ9 I;  3NAR A;  3Q0W A;  2X1E A;  5KAI C;  3ZQL A;  1IN4 A;  2XKO A;  3GFI A;  2ZC2 A;  1ZGW A;  3N4M A;  1SVO A;  5JLX A;  1C0W A;  5FRM A;  3E3V A;  2AQE A;  3FM5 A;  1T39 A;  2XF6 A;  4IOA F;  4B09 A;  1IN7 A;  5EEA A;  1W5C C;  2VE9 A;  4I09 A;  5DM6 F;  4BEH A;  4QIW N;  2HQR A;  3SQN A;  2JPC A;  1T56 A;  3VYR B;  2V1D A;  5B3S H;  2K9L A;  2E1C A;  1FTT A;  3ESW B;  3PNY A;  2VBW A;  3S1R J;  1RR7 A;  2H8R A;  3KZY A;  3K9T A;  2XGD A;  1R00 A;  2NVT J;  1SFK A;  1JI8 A;  3D0S A;  5CVR A;  3AAF A;  2VIX A;  2OAZ A;  3U2R A;  1PUE E;  2B63 J;  1ZLJ A;  2ELJ A;  1S7E A;  2QCO A;  3KEQ A;  1WSU A;  4D7M A;  1TTY A;  1MMD A;  3ZMZ A;  2HKX A;  1G2H A;  1K83 J;  3OOP A;  3Q9S A;  2DA6 A;  4Y17 A;  2L0K A;  4MNU A;  4XLC A;  3DEW A;  1KU2 A;  3GLL A;  4KN4 X;  3EPZ A;  2VXZ A;  4N0B A;  5DCF A;  1P4A A;  2CFO A;  2X4H A;  1A35 A;  3GZ5 A;  1VQ7 I;  1P9Q C;  1PUF A;  1IXC A;  1ZEL A;  1TNS A;  4RS8 A;  1T0F C;  4XID A;  1T8I A;  2HVQ A;  2JUC A;  4BH9 A;  1PUF B;  3S3M A;  4L5J A;  2WY7 Q;  2DA5 A;  3L2Q A;  1K78 A;  4KIF A;  3G1L A;  3V42 A;  4A3D J;  3BJA A;  2R7W A;  1WJB A;  4ITV A;  2DFE A;  3L9F A;  1K78 B;  1EJ9 A;  2L9S A;  4ZYH A;  1H9T A;  1GV5 A;  3GFL A;  4PJM A;  3BG9 A;  2STW A;  5EJC A;  3JAM Z;  3OS0 A;  1MSE C;  2CU7 A;  1BW6 A;  4JK1 X;  2P5K A;  3ZMV A;  2FQ3 A;  3H0G J;  4UUS A;  1SAX A;  1T98 A;  4HG2 A;  1MJ9 A;  3DTE A;  1SC7 A;  5E17 F;  1DP7 P;  2V1X A;  2M7B A;  3DP7 A;  1HDP A;  4G12 A;  2VKV A;  2XRN A;  2A68 F;  4CCK A;  2A6H F;  2XPW A;  3G71 I;  2IGO A;  2QUF A;  3C1D A;  1ZR2 A;  4XLH A;  3DTK A;  4L5I A;  4M71 A;  3D1N I;  1YLF A;  3PNV A;  2PMZ A;  2BV6 A;  2TRT A;  1ULY A;  1RES A;  3OYN A;  2VKH A;  2VE8 A;  4F92 B;  2FMY A;  3ABU A;  5KAF C;  1SD5 A;  4HLY A;  4BUP A;  3R6S A;  1BR1 A;  2GA1 A;  4XNF A;  4IF4 A;  2LC2 A;  3EUA A;  3RQI A;  2JA2 A;  3K69 A;  5K5Q A;  1IN6 A;  1IRF A;  5IOY A;  1FYK A;  2IBD A;  1XGS A;  3W2W A;  3DQV C;  1GXQ A;  1IW7 F;  2HOE A;  2MD0 A;  3HZJ A;  4EM0 B;  4XMY A;  1MSF C;  2VBX A;  3PUB A;  4XN3 A;  4LG0 A;  5DUI A;  3FIS A;  4DZJ A;  5HS8 A;  4XRS A;  1OR7 C;  4HST A;  3TP0 A;  5FLX K;  1ZAO A;  2ME6 A;  1KGS A;  3I55 I;  4LG0 B;  2DO7 A;  4QTR A;  1VND A;  3TOB A;  1V5E A;  2XGC A;  4S05 A;  4G6D A;  4XBF A;  1J0R A;  4E70 A;  3CF2 A;  2H1L A;  4AVP A;  1LDK B;  2ZFW A;  5H20 A;  4A5N A;  4AYB A;  2DMQ A;  4FCY A;  3QYB A;  2P4W A;  1M1E B;  5LHH A;  2FA5 A;  1ETK A;  2E1N A;  2IAI A;  2LKS A;  3ZPL A;  3O6B B;  2FQ4 A;  2QZ8 A;  1QZE A;  2JT1 A;  1MKM A;  3FM3 A;  3IUO A;  1TQI A;  2CW0 F;  4Q48 A;  5FFZ A;  3LA2 A;  1XDU A;  1LNW A;  3QYE A;  3Q5F A;  3C2G A;  5AON A;  1TWF J;  1ETV A;  1MBF A;  5EGO A;  2GXB A;  3GME A;  1RR8 C;  4WCG A;  2PJP A;  2DT5 A;  4XLN F;  4CZZ A;  2W82 A;  3WTT C;  3ASO H;  3UR3 C;  3P5J A;  4GYI A;  2ZSI B;  3EDP A;  4LIT A;  5KK1 A;  4BJ5 C;  4RB2 C;  2M45 A;  3FKJ A;  4EEF G;  3ZQF A;  5FLV A;  3BZ6 A;  1MBE A;  3HDD A;  4E7S A;  1CF7 A;  1G3S A;  1OIS A;  1V5G A;  5J1R A;  3WTY C;  4D7N A;  4H4K C;  5IP6 A;  1KA8 A;  5FD6 A;  4OMZ A;  1CF7 B;  3M3Y J;  5HLT A;  4RGX A;  2G7U A;  4E7K A;  3ROU A;  1QBJ A;  1T0F A;  5ILV A;  1Q1H A;  3W6V A;  3H3V K;  5CVU A;  1G8X A;  1OJL A;  1QVU A;  3M8F A;  1MH4 A;  3RDI A;  1MDM A;  4EGY A;  1JT6 A;  2GA2 A;  2LBF A;  5J40 A;  2VPL A;  2L02 A;  2XIG A;  5E8I A;  3F22 A;  4XON A;  1MDM B;  3PO3 J;  3MKL A;  3BCA A;  1H0M A;  2R7T A;  3LL7 A;  2LBF B;  4OAY A;  4A3M J;  2LKX A;  4B48 A;  1ZG3 A;  2HDC A;  5ED4 A;  1T95 A;  3SYT A;  1XMA A;  1BJA A;  1U2W A;  2OV7 A;  2NOG A;  3I59 B;  3WE2 A;  4YRV A;  5J8C A;  1QNT A;  1B72 A;  3BPV A;  1MZB A;  4J00 A;  3ZCO A;  1OCR H;  3WTX C;  3DBL B;  2RRE A;  2EZI A;  3LWF A;  1YX3 A;  3FXO A;  4DNC A;  1YX5 A;  1B72 B;  1OYI A;  4UVC A;  4Y4R A;  1KON A;  1YHQ I;  1UHW A;  4RLQ A;  2MG4 A;  1QZY A;  4A12 A;  1A6I A;  1SVL A;  5FB2 A;  3MKW B;  1GVD A;  2YU3 A;  3ZOB A;  1EH6 A;  2EWN A;  4MHG A;  5LBQ A;  4V2G A;  2UZK A;  1PP7 U;  3CDL A;  3BG3 A;  3KCC A;  3ELK A;  4AD9 A;  1SMY F;  2E1M B;  2I5U A;  1MBJ A;  3JRB A;  1D3Y A;  1SD7 A;  3WU0 A;  2E7W A;  1WJ5 A;  2BY0 A;  1W5T A;  4GYG A;  4BJ6 C;  3CCE I;  4M3G A;  2M34 A;  2MA3 A;  4WXD A;  2QEX I;  1D5Y A;  5EF6 A;  4CXF A;  1MJB A;  1POG A;  4L0Z B;  1YG2 A;  2Z33 A;  1OR7 A;  2KRC A;  3OYB A;  1QA6 A;  3HKZ N;  3L09 A;  2BHY A;  3E97 A;  5LGT A;  4XN0 A;  2VLA A;  5HS7 A;  3DWL E;  3HTU A;  2XAQ A;  1WH5 A;  4OIP F;  1WCM J;  4ZZL A;  5F27 A;  5ILS A;  4LB5 A;  1EKE A;  3OOU A;  2KPM A;  4PUS A;  1D0Z A;  3CP2 A;  4IHV A;  1TW2 A;  4NC6 A;  4CHU A;  4NQW B;  1BC8 C;  2Y2Z A;  2YSR A;  3P9I A;  3QU6 A;  5FKK A;  5EEG A;  2YU9 J;  1OLT A;  1J59 A;  3HBL A;  4OIO F;  1JTY A;  1KZH A;  5D8L B; 
#chains in the Genus database with same CATH homology
 2DT6 A;  4HPQ A;  2XDV A;  3H9Q A;  1MMS A;  2F4I A;  2HU9 A;  4KT6 A;  4OAZ A;  3CJQ B;  2ZSH B;  2LRE A;  4BXF A;  3OYA A;  4NC8 A;  4P1W A;  3CF5 F;  4CCN A;  2KMU A;  2LOO A;  3M1C A;  1D1C A;  2M7A A;  4XKV A;  4GRI A;  4PJJ A;  3L2V A;  2NXN B;  2H8W A;  3C2H A;  3PSI A;  4XKB A;  4HEA 2;  3CJT B;  1EA3 A;  2O5R A;  3H35 A;  4F3Q A;  3TBI A;  3LFU A;  4XQF A;  2X6W A;  1D1A A;  3H0D A;  2HQA A;  2LRD A;  2M4G A;  3F9K A;  3OIP A;  3LSI A;  1NG7 A;  2L9N A;  2RNG A;  4YEJ A;  4XKW A;  2A6T A;  3J7Y J;  4U87 A;  3VYU B;  4BQO A;  4D9J A;  2X6X A;  3PNT A;  4PSX A;  3OS1 A;  3S3O A;  1FMV A;  1IRX A;  2DOA A;  3OR1 C;  2E35 A;  2DT7 B;  3K4L A;  2IS1 A;  4CH7 A;  4AVZ A;  1Y6I A;  2CUJ A;  4HNT A;  3ZQQ A;  4C2U A;  1WFX A;  5CQE A;  3OYG A;  2VQG A;  1V5F A;  2GOM A;  4XOP A;  2X51 A;  4HNU A;  1PYV A;  4IQJ A;  3D5R C;  2IXS A;  4CUG A;  3CJR B;  1QU3 A;  3KEY A;  4IX7 A;  2UWM A;  4UY8 I;  3DLA A;  3PJR A;  2XF7 A;  1J09 A;  1WJC A;  2MC4 A;  5HVQ C;  2BW3 A;  1QHG A;  3HPH A;  2VQL A;  2BOL A;  2QKL B;  2BW3 B;  3DEE A;  4NNJ A;  3LSK A;  4XLE A;  1BR4 A;  4RLF A;  1AA7 A;  3TMO A;  3OY9 A;  4DOZ A;  3K70 D;  2KZV A;  4HRI A;  3K6G A;  2PJR A;  2Z1D A;  3OYF A;  1UEL B;  2CV0 A;  4XL9 A;  3FBN B;  3D5L A;  3ZR8 X;  3FBI B;  4ZC3 A;  2PJR B;  1DGR M;  4BJT A;  3AL0 C;  3K4N A;  3S93 A;  3A4C A;  2Q2E B;  2V4J C;  5CKT A;  2AQF A;  4XLF A;  3HG9 A;  2E1M C;  1Z3X A;  3E0J B;  4CSW A;  5CPR B;  3VWB A;  2R7S A;  2HVS A;  4PFP A;  4PK4 A;  3RPU D;  2E36 A;  2CV1 A;  2V1N A;  4V19 K;  3U21 A;  3OWT A;  2A5W A;  4EAT A;  4BE1 A;  1NG6 A;  3N05 A;  2RQQ A;  2E34 A;  3A2K A;  1WJD A;  2Z2S B;  4MLO A;  4B44 A;  1WJA A;  1X1D A;  3K4M A;  2JVG A;  3EUH C;  2VB6 A;  4DJA A;  3DPL C;  4E7Z A;  1W36 D;  3QOD A;  1X4O A;  3K70 C;  3IAM 2;  2W1O A;  1TZL A;  3VSK A;  3DKY A;  4BE0 A;  2W7N A;  3QOE A;  4II2 A;  4B47 A;  2KL4 A;  2X1E A;  3I3L A;  4BDZ A;  3RCO A;  3OYD A;  3KYL A;  2LH9 A;  3OYH A;  2ZXH A;  5FRM A;  2AQE A;  2L5Q A;  2XF6 A;  2IGM A;  2K3F A;  3PSF A;  2X85 A;  3H9G A;  4LIU A;  5DM6 F;  3HKZ A;  2HPI A;  4BEH A;  4FET A;  3MD2 A;  1GLN A;  3E1S A;  3CZ6 A;  4ZDL A;  3VYR B;  2CW7 A;  2K9L A;  3DU6 A;  3PNY A;  3HOT A;  1VZ0 A;  1N77 A;  2VJ5 A;  1D1B A;  1Y56 A;  2CMP A;  2V9K A;  3K4B A;  3MKZ A;  1K6Y A;  4LIV A;  3UNG C;  4BU2 A;  3HC7 A;  3HOS A;  3D5S C;  2VJI A;  1SFK A;  2E5Z A;  3OYI A;  4BQQ A;  1JI8 A;  3EGV B;  2VIX A;  3CJS B;  4KIT B;  3BG7 A;  3NWT A;  2ELJ A;  3BC8 A;  1LVK A;  3MMY B;  2P0W A;  5HNH A;  1UAA A;  4ANJ A;  1Z3Y A;  3BG6 A;  3CP8 A;  1MMD A;  5LFA A;  3HPG A;  2DJI A;  2UUZ A;  3OIQ A;  4ZTF A;  2L2O A;  4J01 A;  4XLC A;  2WAF A;  3MKY B;  3EPZ A;  2VXZ A;  1E0E A;  3H5N A;  2CFO A;  2KP6 A;  4U7B A;  2W4S A;  3DPT A;  1P9Q C;  1G59 A;  1ZEL A;  4P5O A;  3SEQ A;  1T0F C;  5JHF A;  2HVQ A;  4C30 A;  2X6Y A;  1U0J A;  3OYM A;  2R7O A;  3KX2 A;  3S3M A;  4NUB A;  4E4H A;  2Y0S A;  3K10 A;  2HZD A;  2WY7 Q;  4PJN A;  3L2Q A;  3V42 A;  2MFZ A;  3BLY A;  2R7W A;  1WJB A;  3S8P A;  5TGT A;  2L7K A;  4ITV A;  3L2U A;  4PFO A;  3VSL A;  4AU7 A;  4XLA A;  2L9S A;  2E60 A;  2XC7 A;  1DGW Y;  4PJM A;  3OS2 A;  4QPO A;  2MAB A;  4F55 A;  3OS0 A;  2WY8 Q;  4ZDP A;  3RTR A;  2R7U A;  1X19 A;  3H5A A;  3W2V A;  4BAC A;  3L2R A;  4ZTJ A;  4HG2 A;  4XOT A;  2R7R A;  4E7L A;  2KDO A;  3DTE A;  3GBG A;  2WBM A;  3K4J A;  3OYK A;  2M7B A;  2XSJ C;  2HVR A;  1WJF A;  4N4O B;  5GAH J;  4CCK A;  4QPQ A;  3J7Z I;  2IGO A;  4XLH A;  5KHD A;  3DTK A;  3HXL A;  2LG4 A;  2R7Q A;  2M4K A;  4ZJZ A;  3PNV A;  4F52 A;  4IZZ A;  1X4P A;  2PMZ A;  4XOR A;  4YEL A;  2FUG 2;  3OYN A;  2VKH A;  4RMN A;  4F92 B;  3AL0 B;  3BCB A;  4C2T A;  4BUP A;  3HUG B;  4RM2 A;  2LY1 A;  1BR1 A;  4XNF A;  4OWR B;  2LC2 A;  3EUA A;  2LYC A;  4ZYA A;  4R79 A;  1BOB A;  2KRH A;  2JA2 A;  2ZJQ F;  2F6C A;  2XF5 A;  3W2W A;  3DQV C;  2MD0 A;  4KIS A;  4BL0 B;  2IGK A;  4XMY A;  3PUB A;  1D0X A;  2BVM A;  2DCE A;  2VQH A;  2WAD A;  4XN3 A;  4Y3O A;  3FDY A;  4XM3 A;  2IGN A;  2R7X A;  1OR7 C;  4HST A;  3SEZ A;  3I9V 2;  3H9J A;  1DP3 A;  1R6R A;  4CCM A;  4C9Y A;  1YE9 A;  1N78 A;  3DU5 A;  2K3P A;  2VJ4 A;  4XKC A;  5HOO A;  2K9M A;  2JVH A;  1V5E A;  5GAD J;  2KLO A;  3ZXS A;  2XAU A;  3CF2 A;  1LDK B;  4AYB A;  2HDW A;  3TL4 X;  2VAS A;  3QYB A;  2LY2 A;  3A1Y A;  3VYS B;  3W2A A;  2WA0 A;  5DM7 F;  1D0Y A;  1Z7L A;  2WB1 A;  4BEH B;  1N75 A;  2CUZ A;  3IUO A;  3OL4 A;  1MMG A;  3QYE A;  3C2G A;  4CCJ A;  2NOJ B;  3SDB A;  3VYT B;  2JSP A;  2ZJP F;  2R7V A;  5KCM A;  3NWS A;  4N4N B;  1TT0 A;  2W82 A;  1W36 C;  3S32 A;  3UR3 C;  2V26 A;  2MYS A;  2ZSI B;  4LIT A;  4BJ5 C;  2VKD A;  2UV1 A;  1PJR A;  3OL3 A;  3FKJ A;  3G2B A;  4F91 B;  4E7S A;  1X1C A;  1FMW A;  3K4C A;  1V5G A;  4H4K C;  2VL8 A;  4KJZ A;  2DXI A;  2R4G A;  3DTI A;  4D1Q A;  2F5V A;  5HLT A;  3OYE A;  1LFP A;  5FRN A;  5LD2 C;  4E7K A;  3SZG A;  4IKF A;  1MMN A;  3CES A;  3OYL A;  1HA8 A;  4Y33 A;  4DGW B;  3VDX A;  4HSR A;  2E5N A;  2IS4 A;  3PL8 A;  2BVL A;  1G8X A;  2GOX B;  2OUM A;  2VXD A;  2JUG A;  3RQ4 A;  3ZRG A;  2LBF A;  3AFH A;  2VPL A;  2V6E A;  2QKM B;  2M0M A;  2X1C A;  4XON A;  2HNH A;  2CV2 A;  3OYJ A;  3BCA A;  2R7T A;  3S3N A;  3LL7 A;  3ZGK A;  3OYC A;  3OR2 C;  2LBF B;  4OAY A;  1X1B A;  4B48 A;  3J7A Y;  4CCL A;  3DKX A;  4E7J A;  4CCO A;  1T95 A;  3FHN A;  1MND A;  3SYT A;  5FRO A;  2ZFU A;  4E7H A;  2HPM A;  2CW8 A;  1WJE A;  2OV7 A;  1MNE A;  3LSG A;  2V7F A;  1LKX A;  4CA0 A;  1WIB A;  4YRV A;  2JQ7 A;  3OMY A;  4J00 A;  3ZCO A;  4DBQ A;  3PFY A;  2Z16 A;  1S9H A;  2RRE A;  1YX3 A;  2K5C A;  4F93 B;  3LSH A;  1YX5 A;  3DPU A;  2WAQ A;  1Z21 A;  4BE2 A;  4Y4R A;  4E6K G;  4ZDO A;  1KON A;  2VJJ A;  4RLQ A;  4LG3 A;  2I8D A;  3MKW B;  2KQR A;  4CZC A;  3LSM A;  4NC7 A;  2W00 A;  3K4K A;  3CMM A;  5CQG A;  4BS9 A;  2X1D A;  4XR6 A;  2E1M B;  3HL2 A;  1MMA A;  4BGD A;  1WJ5 A;  4FAS D;  4IQ4 A;  3ONQ A;  1QHH D;  4G6T B;  4BJ6 C;  2Q1Z B;  3RSN A;  4BDY A;  4JOM A;  4PJL A;  2WAE A;  3EUK L;  1SAU A;  2CS3 A;  2KRC A;  3OYB A;  4B43 A;  4X0G A;  2IS6 A;  5GAG J;  2OC6 A;  2VQC A;  4PSW A;  3IP4 B;  4XN0 A;  2VLA A;  3DWL E;  2IS2 A;  1ERD A;  1BR2 A;  5KNL A;  4B3X A;  1X1A A;  3IAS 2;  2ZXI A;  3H5R A;  4DIQ A;  1UG0 A;  3W3C A;  4DBR A;  4BQN A;  3OOU A;  2KPM A;  4PUS A;  3QYF A;  4RM3 A;  3L2W A;  1D0Z A;  3CP2 A;  3AKZ A;  4E7I A;  3LMM A;  2KHM A;  4NQW B;  4JQF A;  1DQU A;  2CH0 A;  2M3A A;  3M8J A;  5HNF A;  1OLT A;  4II3 A;  1MW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...